Indian Army - Jharkhand

40881354 bids are invited for dgeme revolving stools computer chairs 4 leg , electric engraving machine , brass kerosene blow lamp , heating touch , drill bit , metal files set needle , digital vernier calliper , combination chiesel set flat , combination chiesel set round , round leather hole punch , plastic hammer big , plastic hammer small , taparia nose plier , inspection camera , cutting plier total quantity : 24...

Department of Higher Education - Jharkhand

40878461 bids are invited for refixing of lab equipment ( q3 ) incubator ( large ) incubator ( small ) induction motor universal testing machine impact testing machine axial flow fan centrifugal fan fatigue testing machine demonstration of centrifugal pump direct shear test appartus pitot tube unconfined compression testing machine ammonia printing machine reciprocating pump hot air oven big hot oven weather monitoring instrument gas chamber gas cylinder scientico instruments permeability determination detaching bell detaching plate boring pipe inflamibility index apparatus drop warwick runway switch mono cable aerial ropeway air pollution monitoring instrument rope guide model pit top pit bottom setup different types of isolation stoping air crossing model scale levelling staff permeability testing instrument sieve shaker muffle furnace water tank model board model figure roller system u / g ground bulb holder victor patent jack hammer bit arrow type oil circuit bracker fuse canon oxygen tank electric haulage gear long gear motor with high item motor wheel electric driller jack hammer machine drilling rod model for board and pillar working model open cast mine long barometer u type thermometer 60 alctt20.b.nl retort stand tripod stand bunsen burner reagent bottle hot air oven test tube stand ( wooden ) bath tub funnel conical flask round bottom flask flat bottom flask beaker ( 1l, 2l, 500 ml, 250 ml ) pipette & cerological ( 5ml, 10ml, 25ml, 50ml ) pipette stand ( plastic & wooden ) kipps apparatus gas cylinder distillation unit ( glass ) stop watch watch glass triangular file test tube holder conductivity meter surface gauge electronic compact scale cork borer blow pipe tunnelling fork double mouth r bottle ( woulf bottle ) copper metal ( 500gm ) copper metal ( 100gm ) spirit lamp funnel measuring flask mortar & pettle ( big & small ) gas jar zeal ( thermometer ) burrette test tube ( 2 packet ) gas jar woulf bottle reagent bottle large thistle funnel pipette china dish curved footed glass bowl crushible with lid wire gauge glass bottle large 7 liters funnel retort beaker reagent bottle large conical flask measuring flask test tube glass tube bottle large for acid wooden hammer new tripod stand box wooden scale steel scale drawing table board stand base metal tripod stand wooden tripod stand ranging rod one seal pack ranging rod wooden nail box wooden box fill with iron nail iron chiesel long ranging rod middle size ranging rod big umbrella prism stand rod scale magnetic compass chart model for koepe winding system gfps 375 model for longwall mining method model for pit top layout model for mechanised o / c mining jack hammer sieve shaker compressor testing air compressor machine model for endless rope haulage layout model for pit bottom layout fire stopping model model for longwall method various type of temporary stopping air compressor machine air sampling equipment model model for roof stiching layout of manual b&p method layout of mechanised b&p method layout of manual b&p method model for supported metal minig method cylinderical winding drum model for unsupported metal mining method model of open closed system of power bi cylinderoconical winiding drum cylinderical winding drum conical winding drum short firing tool model for l / w method of working model of boxcut steel box tool anchor testing machine screw prop friction prop rotary compressor point load tester anchor testing frame safari bag bag monitor cable with magnet iron protodyknow strength index standard lab test siever air sampling pump gas monitor setup co detector box chart ( air break gate and box ) iron bar pipe long covered with plastic top slicing sub level caving model black box cover car injector cleaner tools trolley pipe bender wheel aligner tools trolley pipe type warley table clutch cut section radiator hydraulic press greese gun chain pulley hydraulic press anvil with stand tyre changer wheel balancing m / c cut section petrol engine cut section diesel engine electrical wire system work bench rock hydraulic press 2 wheeler electrical system nut bolt washing with 3 basin engine work bench special tool board with 12 fitting numeratic gun assembly ( gun regulator fitting spark plug cleaner tester hanger pneumatic bike rime manual hydraulic exhaust cut section ( hero honda engine ) 2 wheeler ignition system 2 engine set design tech ( board ) tyre pressure gauge steel stair alignment plate blue tool box 2 post lift rom trey oil can sock air compressor iron plate metallic sheet cylinder trolley working table welding m / c cylinder one cartoon safety apron one cartoon safety googles one cartoon welding googles exhaust line working cubical physical balancing white square shape stool potentiometer resonance column long scale meter bridge fire safety solution dead lift set bench press set four set butterfly hand press set body vibrator hop sort cross trainer spin bike trade mill air bag weight plate 25 kg weight plate 20kg weight plate 15 kg weight plate 10 kg weight plate 5 kg weight plate 8 kg weight plate 5 kg weight plate 2.2 kg weight plate 2 kg weight plate 1 kg weight rod long green colour dumbbell hand screw dumbbell weight plate holder stand iron rod usha sewing machine multipurpose sewing machine candle frame of different size gas cylinder with small stove 5kg spray machine 16l papad machine plate manufacturing machine gas cylinder regulator solar cooker honey bee small drum lathe m / c new lathe m / c old drilling m / c ( radial ) pillar drilling m / c lathe shaping m / c bench drilling machine old cutting m / c cylinder trolly old piller drilling m / c working bench wooden with 2 grinder and holding device god frame hmt old milling m / c old welding m / c spot welding m / c cylinder welding m / c ( with all component ) anvil with stand welding accessories kisok machine ( opac ) sensor gate common room gym machine dumbbell sewing machine knitting machine total quantity : 1...

Rajendra Institute Of Medical Science - Jharkhand

40861673 supply of printing items at rims, ranchi , list of printing items : , discharge form a 4 (65 70 gsm) , urine report form a 4 (65 70 gsm) , biochemistry report form a 4 (65 70 gsm) , angiography report form a 4 (65 70 gsm) , forensic medicine & toxicology form a 4 (65 70 gsm) , echocardiography form a 4(65 70 gsm) , blood plasma a 4 (65 70 gsm) , investigation form a 4 (65 70 gsm) , blood report form a 4 (65 70 gsm) , treatment chart a 4 (65 70 gsm) , critical care chart a 4 (65 70 gsm) , haematology form a 4 (65 70 gsm) , histopathology report form a 4 (65 70 gsm) , cytology body fluid report a 4 (65 70 gsm) , clinical section report form a 4 (65 70 gsm) , serology form a 4(65 70 gsm) , bacteriology form a 4 (65 70 gsm) , report of peripheral blood smear study a 4 (65 70 gsm) , leave performa a 4(65 70 gsm) , bed head ticket printing in both side a 4 (65 70 gsm) , blood donor questionnaire & consent form printing in both side a 4 (65 70 gsm) , c.t. scan mri/x ray report form printing a 4 in two colour (65 70 gsm) , blood donation certificateon century board paper a 4 (65 70 gsm) , dead body caring certificate a 4 (65 70 gsm) , viscera preservation performa a 4 (65 70 gsm) , report of stool examination a 4 (65 70 gsm) , report of body fluid examination a 4 (65 70 gsm) , seminal fluid analysis a 4 (65 70 gsm) , death certificate a 4 (65 70 gsm) , opd ticket a 4 (65 70 gsm) , tracer card on chart paper a 4 (65 70 gsm) , blood donor’s card on chart paper a 4 (65 70 gsm) , whole human blood group form a,b,o& ab diff. colour on demai paper (65 70 gsm) , visitor slip paper sample (post card size paper) , gate pass in two colour chart paper sample (100 120 gsm) , envelope ct scan with screen printing envelope paper 15’x18’’ (100 120 gsm) , envelope mri screen printing envelope paper 15’’x18’’ (100 120 gsm) , envelope x ray 9’’x11’’ envelope (100 120 gsm) , envelop x ray 13”x13” envelope paper (100 120 gsm) , envelope x ray 13’’x11’’ envelope paper (100 120 gsm) , envelopex ray 13’’x16’’ envelope paper (100 120 gsm) , money receipt book with numbering & perforation and marking pad 100 each (65 70gsm) , fly leaf cloth past standard size180 gsm , investigation form a 4 , any other form one side a 4 , any other form both side a 4 , any other form one side a 3 , any other form both side a 3 , envelop 7’’x13’’ (100 120 gsm) , certificate a 4 size 180 gsm , any form half of a4 size , daily progress sheet doctor (size a 3) , investigation chart (size a 3) , daily progress sheet nursing (size a 3)...

Rajendra Institute Of Medical Science - Jharkhand

40861669 tender for supply of chemical items at rims, ranchi 1 list of chemicall items : 2 20*c mini cooler ( it should be made up of polycarbonate and non toxic gel, must contain atleast 12 places for 1.5ml tube. ) 3 0.1 gparacetic acid other ingredients : corrosion inhibitors, surfactants, stabilising agents, excipients. hydrogen peroxide, acetic acid passes en 13624, en 13727, en 14348, en 14347, en 14476 standards, pack size: 5 litre jar 4 0.5 % w / v chlorhexidine gluconate and 70 % v / v ethanol500 ml 5 1% w / v available iodine in nonoxynol iodine surfactant500 ml 6 1*tae buffer 7 1, 4 dithiotreytol ( dtt ) solid ( powder ) 25 gm 8 2* ab enzymatic reaction stop solution h2so4 paraformaldehyde glutaraldehyde solution, 25% w / w 1 gm 9 2.45% w / v glutaral dehyde with a powder activator completely free of surfactants 5ltrs 10 20 40% phosphoric acid based scale remover ltr. 11 2 mercaptoethanol ( ? me ) liquid 100 ml 12 2 methoxy ethanol ( 250mg ) ( purity ( gc ) > 99.75 % ) 13 2 propanol ip: 45 g / isopropanol, 1 propanol: 30 g / n propanol ethyl hexadecyl dimethyl ammonium ethylsulphate: 0.2 g emollient and moisturiser with skin protecting substances 500 ml bott with dispenser passes en 13727, en13624, en14476, en1500, en12791 standards, pack size: 500 ml bottle 14 4 methylumbelliferone ( 100gm ) ( purity ( hplc ) =98 %, mol. wt 198.2 ) 15 4 methylumbelliferyl ? d glucopyranoside ( 25mg ) ( to be used in prenatal diagnosis, analytical grade ) 16 4 methylumbelliferyl ? d galactopyranoside ( 1gm ) ( =99% ( tlc ) ) 17 4 methylumbelliferyl ? d galactopyranoside 6 sulfate sodium salt ( 5gm ) ( hplc purified, =90% ) 18 4 methylumbelliferyl 6 sulfo n acetyl ? d glucosaminide, potassium salt ( 25mg ) ( to be used in prenatal diagnosis, analytical grade ) 19 4mu beta d glucopyranoside ( 250mg ) ( purity ( hplc ) > 99 % ) 20 4 mu alpha d gluco pyronoside ( 100mg ) ( purity ( tlc ) > 99 % ) 21 50x tae 500 ml 22 60%v / v ethyl alcohal with benzalkonium chloride, glycerine, dimethiconecyclopentasiloxane, c12 15 alkyl lactate, proylene glycol, methylparaben, phenoxythanol, stearyl alcohol, aminomethyl propanol, diazolidinyl propanol, diazolidinyl aurea with moisturizer 500 ml 23 6 mercaptohexanoic acid ( 1gm ) ( laboratort reagent grade, 90.0% ) 24 7 colour setup 1000 pcs 25 a.s.o. titre ( rapid test kit ) 100 test 26 absolute acid 500 ml 27 absolute alcohol 2.5 ltrsshould be 99.9 %boiling point = 78.3°c ( 1013 hpa ) melting point = 117°cdensity = 0.7895 gm / cm3 ( 20°c ) flash point = 12°c ( closed cup ) ethanol content percent by volume at 15.6°c = 99.50alkalinity = nilacidity as acetic acid percent by weight = max. 0.006 ( 60 ppm ) residue on evaporation percent by weight = max. 0.005 ( 50 ppm ) copper as gm / 100ml = max. 0.0004 ( 4 ppm ) ester as ethyl acetate gm / 100ml = max. 0.02 ( 200 ppm ) aldehyde as acetaldehyde gm / 100ml = max. 0.01 ( 1000 ppm ) 28 absolute alcohol 500 ml 29 ace control level 1 100 ml 30 acetamide agar 500 gm 31 acetic acid 500ml ( laboratory chemical ) only for industrial, institutional and research purposes, not for drug 32 acetic acid 2.5 ltrs 33 acetic acid 200 ml 34 acetic acid 250 ml 35 acetone 25 ml 36 acetone 5 l mol. wt. = 58.08 gm / moldensity = 0.7845 gm / cm3melting point = 94.7°cboiling point = 50.05°csmell = fruity 37 acetone 500 ml 38 acetonitrile ( ico grade ) liquid 100 ml 39 acid based liquid neutralizer concentrate to be used with dosing pump.nos. 40 acid fuchsin 1% 100 ml 41 acid fuchsin 1% 125 ml 42 acid fuchsin solid ( powder ) 25 gm 43 acid glycoprotein 100 gm 44 acid orthophoaphoric 500 ml 45 acid phosphatase 10x2ml 46 acp 100 ml 47 acrylic cold curve liquid 500 ml 48 acrylic cold curve powder 250 gm 49 acrylic colours 500mla. blackb. dark greenc. maroond. ultramarine bluecan be used on variety of surfaces. stays permanent on paper earth ware, wood, thermocot, stone etc., wash proof rich in colour value, quick drying and ready to use and requires no separate medium 50 actidione with agar 500 gm 51 activated charcol 500 gm 52 ada control 100 ml ( compactible with dirui cst240 ) 53 ada enzymetic 25ml 54 ada with calibrator 100 ml ( compactible with dirui cst240 ) 55 adenovirus, stool, antigen, premiere adenoclone, ridascreen; r.biopharma 56 adrenaline hydrochloride 500ml 57 af media 100ml bottle ( ready to use, media should contains fetal bovine serum ( fbs ) , gentamicin, and l glutamine. ) 58 afp 1 ml 59 afst disc fluconazole amphotericin itraconazole 100 disc 60 agar powder 500 gm 61 agarose 500 gm 62 agarose powder 250gm ( to be used for nucleic acid separation, tested dnase and rnase free, high grade ) 63 ahg 5 ml 64 albert’s stain – a – 250 gm each 65 albert’s stain – a – 250 ml each 66 albert’s stain – b – 250 gm each 67 albert’s stain – b – 250 ml each 68 albumin bcg 100 ml 69 albumin bcg 250 ml 70 albumin kit 3x150ml 71 alcian blue 10gm 72 alcian blue 500ml 73 alcian blue 8gx 100 ml 74 alcian blue satain ( ph 2.5, 100ml / pack size ) 75 alcian blue solid ( powder ) 5 gm 76 alcohol 90% 2 ltrs 77 alcohol ethyl 500ml 78 aliquote cup ( centrifuge tab 1.5 ml ) 500 pc 79 alizarin red s 100 ml 80 alizarin red s 125 ml 81 alizarin red s 125 ml 82 alkalian blue 100 ml 83 alkaline peptone water 100 ml 84 alkaline peptone water 25 x 5 ml 85 alkaline phosphatase kit 100 ml 86 alkaline phosphatase kit 20x15ml 87 alkyl alcohol ethoxilate 20 40%, sodium benzoate, 5% based emulsifier 1 ltr. 88 alkyl dimethyl benzyl ammonium chloride ( in house ) ( 2.37 % ) alkyl dimethyl ethyl benzyl ammonium chloride ( in house ) ( 2.37 % ) inert ingredients ( 95.26 % ) 1 ltr 89 alkyle dimethyle benzile ammonium chloride ( in house ) ( 2.37% ) inert ingrediets 95.26% 1 ltr 90 alp 100 ml 91 alpha nepthyl butyrate 500 ml 92 alt ( sgpt ) 100 ml 93 alt ( sgpt ) 2x150ml 94 altl / sgpt 100 ml 95 altl / sgpt 2x150 ml 96 aluminium ammonium sulphate 500 gm 97 aluminium ammonium sulphate 500 ml 98 aluminium foil each pack 99 aluminium potassium sulphate [ potash alum ] 500 gmf. wt. = 474.39assay nlt = 99.0%ph ( 10% solution at 20°c ) = 3.0 4.0chloride ( cl ) nmt = 0.0005ammonia ( nh4 ) nmt = 0.005%iron ( fe ) nmt = 0.005%lead ( pb ) nmt = 0.0005 % 100 amacr 1 ml 101 amdinocillin 10 mcg 102 amh elisa kit 96 tests 103 amikacin ( antibiotic disc ) 10 mcg ( 250 disc ) 104 amikacin ( antibiotic disc ) 30mcg ( 250 disc ) 105 ammonia solution 2.5 ltrs about 25% m = 17.03 g / mol ( 1l = 0.90 kg ) specification: assay ( nh3 ) = 25 %non volatile substance = 0.002 % 106 ammonia solution extrapure ar, 25% liquid 500 ml 107 ammonium acetate solid ( powder ) 100 gm 108 ammonium acetate solid ( powder ) 500 gm 109 ammonium chloride 500 gm 110 ammonium citrate – 500 gm 111 ammonium citrate – 500 ml 112 ammonium hydroxide 500 ml 113 ammonium molybdate 100 gm 114 ammonium molybdate 500 gm 115 ammonium oxalate 250gm 116 ammonium oxalate 500ml 117 ammonium persulphate, solid ( powder ) 25 gm 118 ammonium solution 500 ml 119 ammonium sulfonate 500g bottle ( acs reagent, 99.0 100.5% ) 120 ammonium sulphate 250 gm 121 ammonium sulphate 500 gmassay = 98.5 %nvm = 0.2 %chloride = 0.005 %iron = 0.002 %lead= 0.002 %10 % aqueous solution clear and colourlessspecification: specific rotation ( [ ? ] 20° / d; c = 10 water ) = +51 to +53°melting range = 145°c 150°cchloride = 0.005 %sulphate = 0.01 %sulphites = passes testarsenic = 0.0001 %iron = 0.0005 %heavy metals ( as pb ) = 0.0005 %loss on drying ( 105°c ) = 0.5 %sulphated ash = 0.1 % 122 amoxicillin 10 mcg ( antibiotic disc ) ( 250 disc ) 123 amoxicillin 2 mcg + clavulanic acid 1 mcg ( antibiotic disc ) ( 250 disc ) 124 amoxicillin 25 mcg ( antibiotic disc ) ( 250 disc ) 125 amoxicillin clavulanate disc 20 mcg ( antibiotic disc ) ( 250 disc ) 126 amoxycillin clavulanate ( antibiotic disc ) 10mcg ( 250 disc ) 127 amphetamines 100 ml 128 amphotericinb powder ( solubilized powder, g irradiated ) 50 gm 129 amphotericin b ( mic e test strip ) 130 amphotericin b mic e strip 131 ampicillin ( antibiotic disc ) 10 mcg ( 250 disc ) 132 ampicillin 2 mcg ( antibiotic disc ) ( 250 disc ) 133 ampicillin 25 mcg ( antibiotic disc ) ( 250 disc ) 134 ampicillin sulbactum ( antibiotic disc ) 10mcg ( 250 disc ) 135 amulgeum pluger 136 amyl of isoamy alcohal 500ml 137 amylase 100 ml 138 amylase kit 2x30ml 139 ana screening elisa kit 96 tests 140 anaerobic gas pack 1.5 ltr. 141 anaerobic gas pack 3.5 ltr. 142 anaerobic indicator strip 143 anaerobic indicator tablet 144 ? naphthol 500 gm 145 andrades indicator 100 ml 146 andrades indicator 125 ml 147 anhydrous ammonium bicarbonate anhydrous liquid 500 gm 148 anhydrous anhydrous aluminum chloride 100 ml 149 anhydrous anhydrous aluminum chloride 500 gm 150 anhydrous anhydrous ferric chloride 30% 100ml 151 anhydrous anhydrous ferric chloride 30% 500 gm 152 anhydrous anhydrous sodium hydroxide ( naoh ) pellet 250 gm 153 anhydrous anhydrous sodium hydroxide ( naoh ) pellet 500 gm 154 anhydrous anhydrous sodium phosphate monobasic ( nah2po4 ) 500 gm 155 anhydrous calcium carbonate anhydrous 156 anhydrous dextrose anhydrous purified 500 gmspecification: specific rotation ( [ ? ] 20° / d; c = 10 water ) = +51 to +53°melting range = 145°c 150°cchloride = 0.005 %sulphate = 0.01 %sulphites = passes testarsenic = 0.0001 %iron = 0.0005 %heavy metals ( as pb ) = 0.0005 %loss on drying ( 105°c ) = 0.5 %sulphated ash = 0.1 %should be 99.9 %histopathology grade 157 anhydrous diethylenediamine anhydrous ( piperazine ) 100 gm 158 anhydrous di sodium hydrogen phosphate anhydrous 100 gm 159 anhydrous lithium chloride anhydrous 100 gm 160 anhydrous phenol anhydrous 100 gm 161 anhydrous potassium phosphate di basic anhydrous 5 kg [ di potassium hydrogen phosphate anhydrous ] assay nlt = 98.0 %ph ( 5 % aqueous solution ) = 8.5 9.6maximum limits of impurities • chloride = 0.005 %• loss on drying ( 105°c ) = 1.0 % 162 anhydrous potassium phosphate di basic anhydrous 500 gm ( di potassium hydrogen phosphate anhydrous ) k2hpo4mol. wt. = 174.17 163 anhydrous sodium acetate anhydrous 500 gm 164 anhydrous sodium carbonate anhydrous 500 gmminimum assay ( acidimetric ) after drying = 99.5 %maximum limit of impuritiesmoisture = 1.5 %chloride = 0.01 %silicate = 0.02 %sulphate = 0.02 %lead = 0.03 % 165 anhydrous sodium carbonate anhydrous 500mlminimum assay ( acidimetric ) after drying = 99.5 %maximum limit of impuritiesmoisture = 1.5 %chloride = 0.01 %silicate = 0.02 %sulphate = 0.02 %lead = 0.03 % 166 anhydrous sodium phosphate dibasic anhydrous 500 gmassay nlt = 99.0 %ph ( 5 % aqueous solution ) = 8.7 9.4maximum limits of impurities • loss on drying ( 105°c ) = 0.5 %• heavy metals ( pb ) = 0.001 %• chloride = 0.01 % 167 anhydrous sodium sulphate anhydrous 500 gm 168 anhydrous sodium thiosulphate anhydrous 1 kg 169 anhydrous tetra sodium pyrophosphate anhydrous 100 gm 170 anidulafungin ( mic e test strip ) 171 anidulafungin powder ( solubilized powder, g irradiated ) 172 aniline blue solution 100 gm 173 aniline blue solution 500 gm 174 anti – a 10 ml 175 anti – b 10 ml 176 anti – d 10 ml 177 antisera for escherichia coli o157:h7 2 ml 178 anti a1 lactin 10 ml 179 anti ab serum 10 ml 180 anti d igm 10 ml 181 anti d rhofinal 10 ml 182 anti h lactin 5 ml 183 anti hcv ab elisa 1 x 96 184 anti human globin 5 ml 185 anti sera for salmonella typhi poly h 2 ml 186 anti sera for salmonella typhi poly o 2 ml 187 anti sera for shigella species 2 ml 188 anti sera for vibrio cholerae classical 2 ml 189 anti sera for vibrio cholerae eltor 2 ml 190 anti streptosylin 100 ml 191 antibiotic zone scale 192 antigen ( og4c3 ) detection elisa kit for wuchereria bancrofti 193 antigen v.d.r.l. 250t 194 antisera kit for salmonella 195 antisera kit for shigella 196 antisera kit for vibrio 197 antitrypsin 100 ml 198 apo cal 5 point 100 ml 199 apo calibrator 100 ml 200 apo a 100 ml 201 apo b 100 ml 202 apt broth 500 gm 203 aptt reagent 3ml 204 aptt reagent 5 ml 205 aq potassium permanganate 0.25% 100 ml 206 aqua peg 40 hydrogenated castor oil, glycerin, aroma, sodium gluconate, sucralose, octinidine hcl, citric acid, bht 207 aqua winth apip 500 ml 208 aqua, cocanidopropylamine oxide peg 7 glyceryl cocoate, glycerin hydroxyethyl cellolose, lactic acid, octenidine hcl, allantion 209 aqua, glycerine cocamidopropylamine oxide, sodium lactate, allantion, octenidine hcl ethylhexyl glycerine 210 aqueous citric acid 0.5% 100 ml 211 aqueous phenol 5% 500 ml 212 aqueous silver nitrate 5% 100 ml 213 aqueous sodium metabisulphite 1% 100 ml 214 aqueous sulphuric acid ( h2so4 ) 3 % 250 ml 215 arginine decarboxylase broth 216 asparagine proline broth 217 asparagine 100gm 218 ast ( sgot ) 100 ml 219 ast ( sgot ) kit 2x150ml 220 ast sensitivity disc 5x250 d 221 astrovirus, stool, antigen, ridascreen, drg international r.biopharma 222 atcc e. coli 25922 223 atcc e. coli 35218 224 atcc staphylococcus aureus 25923 225 atcc staphylococcus aureus baa 1708 226 atropine 500 ml 227 atropine sulphur 25 gm 228 atropine sulphur 500 ml 229 au consumables kit 1 kit 230 auramine o 100 gm 231 auramine o 1000 ml 232 auramine o 250 ml 233 auramine o 500 ml 234 australia antigen ( 0.3 ng / ml ) 100 test 235 auto pipette fixes 100 micro litre 236 auto pipette fixes 200 micro litre 237 auto pipette fixes 50 micro litre 238 autoclavable l spreader for ast 239 automated rapid mycobacterium culture differentiation and sensitivity system ( liquid culture ) 240 available iodine ( 1.0 % w / v ) 241 available iodine ( 1.0% w / v ) and watersoluble base ( contain sodium iodide and surfactant ) manufacturer / marketing company should be certifying according to din en iso 242 available iodine 1% w / v in an aqueous <5 sodium iodide, <1 surfactant base, <88 water shelf life of 5 years, pack size: 500 ml bottle 243 azithromycin ( antibiotic disc ) 15mcg ( 250 disc ) 244 azlocillin ( antibiotic disc ) 75mcg ( 250 disc ) 245 azlocillin 30 mcg ( antibiotic disc ) ( 250 disc ) 246 aztreonam ( antibiotic disc ) 30mcg ( 250 disc ) 247 bacitracin 20 mcg ( antibiotic disc ) ( 250 disc ) 248 bacitracin disc ( antibiotic disc ) 16mcg 250 disc 249 bacterial antigen rapid latex agglutination test for meningitis 100 test 250 bag autoclavable bags 900g ( size 12x24, transparent bags ) 251 bag autoclavable bags, size s ( 8x12 ) ( should be high grade plastic, for autoclavable, for laboratory use ) 252 bag autoclavable bags, size l ( 14x19 ) ( should be high grade plastic, for autoclavable, for laboratory use ) 253 bag b bag double – each 254 bag b bag paediatric each 255 bag b bag penta – each 256 bag b bag quadruple – each 257 bag b bag triple – each 258 bag biohazard bag medium ( discarding pouch ( red – black ) sizes 12 x 12 for syringe & needle discarding ( 100 pieces / pack ) ) 259 bag biohazard bag small ( discarding pouch ( red – black ) sizes 8 x 12 for gel & tips discarding ( 100 pieces / pack ) ) ) 260 bag biohazard bags large ( autoclaveable ) each bag 261 bag biohazard bags medium ( autoclaveable ) each bag 262 bag blood bag single – each bag 263 bag sample bags 96w 264 bag top to bottom each 265 bag top to top each 266 bag zip lock bags each 267 band aid round 268 baramathymol blue 500 ml 269 barbitone 500 ml 270 barbiturates 100 ml 271 barbituric acid, solid ( powder ) 25 gm 272 barium carbonate 500gm 273 barium chloride 500 gm 274 barrit reagent a 250 ml 275 barrit reagent b 250 ml 276 basic fuchsin 0.15% 500 ml 277 basic fuchsin 0.5% 500 ml 278 bd facs lysing solution 1pc 279 bd facs permebilizing solution 1 pc 280 b d glucan test for aspergillus each kit 281 beaker 100 ml 282 beaker 1000 ml 283 beaker 250 ml 284 beaker 500ml each 285 beaker 2000ml each 286 beef extract powder 250 gm 287 beef extract powder 500gm 288 benedict’s reagent 5l qualitative laboratory reagent for detection of sugar in urine. 289 benedict’s solution 500mlappearance = clear pale blue liquidodourlessmelting point = 0°c ( 32°f ) waterboiling point = 100°c ( 212°f ) waterevaporation rate < 1vapour pressure ( mmhg ) = 14 watervapour density ( air ) =1 = 0.7 waterspecific gravity = 1 ( water ) solubility complete 290 benzalkonium chloride solution ip ( 0.5 % v / v ) , equivalent to benzalkonium chloride ( 0.25 % w / v ) 500 ml 291 benzidine powder 100 gm 292 benzidine powder 25 gm 293 benzidine powder 250 gm 294 benzidine powder 500gmmelting range = 127°c 129°csolubility in ethanol to pass testsulphated ash = max. 0.05 %sulphate to pass test. 295 benzodiazepines 100 ml 296 benzoic acid 500 gm 297 benzoic acid 500 ml 298 beta mercaptoethanol 200 ml 299 beta 2 macroglobulin 100 ml 300 betadine 10% 250 ml 301 betadine 10% 500 ml 302 betaxolol 25% 303 betaxolol 85% 304 bicarbonatecalibrator 100 ml 305 bicarbonatecalibrator 125 ml 306 bile esculin azide agar 500 gm 307 bile esculin disc pack of 100 disc 308 bile esculin powder 250 gm 309 bile esculin powder 500 gm 310 bilirubin kit 2x250ml 311 bilirubin kit 4x60ml 312 billirubin d 100 ml 313 billirubin total 100 ml 314 biochemical test kit for identification of acinetobacter species kit ( 24 t ) each kit 315 biochemical test kit for identification of bacillus species kit ( 12 t ) each kit 316 biochemical test kit for identification of candida species kit ( 12 t ) each kit 317 biochemical test kit for identification of enterobacteriaece ( 24 t ) each kit 318 biochemical test kit for identification of gram negative rods kit ( 12 t ) each kit 319 biochemical test kit for identification of listeria species kit ( 12 t ) each kit 320 biochemical test kit for identification of neisseria species kit ( 12 t ) each kit 321 biochemical test kit for identification of nonfermentor kit ( 24 t ) each kit 322 biochemical test kit for identification of salmonella species kit ( 12 t ) each kit 323 biochemical test kit for identification of shigella species kit ( 12 t ) each kit 324 biochemical test kit for identification of staphylococcous species kit ( 12 t ) each kit 325 biochemical test kit for identification of streptococcus species kit ( 12 t ) each kit 326 biochemical test kit for identification of vibrio cholerae kit ( 12 t ) each kit 327 biochemical test kit for identification of vibrio species kit ( 12 t ) each kit 328 biotin 4 amidobenzoic acid sodium salt50mg ( purity ( tlc ) > 95 %, mol wt. 385.4 ) 329 bismarck brown 100 gm100gm glan bottledye content 50 %solubility = h20 : 10mg / ml clear to turbid red orange to redform = powdergrade = certified by biological stain commissionquality level = 100 330 bismarck brown 25 gm 331 bismuth sulphite agar 100gm 332 blade blade for cryostat ( frozen ) 333 blade cryostat blade for leica – 50 pcs ( proprietary item ) low profile made of stainless steel with high durability.disposable blades81980 mm long x 8 mm high x 0.25 mm thick blades 334 blade microtome blades – 50 pcs ( proprietary item ) high profile 335 bleach hydrogen peroxide of minimum 30% and oxygen based bleaching agent 5 ltr. 336 bleach sodium hydroxide maximum 5% based bleaching agent 5 ltr. 337 blood agar base – 250 gm 338 blood agar base 500 gm 339 blood free campylobactor agar 340 blood urea nitrogen 100 ml 341 blood urea nitrogen 2x150ml 342 bolton broth ( base ) 343 bolton selective supplement 344 bone marrow aspiration needle – metal, reusable , salah type with component includingtrocar , cannula & adjustable side guardsize –no 14 , no – 16 & no – 18 g , 5 cm longneedle 345 bone marrow biopsy needle ergonomic handle.material : stainless steel remover guide provided with indicators to facilitate the sample expulsion and that allows samples lenght check. provided with a special lock for a safe removal of the sample 346 boric acid 500 gm 347 bottle blood culture bottle ( conventional ) adult 50 ml each 348 bottle blood culture bottle 100ml 349 bottle blood culture bottle 125ml 350 bottle blood culture bottle 30 ml 351 bottle blood culture bottle ( conventional ) pediatrics each 352 bottle brown bottle reagent 1000 ml 353 bottle brown bottle reagent 250 ml 354 bottle brown glass bottles 100 ml 355 bottle clear glass bottles, volume 1000ml ( clear glass bottle with screw cap for laboratory use ) 356 bottle clear glass bottles, volume 250ml, ( clear glass bottle with screw cap for laboratory use ) 357 bottle clear glass bottles, volume 500ml ( clear glass bottle with screw cap for laboratory use ) 358 bottle clear glass bottles, volume 2000ml ( clear glass bottle with screw cap for laboratory use ) 359 bottle drop bottle each 360 bottle mc cartney bottle 30ml each 361 bottle myco f bottle each 362 bottle reagent bottle – 100 ml ( silicate with droper cap – 100 pc ) 363 bottle reagent bottle 1lit 364 bottle reagent bottle 500ml 365 bottle reagent bottle 100ml 366 bottle reagent bottle 125ml 367 bottle reagent bottle 250ml 368 bottle spray bottles each 369 bottle sprey gun with bottle ( 500 ml ) nos. 370 bottle sqeeze bottle each 371 bottle universal bottle 30 ml with screw cork 372 bottle universal bottle glass withrubber washer and cap 500 pcs 373 bottle wash bottle 500ml 374 bottle wash bottle 250ml 375 bovin serum albumine 10mg ( agarose electrophoresis > 96 %cell culture test pass ) 376 bovine albumin 22% 10 ml 377 box autoclave biological indicator box ( geo.atropheus ) 50 x 1 ml 378 box bowie – dick compact box 379 box cap box each 380 box cryo box ( 1 ml ) ( each pack 500 vials ) 381 box cryo box 1.8ml box of 04pcs 382 box cryo boxes ( 5ml ) 4x5 ml 383 box cryo boxes ( 5ml ) each 384 box eto indicator box 385 box gluffs boxeach 386 box micro pore box each 387 box plasma casset box 388 box slide box 389 box softner water kit box each 390 box steam emulating indicator box 391 box sterilization indicator box 392 box tip box 0.2 10μl 393 box tip box 200 1000μl 394 box tip box 2 200μl 395 brain heart infusion agar 250 gm 396 brain heart infusion agar 500 gm 397 brain heart infusion broth 250 gm 398 brain heart infusion broth 500 gm 399 brain heart infusion broth powder 250gm 400 brain heart infusion broth powder 500gm 401 bramathymol blue 125ml 402 bramathymol blue 500 ml 403 brilliant cresyl blue solution 100gm 404 brilliant cresyl blue solution 25gmdark green colour powderabsorption maxima = 623 628specific absorptivity of 1% / 1cm ( ?max = 0.005 gm / l ) melting point = 233 236°c 405 brilliant green bile broth 2% 125 ml 406 bromine sample 250 gm 407 bromo phenol blue 500 ml 408 bromo phenol blue powder 10 gm 409 bromothymol blue 125gm 410 brucella igm elisa 96 w 411 brucella slide agglutination test 412 brush cyto brush – material plastic color white packaging type box to minimize trauma 413 brush test tube brush each 414 brush washing brush 12” 415 brush washing brush 6” 416 buffer saline sodium citrate buffer 500 ml 417 buffer for seroprotin electrophoresis each 418 buffer solution hemoglobin 1000 ml 419 buffered formal acetone 500 ml 420 buffered peptone water 421 butane gas 422 c reactive protein kit ( rapid test kit ) 100 test 423 c3control level 1 100 ml ( compactible with dirui cst240 ) 424 c3with calibrator 100 ml ( compactible with dirui cst240 ) 425 c3 100 ml 426 c4control level 2 100 ml ( compactible with dirui cst240 ) 427 c4 100 ml 428 c4 with calibrator 100 ml ( compactible with dirui cst240 ) 429 ca125 1 ml 430 calamine powder 250 gm 431 calcium arsennazo111 100 ml 432 calcium chloride powder 500 ml 433 calcium choride solution for aptt 10ml 434 calcium kit 2x150ml 435 calcium oxide 250 gm 436 calcium oxide 250 ml 437 calcium phosphate dibasic dihydrate 500 gm 438 calcium sulphate 500 gm 439 calcium sulphate 500 ml 440 calcium sulphate dihydrate 500 gm 441 calcoflour white 100 ml 442 calcoflour white 25 ml 443 calcoflour white 50 ml 444 calibrated thermometer 445 calibrator ldl ( us ) 100 ml 446 caliper for antibiotic zone mesurement 447 calponin 1 ml 448 calretinin 1 ml 449 candida albicans 450 candle jar 5 ltr. 451 carbamezapine 100 ml 452 carbenicillin 100 mcg ( 250 ) 453 carbo red 500 ml 454 carbohydrate consumption broth base 455 carbolfuschin 250 ml 456 carbol fuschin 500 ml 457 carbol fuschin 125ml 458 carbolic acid 500 gm 459 carbolic acid 500 ml 460 cardiac controls 5 ml 461 carmine powder 250 gm 462 casein 500 gm 463 casein 500 ml 464 caspofungin mic e strip 465 caspofungin powder ( solubilized powder, g irradiated ) 466 ccda selective supplement 467 cd 10 10 ml 468 cd 10 apc 1 pc 469 cd 10 pe 1 pc 470 cd 100p 471 cd 117 1 ml 472 cd 117 apc 1 pc 473 cd 15 1 ml 474 cd 19 1 ml 475 cd 19 pe cy 7 1 pc 476 cd 20 1 ml 477 cd 20 fitc 1 pc 478 cd 3 1ml 479 cd 3 cy 5.5 1 pc 480 cd 3 per cp cy5.5 1 pcs 481 cd 30 1 ml 482 cd 31 1 ml 483 cd 33 pe 1 pc 484 cd 34 apc 1 pc 485 cd 34 endothelial cell marker 1 ml 486 cd 4 pe cy 7 1 pc 487 cd 45 1 ml 488 cd 45 apc h7 1 pc 489 cd 5 1 ml 490 cd 5 pe 1 pc 491 cd 56 1 ml 492 cd 64 fitc 1 pc 493 cd 7 apc 1 pc 494 cd 79 a pe 1 pc 495 cd 8 fit c 1 pc 496 cd 99 1 ml 497 cd k4 1 ml 498 cd13percy7 1 pc 499 cd38percpcy5.5 500 cdna synthesis kit ( 50 reactions ) 501 cea 1 ml 502 cedar wood oil –100ml 503 cedar wood oil 25 ml 504 cefaclor ( antibiotic disc ) 30mcg ( 250 disc ) 505 cefadroxyl 30 mcg ( antibiotic disc ) ( 250 disc ) 506 cefamandole ( antibiotic disc ) 30mcg ( 250 disc ) 507 cefazoline ( antibiotic disc ) 30mcg ( 250 disc ) 508 cefdiniar 5mcg ( antibiotic disc ) ( 250 disc ) 509 cefepime ( antibiotic disc ) 30 mcg ( 250 disc ) 510 cefixime 5 mcg ( antibiotic disc ) ( 250 disc ) 511 cefmatazole ( antibiotic disc ) 30mcg ( 250 disc ) 512 cefoaximen + sulbactam ( antibiotic disc ) 10 mcg ( 250 disc ) 513 cefoaximen + sulbactam ( antibiotic disc ) 30 mcg ( 250 disc ) 514 cefonicid ( antibiotic disc ) 30 mcg ( 250 disc ) 515 cefoperazone ( antibiotic disc ) 75 mcg ( 250 disc ) 516 cefoperazone 30 mcg ( antibiotic disc ) ( 250 disc ) 517 cefoperazone salbactum 10mcg ( antibiotic disc ) ( 250 disc ) 518 cefotaxime ( antibiotic disc ) 30 mcg ( 250 disc ) 519 cefotaxime 5 mcg ( antibiotic disc ) ( 250 disc ) 520 cefotaxime clavulanic acid ( antibiotic disc ) 10mcg ( 250 disc ) 521 cefotaxime clavulanic acid ( antibiotic disc ) 30 mcg ( 250 disc ) 522 cefotetam ( antibiotic disc ) 30mcg ( 250 disc ) 523 cefoxitin ( antibiotic disc ) 30mcg ( 250 disc ) 524 cefoxitin 10 mcg ( antibiotic disc ) ( 250 disc ) 525 cefperazone 75 mcg +sulbactum 30 mcg ( antibiotic disc ) ( 250 disc ) 526 cefpodoxime ( antibiotic disc ) 10mcg ( 250 disc ) 527 cefprozil 30 mcg ( antibiotic disc ) ( 250 disc ) 528 cefsulodin 30 mcg ( antibiotic disc ) ( 250 disc ) 529 ceftaroline ( antibiotic disc ) 30mcg ( 250 disc ) 530 ceftazidime 10 mcg ( antibiotic disc ) ( 250 disc ) 531 ceftazidime clavulanic acid ( antibiotic disc ) 30mcg ( 250 disc ) 532 ceftazidime clavulanic acid 10mcg ( 250 disc ) 533 ceftazidime ( antibiotic disc ) 30mcg ( 250 disc ) 534 ceftazidime avibactum ( antibiotic disc ) 20 mcg ( 250 disc ) 535 ceftazidime avibactum ( antibiotic disc ) 30 mcg ( 250 disc ) 536 ceftiofur 30 mcg ( antibiotic disc ) ( 250 disc ) 537 ceftizoxime ( antibiotic disc ) 30mcg ( 250 disc ) 538 ceftriaxone ( antibiotic disc ) 30mcg ( 250 dics ) 539 ceftriaxone + sulbactam ( antibiotic disc ) 10 mcg ( 250 dics ) 540 ceftriaxone + sulbactam ( antibiotic disc ) 30 mcg ( 250 dics ) 541 ceftriaxone 30mcg+ sulbactam 15mcg+ edta 100mcg ( antibiotic disc ) ( 250 dics ) 542 cefuroxime ( antibiotic disc ) 30 mcg ( 250 dics ) 543 cefuroxime 5 mcg ( antibiotic disc ) ( 250 disc ) 544 cell clean 50 ml 545 cell pack 20 ltrs 546 cellulose acetate strip 25 x 130 547 cellulose acetate strip 57 x 130 548 cellulose powder 500 gm 549 cephalexin 30 mcg ( 250 disc ) 550 cephalothin ( antibiotic disc ) 30mcg ( 250 dics ) 551 cephradine 30 mcg ( antibiotic disc ) ( 250 disc ) 552 cepodoxime ( antibiotic disc ) p. size 5 x 250 553 c erb2 onco proton her2neu 3 ml 554 cerbenicillin ( antibiotic disc ) p. size 5x 250 555 ceruloplasmin 100 ml 556 cetrimide agar 500 gm 557 chamber dark humidity chamber 558 chamber multipurpose staining chamber body yype – plastic size – 46x25x4 cmslide capacity – 24 559 chamber neubuers chamber with silver lining each 560 chaps ( cholamidopropyl ) dimethylammonio ] 1 propanesulphonate } ) 561 charcol 500 gm 562 chart marker pen each 563 chemical indicators class6 steam strips 564 chemistry controls ( more than 30 parameters ) 5 ml 565 chikungunya igm elisa kit ( 1 x 96 ) 566 chikungunya igm, igg rapid kit single 567 chloramphenicol ( antibiotic disc ) 30 mcg ( 250 disc ) 568 chloramphenicol 10 mcg ( antibiotic disc ) ( 250 disc ) 569 chloramphenicol yeast extract glucose agar 570 chlorhexidine gluconate and cetrimide antiseptic lotion pack 1l ( like savlon ) 571 chlorhexidine gluconate solution ip 10% v / v equivalent to chlorhexidine gluconate2% w / v ethanol ip 70% v / v 500 ml 572 chlorhexidine gluconate solution ip 20 % v / v, ( equivalent to chlorhexidine gluconate 4 % w / v ) , with isopropanol<10%, ethoxylated alkylphenol<10%, fatty acid diethanolamide<10%, acetic acid glacial<1%, cellulose and fragrance<10% emollient & moisturising agents passes en 1499 standards, pack size: 500 ml bottle 573 chloroform 1000ml ( molecular bio use only, molecular weight 119.38 ) 574 chloroform 200 ml 575 chloroform 2.5 ltrs 576 chlorophenol red 500 ml 577 chloroxylenol 4.8 % w / v ( equivalent todettol ) 1 ltr 578 chocolate agar plate 579 cholesterol hi co 100 ml 580 cholesterol kit 2x250ml 581 cholinesterase 24 ml 582 chopping board – each ( grossing boards ) features measurement guides printed onto boardmade of heavy duty, stain resistant, thick polyethylenewill not dull fine surgical bladesfeatures a drain groove, carved into the edge to contain fluidsdurable design will make the board last for years, without changing shape, bending, or swelling 583 christensen’s urea 584 chrom agar 500 gm 585 chromium ( iii ) chloride hexahydrate 586 chromium oxide 5% 100ml 587 chromogenic agar listeria ( listeria ottaviani agosti agar base ) 588 chromogenic carbapenem resistant gram negative bacterial screening agar 589 chromogenic colistin resistant gram negative bacterial screening agar 590 chromogenic esbl producing gram negative bacterial screening agar 591 chromogranin a 1 ml 592 cinoxacin ( antibiotic disc ) 100 mcg ( 250 disc ) 593 ciprofloxacin ( antibiotic disc ) 5 mcg ( 250 disc ) 594 ciprofloxacin 1 mcg ( antibiotic disc ) ( 250 disc ) 595 circular chart recorder each 596 citric acid ( c6h8o7 ) 500 gm 597 citric acid ( c6h8o7 ) 500 ml 598 ck –mb kit 75 ml 599 ck mb with calibrator 100 ml ( compactible with dirui cst240 ) 600 ck 20 1 ml 601 ck 5 / ck 6 1 ml 602 ck 7 1ml 603 ck mb calibrator 100 ml 604 ck nac 100 ml ( compactible with dirui cst240 ) 605 clarithromycin ( antibiotic disc ) 15 mcg ( 250 disc ) 606 clarithromycin 2 mcg ( antibiotic disc ) ( 250 disc ) 607 cleaning & disinfecting sol ( like lysol ) 5 ltrs 608 cleaning solution 1 kit 609 cled cystine lactose electrolyte deficient ( cled ) agar 500 gm 610 clindamaycin ( antibiotic disc ) 2 mcg ( 250 disc ) 611 clostridium difficle rapid identification test kit 612 cloxacillin 1 mcg ( antibiotic disc ) ( 250 disc ) 613 cmpo fitc 1 pc 614 cmv igg elisa 1 x 96 ( 1 pack ) 615 cmv igm elisa 1 x 96 ( 1 pack ) 616 coagulas plasma 617 cocaine 100 ml 618 colchicine powder 619 colcimed 5 mg 620 coliform agar 621 colistin 10 mcg ( 250 disc ) 622 colistin 25 mcg ( 250 disc ) 623 colistin disc ( antibiotic disc ) ( 1x100 ) each 624 colistin mic e strip test 625 colistin sulphate salt powder1 gm 626 combistix reagent strips 100pc / box 627 combistrix 100 t 628 complete haemacytometer set ( neubeur blood counting chamber brightlined ) number of memory sticks ?1item weight ?100 gpackage dimensions ?5 x 3 x 1 cm; 100 grams country of origin ?germany 629 congo red 100 ml 630 container autoclavable biohazards waste container large 631 container autoclavable biohazards waste container medium 632 container microtube container 1000ml ( it should be madeup of medical grade polypropylene or polycarbonate, confirming to us fda code of federal regulations title 21, and should be autoclavable ) 633 container microtube container 500ml ( it should be madeup of medical grade polypropylene or polycarbonate, confirming to us fda code of federal regulations title 21, and should be autoclavable ) 634 contains subtilisin tridecylpolyethylenglycolether propan 2 ol, glycerol passes en 13624, en 13727, en 14561 and en 14562 standards, pack size: 2 litre bottle 635 cooked meat broth 636 coomassie brilliant blue g250 637 coomassie brilliant blue r250 638 coplin jar –made of polypropylene microwave safe can hold 10 slides ( slide size: 25 x 75 x 1.0mm ) & 50 slides interior is grooved to hold slides verticallydomed and shallow thread screw cap 639 coplin jar plastic 640 copper acetate 500 gm 641 copper sulphate crystal 500 gm 642 corn meal agar 500 gm 643 cotrimoxazole ( antibiotic disc ) 1.25 mcg ( 250 disc ) 644 cotrimoxazole ( antibiotic disc ) 23.75mcg ( 250 disc ) 645 cotton tip applicator 646 covid 19 igg 647 cpk kit 2x75ml 648 creatinine 100 ml 649 creatinine enzymatic 100 ml ( compactible with dirui cst240 ) 650 creatinine kinase ( ck – nac ) 100 ml 651 creatinine kinase ( ck ) kit 2x75ml 652 creatinine kit 2x500ml 653 creatinine powder 25 gm 654 creatinine zinc chloride 500 gm 655 cresyl blue powder 250 gm 656 cronobacter isolation agar 657 cronobacter sakazakii 658 cronobactor selective broth 659 crplatex high sensitative calibrator 100 ml 660 crplatex normal calibrator 100 ml 661 crp quantitative 100 ml ( compactible with dirui cst240 ) 662 crp quantitative ( range 0 100 ) 100 ml ( compactible with dirui cst240 ) 663 crp reagent ( rapid test kit ) 100 test 664 crp / rf c ( quality control , crp, rf ) 100 ml ( standard compatible with dirui cs 240 system pack ) 665 crp latex 100 test 666 cryo globes large – 100 pc 667 cryo globes medium – 100 pc 668 cryo globes small – 100 pc 669 cryo tags each 670 cryptococcal latex agglutination test 50 tests 671 cryptococcus atcc 36556 672 crystal blue powder 500 gm 673 crystal sulphate 125ml 674 crystal sulphate 500 ml 675 crystal violet 25 gm 676 crystallin phenol powder 250 gm 677 crystalline phenol powder 500 gm 678 ctla 4 ( monoclonal ab ) 100ug 679 ctla 4 ( polyclonal ab ) 200ul ( 0.5 1.5 ug / ul ) 680 cuprous chloride ( cu ii chloride ) 500 gm 681 cuvetes and stirrece for hemestar ( coagulation ) xf 1.0 / 2.0 682 cylinder glass measuring cylinder 250 ml 683 cylinder glass measuring cylinders 100ml 684 cylinder glass measuring cylinders 1000ml 685 cylinder glass measuring cylinders 2000 ml 686 cylinder glass measuring cylinders 25ml ( it should be madeup of polymethylpentene, confirming to us fda code of federal regulations title 21, and should be autoclavable ) 687 cylinder glass measuring cylinders 500ml 688 cylinder glass measuring cylinders 50ml 689 cystatin 1 ml 690 cysticercosis igg elisa kit 691 cysticercosis igm elisa kit 692 cyto fix 125 ml 693 cytomegalovirus, serum, igm, biorad, drg international 694 dapi 10 mg 695 dapi dihydrochloride ( 4, 6 diamidino 2 phenylindole dihydrochloride ) 696 d biotin 697 dca media 250 gm 698 dca media 500 gm 699 d dimer 100 ml 700 d dimer control level 1 100 ml ( compactible with dirui cst240 ) 701 d dimer control level 2 100 ml ( compactible with dirui cst240 ) 702 d dimer with calibrator 100 ml ( compactible with dirui cst240 ) 703 decarboxylase base 500 gm 704 decotrorising reagent destainer ( german ) electrophoresis each 705 dengue igg elisa 706 dengue igm elisa 1 x 96 707 dengue ns1 elisa 1 x 96 708 dengue nsi igm, igg, rapid kit 50 tests 709 dental cement 1 kg 710 deoxycholate citrate agar 711 deproteinising solution 1000ml 712 desmin 1 ml 713 destainer & clearing solution 500 ml 714 d gluconic acid 715 di sodium hydrogen phosphate 500 gm 716 di sodium hydrogen phosphate dihydrate purified 500 gm 717 di sodium hydrogen phosphate dihydrate purified 250 gm 718 diaectyl monoxime 25 gm 719 diamond pencil marker 50 in no. ( used for marking slide or test tube etc.diamond pencil for writing information onto histological and cytological slides.suitable for most laboratory glass surface, metal and ceramic. thin diamond tip for a perfect writing. ) 720 diastic 100 t 721 dichloro phenol 2 6 – 10 gm 722 dichloro phenol indo phenols 2 6 – 10 gm 723 diethyl ether ( hplc grade ) 500 ml 724 differential reinforced clostridial broth ( drcm ) 725 digital display of temperature for refrigeraters and incubators 726 digitoxin ( tdm calibrator ) 100 ml 727 digoxin 100 ml 728 dimethyl sulfoxide ( dmso ) 500 ml 729 di potassium hydrogen ortho phosphate ( k2hpo4 ) 500 gm 730 dipotassium hydrogen phosphate 500 gm 731 disinfectant 100 g of granules contain the following active ingredients: 43 g sodium per carbonate, 22 g tetraacetylethylenediamine. passes en 13624, en 13727, en 14348, en 14561, en 14562, en 14563, en 13704 and en 14476 standards, pack size: 1.5 kg box 732 disinfectant chlorhexidine gluconate solution ip 20 % v / v, equivalent to chlorhexidine gluconate 4.0 % w / v 1 ) en 13624 yeasticidal 2 ) en 13727 bactericidal500 ml 733 disinfectant ortho – phthalaldehyde 0.55% w / wwith test strip & deactivatorquantitative suspension test for the evaluation of mycobactericidal activity of chemical disinfectants in the medical area including instrument disinfectants test method and requirements ( phase 2 / step1 ) 5 ltrs 734 disinfectant ortho phthalaldehyde – 0.55% non corrosive, high level instrument disinfectant surfactant free, pack size: 5 litre jar 735 disinfectant polymeric biguanide hydrochloride ( in house ) ( < 10 % ) alkyl dimethyl benzyl ammonium chloride & didecyl dimethyl ammonium chloride ) ( in house ) ( < 10 % ) quantitative non porous surface test for the evaluation of bactericidal and / or fungicidal activity of chemical disinfectants 5 ltrs 736 disinfectant sodium parborate monohydrate in house 50% w / w quantitative suspension test for the evolution of sporicidal activity of chemical disinfectant of used in food industrial domestic & institutional 5 ltrs 737 disinfectant sodium perborate monohydrate ( in house ) ( 50 % w / w ) quantitative suspension test for the evaluation of sporicidal activity of chemical disinfectants used in food, industrial, domestic and institutional areas 5 ltrs 738 disinfectant powder disinfectant powder for surface cleaning containing potassium monopersulphate 40 50 % sodium c10 – 13. alkybenzen sulphonate 10 20 % sodium ( like virkon ) 5 kg 739 disinfectant solution 4.25% ahp based surface disinfectant concentrate. 1 ltr. 740 disinfectant solution 5th generation qac based disinfectant having didecyl dimethyl ammonium chloride and n alkyl dimethyl benzyl ammonium chloride 1 ltr. 741 disinfectant solution aldehyde surface & environmental disinfectant – 5 ltr. 742 disinfectant solution aldehyde surface & environmental disinfectant – 500 ml 743 disinfectant solution disinfectant containing electrolysed water with neutral ph, hypochlorous acid, sodium hypochlorite – 5 ltr. 744 di sodium hydrogen orthophosphate dodecahydrate 500 gm 745 di sodium hydrogen phosphate 500 gm 746 di sodium metasilicate upto 30%, nonionic surfactant and anionic surfactant based powder with optical brightner 1 kg. 747 di sodium tetraborate decahydrate ( borax ) 500 gm 748 disposable blades818 749 disposable esr pipettecapacity 180mlchannel westergrenmartial plastic, colour – transparentpack per box – 50pc / 100pc 750 disposable fluid collection system each 751 distilled water / di water / deionised water 5 lappearance density = 999.972melting point = 0°c ( 32°f ) thermal conductivity = 0.58 w / mk 1 refractive index = 1.3325viscosity = icpspecific heat capacity = 75.375 ± 0.05 j / mk 1 752 dixon agar 250 gm 753 dixon agar 500 gm 754 dna extraction kit 250 r 755 dna extraction kit 50 test 756 dna isolation kit from 200 ul blood sample 100 tests 757 dna ladder ( 100 bp ) 100 ul ( 0.5 ug / ul ) 758 dna ladder ( 50 bp ) each vial 759 dna loading dye 20 ml 760 dna zap pcr dna degradation solutions 5 x 1ml 761 dnase inhibitor ( 50 reactions ) 762 dnph ( 2 4, dinitrohphenylhydrazine ) 500gm laboratort reagent grade, >97.0% 763 dntps ( 10 mm ) each 10 ml 764 dntps ( 10 mm ) each 1000 ml 765 documentation hand labeler gun nos. 766 doripenam ( antibiotic disc ) 10 mcg ( 250 disc ) 767 doxycycline ( antibiotic disc ) 30 mcg ( 250 disc ) 768 dpx mountant 500 ml 769 dropper each 770 dulcitol discs each 771 dulcitol powder 25gm 772 dutp 2 gm 773 e.s.r fluid 500ml 774 each 100 g contains didecyldimethyl ammonium chloride: 7.0 g corrosion inhibitors, fragrance, excipients q.s. ( alcohol free, aldehyde free ) , pack size: 500 ml bottle 775 each 100 g containsethanol ip: 10.0 g, 2 propanol ip: 9.0 g / isopropanol 1 propanol: 6.0 g / n propanolprovided with convenient hand sprayer, pack size: 250ml bottle 776 each 100 gm contain dodecylbiyspropylene triamine 9.2 gm and didecyldimethyl ammoinum chloride 13gm1 ltr jar 777 each 100 gm containes 1.6 dihydroxy 2.5 dioxyhexane ( chemically bound formadehyde ) in house 11.2gm, glutadehyde 5gm, benzalkonium chloride 5gm, alkyle urea derivative in house 3 gm test report from reputed indian or international lab 1 ltrs jar 778 each 100 gm contanes true propanol 40 gms 1 propenol 22 gm saniocid 1 ltrs jar 779 each 100 gms contains :sodium salicylate ip0.46 gsodium benzoate ip 0.59 gwater soluble baseq.s 780 each 100 gms contains2 propanol ( 63 gm ) benzalkonium chloride ( 0.025 gm ) 781 each 100 gms contains: 2 propanol40 gm1 propanol22gm saniocid250ml 782 each 100 gms contains:1, 6 dihydroxy, 2 5 dioxyhexane ( chemically bound formaldehyde ) , ( in house ) ( 11.2 gm ) glutaraldehyde ( 5.0 gm ) , benzalkonium chloride ( 5.0 gm ) , alkyl urea derivative ( in house ) ( 3.0 gm ) , test report from reputed indian or international labs against viruses as per dvv guideline 783 ec broth 784 e cadherin 1 ml 785 e check 123 1pc 786 ecoshield solution – 1 ltr. 787 edta, disodium salt 2 hydrate 100 gm 788 egfr 1 ml 789 ehrlich’s aldehyde reagent 100 ml 790 ehrlich’s aldehyde reagent 125 ml 791 ehrlichs aldehyde test 250 ml 792 ehtnol ip 10gm, truepropenol 9gm, 1 propenol 6 gm 793 electric ph metre 794 electrical digital timer 795 electronic cell counter with 10 keysfor dlc digital blood cell counter bcc 10 is a feature loaded cell counter with perfect quality no. of cells: 10no. of keys: 12body material: abspower source: 2 x 1.5v ( aa ) 796 electronic cell counter with 9 keys for dlc 797 electrophoresis hemoglobin & protein buffer 500 ml 798 elelay ( gel ) 1 kg 799 ellners broth 800 ema 1 ml 801 enoxacin 10 mcg ( 250 disc ) 802 enrofloxacin 5 mcg ( 250 disc ) 803 enterobacter aerogenes / klebsiella aerogenes 804 enterococcus faecalis 805 eorin 0.1%– 500 ml 806 eosin & nigrosin stain: ( twin pack ) specification: eosin & nigrosin stain: ( twin pack ) specification:a.. 0.5% eosin y , 290 mosm / kg nacl 1x 30mlb. 10% nigrosin , 290 mosm / kg nacl 1x 30ml 807 eosin yellowish indicator for microscopy 25 gmspecification: assay ( on dried substance ) = 90%ph ( 1%, water ) = 6.5 7.5adsorb on maxima ( in water ) = 515 518 nmabsorption ratio ( max 15nm / max+15nm ) 1.21 1.77specific extinction ( e1% 1cm; ? = 516nm, water ) [ on dried substance ] = 1230 1280tlc analysis passes testloss on drying ( 105°c ) = 8%suitability for microscopy passes test 808 epson ( ribbon cartridge ) nos. 809 epstein barr virus igm ( ab ) 1 x 96 810 equivalent to cetrimide ip ( 15 % w / v ) chlorhexidine gluconate solution ip ( 7.5 % v / v ) equivalent to chlorhexidine gluconate ( 1.5 % w / v ) 1 ltrs 811 erg 1 ml 812 ertapenem ( antibiotic disc ) 10mcg ( 250 disc ) 813 erythromycin ( antibiotic disc ) 15 mcg ( 250 disc ) 814 erythromycin 10 mcg ( antibiotic disc ) ( 250 disc ) 815 erythromycin 2 mcg ( antibiotic disc ) ( 250 disc ) 816 erythromycin 5 mcg ( antibiotic disc ) ( 250 disc ) 817 estrogen receptor 3 ml 818 etbr– 100 r each 819 ethambutol / myambutol 25 mcg ( antibiotic disc ) ( 250 disc ) 820 ethambutol / myambutol 50 mcg ( antibiotic disc ) ( 250 disc ) 821 ethanol 100% ( molecular grade ) 500 ml 822 ethanol 1000 ml 823 ethanol 250 ml 824 ethanol 500 ml 825 ethanol ip ( 10 gm ) 2 propanol ( 9 gm ) , 1 propanol ( 6 gm ) 826 ethanol ip ( 3.0 % v / v ) benzalkonium chloride solution ip ( 0.5 % v / v ) , equivalent to benzalkonium chloride ( 0.25 % w / v ) 827 ethidium bromide solution 10ml ( hplc purified, suitable for use in gel electrophoresis ) 828 ethionamide / trecator 25 mcg ( 250 disc ) 829 ethnol ip 10 gm to propanol 9gm 1 propanol 6 gm, bottle manufacturer / marketing company should be certifuing accourding to din en iso 9001, 14100 & 13485 certificate 830 ethyl acetate 250 ml 831 ethyl alcohol 500ml ( high grade, for use in molecular biology experiments, purity =99.99%, should contain isoamyl alcohol =0.05, 2 propanol =0.01, and higher alcohols =0.01. ) 832 ethyl violet azide broth ( eva broth ) 833 ethylacetate ( 1 litre ) ( laboratort reagent grade, =99.0% ) 834 ethylenediaminetetraacetic acid powder ( 500gm ) ( acs grade, for molecular biology use ) 835 ethyl hexadecyl dimethyl ammonium ethylsulphate 0.2 gms ( mecetronium ethylsulphate ) each 100 gms contains2 propanol 45 gms, 1 propanol 30 gms, with third party test report from reliable lab, or indian or european norm certificates 836 eto cartridge nos. 837 external quality contro immunology controls ( immno tubidimetric methods > 5 parameters ) 838 external quality control clinical chemistry ( more than 30 parameters ) 839 external quality control hba1c and a2f 840 external quality control immunoassay ( more than 20 parameters ) 841 fail safe pcr pre master mix kit 60 units ( should capable of amplify high gccontent or secondary structure template, must contain all 12 premixes, ) 842 faropenem ( antibiotic disc ) 5mcg ( 250 disc ) 843 fast blue bb salt – 500 gm 844 fast gernet bgbc salt 500 gm 845 febrile antigen set ( widal tube test ) 10 pieces 846 ferric alum 2% 500 ml 847 ferric alum 99% 250 gm 848 ferric chloride 250 gm 849 ferric chloride 5% 100 ml 850 ferric nitrate 500 gm 851 ferritin 100 ml 852 ferritin control level 1 100 ml ( standard compatible with dirui cs 240 system pack ) 853 ferritin control level 2 100 ml ( standard compatible with dirui cs 240 system pack ) 854 ferritin with calibrator 100 ml ( standard compatible with dirui cs 240 system pack ) 855 ferrous ammonium sulfate 500 gm 856 ferrous chloride 857 fetal bovine serum gold 500 ml 858 ficoll 859 fixative solution 860 flask conical flask 100 ml 861 flask conical flask 1000ml 862 flask conical flask 125ml 863 flask conical flask 250 ml 864 flask conical flask 500ml 865 flask round bottom flask 250ml 866 flask round bottom flask 1000ml 867 flask round bottom flask 100ml 868 flask round bottom flask 125ml 869 flask t 25 flask 870 fli 1– 1 ml 871 floater ( 3 4 ) 872 flouride powder 500 gm 873 fluconazole ( mic e test strip ) 874 fluconazole powder ( solubilized powder, g irradiated ) 50 gm 875 flucytosine mic e strip 876 flucytosine powder ( solubilized powder, g irradiated ) 50 gm 877 fogging kit – each 878 forcep blunted dissecting 879 forcep pointed 880 forcep ptfe pointed 881 formaldehyde solution 1 ltr 882 formaldehyde solution 250 ml 883 formaldehyde solution 5 ltrs hcho [ mol. wt. = 30.08 ] solubility = miscible with water and absolute alcohol forming colourless solutions.weight per ml at 20°c=1.085 1.095gassay = 37.0 41.0 w / v hchomaximum limits of impurities acidity 3 mlash = 0.02%chloride ( cl ) = 0.001 % 884 formaldehyde solution 500 ml 885 formaline tab 100 pcs 886 formic acid 500 gm 887 formic acid 500 ml 888 fosfomycin ( antibiotic disc ) 200 mcg ( 250 disc ) 889 fosfomycin 50 mcg ( antibiotic disc ) ( 250 disc ) 890 fosfomycin with glucose 50 mcg ( antibiotic disc ) ( 250 disc ) 891 fouchet’s reagent 250 mlfor bile pigment bilirubinfor lab use only 892 fouchet’s reagent 500 ml 893 fraser broth 894 fraser listeria selective supplement 895 frosted micro slides 19mm x 25mm, thickness 1.35mm 896 fructose powder 500 gm 897 fuchsine acid 500 ml 898 furaxone 100 mcg ( 250 disc ) 899 furazolidone 100 mcg ( 250 disc ) 900 fusidic acid 10 mcg ( 250 disc ) 901 g.v. lotion 100ml 902 g.v. powder 500 gm 903 g 6 pdh 100 ml ( compactible with dirui cst240 ) 904 galactomannan lateral flow assay – 50 t 905 galactose 1 phosphate ( 40 units ) ( purity ( hplc ) > 98 % ) 906 gatifloxacin ( antibiotic disc ) p. size 5x 250 ( 250 disc ) 907 gcdep 1 ml 908 gds e coli 909 gel red 1 x 0.5 ml 910 gel scoup each 911 gelatin agar 912 gelatine powder 500 gm 913 genotype mtbdr plus detection kit 914 gentamicinhs ( antibiotic disc ) 120 mcg ( 250 disc ) 915 gentamicin ( antibiotic disc ) 10 mcg ( 250 disc ) 916 gentamicin 30 mcg ( antibiotic disc ) ( 250 disc ) 917 geobacillus stearothermophilus ampoules 918 geobacillus stearothermophilus spores ( biological indicator ) 50 x 1 ml 919 gfap 1 ml 920 ggtp 10x2ml 921 giemsa powder 25 gmappearance = dark green to black crystal or powdermelting point = 300°c ( lit ) solubility = 10mg soluble in 10ml of methanol to give clear blue solution with greenish fluorescence.loss on drying at 110°cnmt = 8.0 % 922 giemsa powder 250 gm 923 giemsa powder 500 gm 924 giemsa stain 250 ml 925 giemsa stain 500 ml 926 glacial acetic acid 2.5 lboiling point = 116 118°cassay ( acidimetric ) = 99.7 colour = 10 hazytitratable base = 0.0004 meq / gmacetic anhydride = 100 ppmchloride = 1 ppmheavy metal ( as pb ) = 0.5 ppm sulphate = 1 ppmiron = 0.2 ppmevaporation residue = 10 ppm 927 glacial acetic acid 500 ml 928 glacial acid / glocalic acid 500ml 929 glasspetridish ( 90 mm ) 930 glasspetridish ( 100 mm ) 931 glasspetridish ( 120 mm ) 932 glasspetridish ( 90 mm ) 933 glass beads ( small size ) 1000 gm 934 glass beads ( small size ) 250 gm 935 glass beads ( small size ) 500 gm 936 glass cover silips 22 x 22 mm 10 gm 937 glass cover silips 22 x 24 mm 10 gm 938 glass cover silips 22 x 60 mm 10 gm 939 glass cover slip square shape ( 18 mm x 18 mm ) 10 gm 940 glass cover slip square shape ( 22 mm x 40 mm ) 10 gm 941 glass innomer cement grade 942 glass marking pencil each 943 glass wool 944 glove cryo gloves 1 pair 945 glove nitrile gloves ( large ) ( disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) 946 glove nitrile gloves ( medium ) ( disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) 947 glove nitrile gloves ( small ) ( disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) 948 gloves autoclave / microwave gloves 949 glucofuranose 950 glucose ( hexokinase ) 100 ml ( compactible with dirui cst240 ) 951 glucose hk 100 ml 952 glucose kit 1 kit 1000 ml 953 glucose powder 500 gm 954 glucose salt teepol broth 955 glutaraldehyde ( 2.45 % w / v ) with test strip & activator 5 ltrs 956 glutaraldehyde 2.45 % w / v purified water 3 7% butylated hydroxyanisole, pack size: 5 litre jar 957 gluteraldehyde solution 5 ltrs 958 glycerine 2.5 ltrs 959 glycerine 400gm 960 glycerine 500 ml98% w / w min. aqua and rose flavour 961 glycerol 500 ml 962 glycine powder ( ar ) 250 gm ( acs reagent, =98.5%, analytical grade ) 963 glycocylated hemoglobin kit 25 t 964 glycogen kit 965 glycolic acid 500 ml 966 glycosylated kit 100 ml 967 gold chloride 0.1% 100 ml 968 gold chloride 0.2% 100 ml 969 gram stain kit 250 ml 970 gram stain kit 500 ml 971 grams iodine ( crystal ) 100 gm 972 griess assay reagent 500 ml 973 guanidine hydrochloride 974 guanidinium thiocyanate 975 h.c.v. kit rapid 50t 976 h.i.v. rapid kit50 t 977 h2o2 250 ml 978 h2so4 ( sulphuric acid ) conc 500ml 979 hand rub alcoholwith moisturizer 500 ml2.5 % v / v chlorhexidine gluconate solution i.p equivalent to 0.5% w / v chlorhexidine gluconate 70 % v / v ethyl alcohol, skin emollients, perfume, fast green as fcf colour. 980 hand wash solution scrub 500 ml 981 haptoglobin 100 ml 982 hardness testing kit ( for water analysis ) each 983 harris haematoxylin solution ( papanicolaou solution ) 25 gmdensity = 1.04 gm / cm3 ( 20°c ) ph = 2.3 2.8 ( 20°c ) ci75290 5.3 gm / lal2 ( so4 ) 3 18h2067gm / l 984 hav + hev igm elisa 96w 985 hav igm elisa – 1 x 96 test 986 hba1c 100 ml 987 hba1c calibrator 100 ml 988 hbdh 100ml 989 hbsag elisa 1 x 96 test 990 hcv dna extraction kit 991 hdl cholesterolcalibrator 100 ml 992 hdl cholestrol direct 100 ml 993 hdl cholestrol kit 10ml 994 hdl control 50 ml 995 hdl cholesterol 100 ml 996 heamatoxlene powder 250 gm 997 heamoglobin denatarant 1000 ml 998 heat block 999 hektoen enteric agar 1000 hematology external quality control 1001 hematology controls ( compatible within sysmex xn 1000 ) 3 ml 1002 hematoxylin monohydrate 82% 1003 hematoxylin powder 1 kg 1004 hematoxylin powder 25gmappearance = yellow to brown to tan colourform = powderdye content = 80%solubility in alcohol passes testwater 8 % max.spectroscopy peak at 253, ratio 0.98 @ 508 / 538nm density @ peak 0.519qu 1005 hematoxylin powder stain 125 ml 1006 hemo dialysis solution 10 ltrs 1007 hemocyto meter ( german ) pcs 1008 hemoglobin electrophoresis kit 100 tests 1009 hemoglobin estimation 1010 hemoglobin set – each 1011 hemoglobino meter ( 0 30 g / dl ) ( german ) pcs 1012 hemoglobinometer calorimetry set 1013 hepatitis a, serum, igm, wantai, dia pro, srl, italy, hepavase ( gbc taiwan ) 1014 hepatitis b, serum, hbsag, j mitra, biorad 1015 hepatitis c rpd kit ( detects core, ns3, ns4 ns5 all hcv genotypes ) – 50 t 1016 hepatitis c, serum, total antibody, j mitra, ortho hcv 3.0, biorad 1017 hepatitis d virus, serum, total antibody, dia pro, srl, italy, gbc taiwan ( for research use only ) 1018 hepatitis delta each 1019 hepatitis e, serum, igm, wantai, mp diagnostics, dia pro 1020 hepes sodium salt 1021 hev igm elisa 1 x 96 test 1022 hexane 500 ml 1023 hini elisa 96w 1024 hippurate broth 1025 hla b27 rtpcr kit 96 tests 1026 hladrpercpcy5.5 1 pc 1027 hma 45 1ml 1028 hmb 45 1 ml 1029 holdar vacutainer holder – each 1030 holder test tube holder each 1031 homocysteine with standard 100 ml ( compactible with dirui cst240 ) 1032 hsv i + iiigg ( ab ) elisa 1 x 96 1033 hsv i + ii igm ( ab ) elisa 1 x 96 1034 hsv i igg ( ab ) elisa 1 x 96 1035 hsv i igm ( ab ) elisa 1 x 96 1036 hsv ii igg ( ab ) elisa 1 x 96 1037 hsv ii igm ( ab ) elisa 1 x 96 1038 hugh leifson medium 1039 hydrated disodium hydrogen phosphate 250 gm 1040 hydrochloric acid ( 35 % ) 500 ml 1041 hydrochloric acid hcl conc 500ml 1042 hydrochloric acid n / 10 500 ml 1043 hydrogen peroxide of minimum 30% and oxygen based bleaching agent 5 ltr. 1044 hydrogen peroxide solution 2.5 ltrscontains 6.5% w / v hydrogen peroxide ( non medicinal ) 1045 hydrogen peroxide solution 500 ml 1046 hydrophobic barrier marker pen – reagent blocker ( pap pen ) use in immunohistochemical applications 1047 hydroquinone 250 gm 1048 hydroquinone buffer 500 ml 1049 hydroxylamine hydrochloride ( 500gm ) ( laboratory grade, 99% ) 1050 hypochloride 10 % 500 ml 1051 hypochlorous acid ( hocl – 0.003% ) + sodium hypochlorite ( naocl – 0.004% ) + electrolysed water – 99.97% ( wound care spray ) – 500 ml 1052 hypochlorous acid ( hocl – 0.008% ) + sodium hypochlorite ( naocl – 0.002% ) + electrolysed water – 97.64% ( wound care gel ) – 60 gm. 1053 ice bucket each 1054 iga 100 ml 1055 ige calibrator 100 ml ( compactible with dirui cst240 ) 1056 ige reagent 100 ml ( compactible with dirui cst240 ) 1057 igg 100 ml 1058 igm 100 ml 1059 imidazole 1060 imipenem ( antibiotic disc ) 10mcg ( 250 disc ) 1061 imipenem relebactum ( antibiotic disc ) 10 mcg ( 250 disc ) 1062 imipenem relebactum ( antibiotic disc ) 25mcg ( 250 disc ) 1063 immunoassay controls ( more than > 30 parameters ) 5 ml 1064 immunohistochemistry ( ihc ) estrogen receptor kit ( a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents. ) 1065 immunohistochemistry ( ihc ) her2 receptor kit ( a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents. ) 1066 immunohistochemistry ( ihc ) progesterone receptor ( pr ) ( a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents. ) 1067 immunology controls including ( crp / aso / rf ) 5 ml 1068 in water soluble base ( contains sodium iodide and surfactants ) ( ) 1069 india ink – 100 gm 1070 india ink 100 ml 1071 indian ink 250 ml 1072 inhibin 1 ml 1073 innovative tenside system containing 5 15% anionic surfectants, < 5 % nonionic surfectants, <5% polycarboxylate, enzymes.other excipients: solubiliser, corrossion inhibitors sodium cumenesulfonate, sodim etasulfate, 2 aminoethanol, alcohols, c13 15 branched and linear, butoxylated ethoxylated, alkylpolyethylen glycol polybutylen glycolether, subtilisin, glucerol, pack size: 5 litre jar 1074 iodine 500 gm 1075 iodine apex 100 gm 1076 iodoacetamide ( iaa ) 1077 iron 100 ml ( standard compatible with dirui cs 240 system pack ) 1078 iron alum 5% 100 ml 1079 iron binding kit 150ml 1080 iron sulfite agar 1081 iron tibc 100 ml 1082 iso amyl alcohol 500 ml 1083 iso butanol 1084 isoniazid / isonicotinyl hydrazine 1mcg ( 250 disc ) 1085 isopropanol 1000ml ( acs purity 69 71 % ) 1086 isopropyl alcohol 2.5 ltr c3h80 [ mol. wt. = 60.10 ] specification: assay ( gc ) nlt = 99.0%weight per ml at 20°c = 0.784 0.786maximum limits of impurities.residue after evaporation = 0.002%water = 0.2% 1087 isopropyle alcohol ( molecular grade ) 2.5 ltrs 1088 itraconazole mic e strip 1089 itraconazole powder ( solubilized powder, g irradiated ) 1 mg ( 250 disc ) 1090 japanese encephalitis igm elisa 1 x 96 1091 kanamycin ( antibiotic disc ) 30mcg ( 250 disc ) 1092 karyotyping media ( 500ml ) ( ready to use liquid media, to be used to culture peripheral blood lymphocytes, 1x preparation, must supplemented with fetal bovine serum, l glutamine, and phytohemagglutinin, media use must be certified for “in vitro diagnostic use”. it should be manufactured at fda registered cgmp compliant facility only. ) 1093 kel 500ml 1094 ketoconazole powder ( solubilized powder, g irradiated ) 1 mg ( 250 disc ) 1095 ketokonazole mic e strip 1096 ketone bodies ( blood ) with calibrator 100 ml ( compactible with dirui cst240 ) 1097 ki67 antigen 1 ml 1098 kovac’s indole reagent 250 ml 1099 kovacs reagent – 100 ml 1100 l spreader 1101 l arginine hydrochloride 10 gm 1102 l j media slant ( solid media ) 250 gm 1103 l j media slant each 1104 l lysine hydrochloride 10 gm 1105 l shaped wire each pack 1106 l.d test kit ( rk39 ) – 100 tests 1107 l.d test kit ( rk39 ) – 25 tests 1108 l.d test kit ( rk39 ) – 50 tests 1109 lab goggles each 1110 lab shoes size 10 1111 lab shoes – size 7 1112 lab shoes size 8 1113 lab shoes size 9 1114 laboline 1115 laboratory deodorizing pearls 1116 lactate control 100 ml ( compactible with dirui cst240 ) 1117 lactate with calibrator 100 ml ( compactible with dirui cst240 ) 1118 lactic acid 1119 lactophenol cotton blue 250 ml 1120 lactose 500 gm 1121 lactose broth 1122 lactose powder250 gm 1123 lactose ttc agar with tergitol 7 1124 large ruler metallic scales each 1125 l arginine hydrochloride 10 gm 1126 lavofloxacin 5 x 250d 1127 lb broth ( lennox ) 1128 lb broth with agar 1129 ldh kit – 2x25ml 1130 ldl cholesterolcalibrator 100 ml 1131 ldl control 50 ml 1132 lead acetate 500 gm 1133 leeming notman agar 250 gm 1134 leeming notman agar 500 gm 1135 leica freezing media for cryostat ( 125 ml ) leicapack size 40z ( 118 ml ) optimal cutting temperature ( oct ) compound is formation of clear, water soluble glycols and resin, providing a solid matrix to specimen holder for consistent sectioning in a cryostat working temperature of 10°c below.specification: mol. formula = na2s2o4mol. wt. = 1 / 4.11assay ( iodometric ) = 85 87.5iron ( fe ) = max. 0.002 % ( at the moment of batch analysis ) 1136 leishman powder 25gmform = powder colour = dark greensolubility solution in methanol turbidity 0.1 % clearsolubility colour solution in methanol 0.1 % blue with green fluorescenceloss on drying = max. 8 %absorbance ( a ) in 1 % solution in methanol in a 1cm cell at 650nm = min. 950 1137 leishman stain 500ml 1138 leishman stain powder 100gm 1139 leishman stain powder 250 gm 1140 lens cleaner 1141 leptospira igm elisa 1 x 96 ( 1 pack ) 1142 levofloxacin ( antibiotic disc ) 5mcg ( 250 disc ) 1143 liapase 100 ml 1144 light green 2% 100 ml 1145 light green for microscopy 25 gmabsorption maximum ( ? max. water ) = 629 634 nmspecific extinction ( e1% / 1cm ) ? max. = 0.0005 %water = 830 1130loss on drying ( 110°c ) = 12% 1146 light green powder 500 gm 1147 light green sf yellow 25 gm 1148 lignocaine hydrochloride 10 mlinjection ip = 2%lignocaine hydrochloride ip 2% w / vsodium chloride = 0.45% w / vmethyl paraben = 0.2% w / vwater for injection ip q.s 1149 lignocaine hydrochloride 20 ml 1150 lincomycin 15 mcg ( 250 disc ) 1151 lincomycin 2 mcg ( 250 disc ) 1152 linezolid ( antibiotic disc ) 30mcg ( 250 disc ) 1153 linezolid 10 mcg ( antibiotic disc ) ( 250 disc ) 1154 lipase, amylase, protease, cellulase, biodegradability 3.785 liter 1155 lipid controls 5 ml 1156 lipoporotein ( a ) – 5 ml 1157 lipoprotein 100 ml 1158 liquid paraffin ( heavy ) 500 ml 1159 liquid paraffin light 500 mlguarantee analysisweight per ml at 20°c = 0.84 0.89gmrefractive index at 20°c = 1.480identification ( by ir ) = passes test 1160 liquor ammonia 500 ml 1161 listeria enrichment broth ( base ) 1162 listeria innocua 1163 listeria monocytogenes 1164 lithium carbonate 100 ml 1165 liver broth 1166 l lysine hydrochloride 10 gm 1167 l mould brass – specimen holder used for holding the wax block for taking sections on the microtome. ( size – 7.5 × 3 × 1.9 cm pair ) 1168 l mould brass – specimen holder used for holding the wax block for taking sections on the microtome. ( size – 4.5 x 2.5 x 0.5 cm pair ) 1169 lomefloxacin 10 mcg 1170 loop ( 1 mm ) each pack 1171 loop ( 10mm ) each pack 1172 loop ( 2mm ) each pack 1173 loop ( 4mm ) each pack 1174 l ornithine hydrochloride 10 gm 1175 lpa 100 ml 1176 l threonine 1177 l tyrosine 1178 lugols iodine 100 ml 1179 lugols iodine 250 ml 1180 lugols iodine 500 ml 1181 l valine 1182 lysozyme 1183 m.p. test kit ( pv, pf ) –100 tests 1184 m.p. test kit ( pv, pf ) –50 tests 1185 m.p. test kit ( pv, pf ) – 25 tests 1186 mac cartney bottle with screw cork 1187 mac conkey agar 500 gm 1188 macconkey broth 1189 macconkey sorbitol agar500 gm 1190 magnefying glass 3 each 1191 magnesium chloride ( mgcl2 ) 100 gm 1192 magnesium chloride ( mgcl2 ) 500 ml 1193 magnesium chloride hexahydrate 1194 magnesium powder 500 gm 1195 magnesium sulphate 500 gm 1196 magnesium sulphate heptahydrate 1197 malachite green 100 gm 1198 malaria elisa 96 w 1199 malt extract 1200 maltose 500 gm 1201 mangenese chloride 1202 mannitol egg yolk polymyxin ( myp ) agar 1203 mannitol salt agar 1204 manual cell counter with 9 keys for dlc – differential blood cell counter 9 windows total of keys8 or 9 keys total of windows 2 ( totalaizer ) each window figure range:0 999number of buttons 8 number of windows 9dimensions ( mm ) w320xd80xh50 1205 masson trichrome stain reagent 1206 mathicilin : 5x50 t 1207 may grunwald stain 20gm 1208 may grunwald stain 500ml 1209 mayer’s hemalum solution 1 ltrsspecification: density = 1.05 / cm3 ( 20°c ) ph = 1.8 2.2 ( 20°c ) ci752904.4gm / lal2 ( so4 ) 3 18h20 = 28gm / lc6h8o7h2o = 0.5 gm / l 1210 mayer’s hemetoxylene solution 1 gm 1211 mc cal a ( mastercurve calibrator a ) 100 ml 1212 mc grunewald stain 500 ml 1213 mdm 2 1 ml 1214 measles igm ( ab ) elisa 1 x 96 1215 measuring jar 500 ml 1216 measuring scoop each 1217 mecillinam 10 mcg ( 250 disc ) 1218 melan a 1 ml 1219 m endo agar 1220 mercuric chloride 500 gm 1221 mercuric oxide red 100gminorganic chemical assay = 99 %appearance ( form ) = solid colour = redpurity = 99 %mol. wt. = 216.59grade ar / grmelting point = 500°c 1222 mercuric oxide red 500gm 1223 mercuric sulphate 500 gm 1224 meropenem ( antibiotic disc ) 10mcg ( 250 disc ) 1225 metanil yellow 500 gm 1226 methanamine 3% 500 ml 1227 methanamine silver 100 ml 1228 methanol – 500 ml 1229 methanol ( methyl alcohol ) 2.5 ltrsminimum assay 99.8 %maximum limit of impurities • colour = 10 hu• water = 0.1 %• acidity ( hcooh ) = 0.001 %• alkalinity ( nh3 ) = 0.0002 %• non volatile matter = 0.001 %• aldehydes and ketones = 0.005 %• ethanol = 0.1 %• copper = 0.00005 %• lead = 0.00005 %• iron = 0.0001 %• permanganate = 0.00025 % 1230 methyl alcohol 5 ml 1231 methyl blue 25 gm 1232 methyl green 250 gm 1233 methyl red indicator – 250 ml 1234 methyl violet / crystal violet powder 250 gm 1235 methyl violet / crystal violet powder 500 gm 1236 methyl violet / crystal violet solution 100 ml 1237 methyl violet / crystal violet solution 250 ml 1238 methyl violet / crystal violet solution 500 ml 1239 methylene blue ( aqueous ) 100 ml 1240 methylene blue 100 gm 1241 methylene blue 250 gm 1242 methylene blue 500gm 1243 methylene blue new 100 ml 1244 methylene chloride 250 ml 1245 methylene green 100 gm 1246 metronidazole 5 mcg ( 250 disc ) 1247 metronidazole 80 mcg ( 250 disc ) 1248 mezlocillin 30 mcg ( 250 disc ) 1249 mezlocillin 75 mcg ( 250 disc ) 1250 m fc agar 1251 mg powder 500 g 1252 micafungin ( mic e test strip ) 1253 micafungin powder ( solubilized powder, g irradiated ) 1 mg 1254 micafungine mic e strip 1255 michel’s transport media 1256 micro albumin control level 1 100 ml ( compactible with dirui cst240 ) 1257 micro albumin csf / urine 100 ml 1258 micro albumin with calibrator 100 ml ( compactible with dirui cst240 ) 1259 micro clean 1 ltr. 1260 micro protein control level 1 100 ml ( compactible with dirui cst240 ) 1261 micro protein kit 1262 micro protein with calibrator 100 ml ( compactible with dirui cst240 ) 1263 microfililaria rapid card test each 1264 microtube rack 1265 milk agar 1266 minocycline ( antibiotic disc ) 30mcg ( 250 disc ) 1267 modified charcoal cefoperazone deoxycholate agar ( mccd ) 1268 modified dixon agar 250 gm 1269 modified dixon agar 500 gm 1270 modified mha500 gm 1271 molecular grade h2o – 500 ml 1272 molecular ladder 100bp 1273 mollecular ladder 1kb 1274 molybdic acid 500 ml 1275 motility test media 1276 moxalactum ( antibiotic disc ) 30mcg ( 250 disc ) 1277 moxifloxacin 5 mcg ( antibiotic disc ) ( 250 disc ) 1278 mpo staining reagent – benzidin power 250 gm 1279 mr reagent 100 ml 1280 msa ( mannitol salt agar ) media 250 gm 1281 msa ( mannitol salt agar ) media 500 gm 1282 msn ( vaccutainer needle ) 1283 mtt tetrazolium 1284 mueller hinton agar 500 gm 1285 mueller kauffman tetrathionate novobiocin broth base ( mkttn ) 1286 multi calibrator antibiotic tdm 100 ml 1287 multi enzyme cleaner with neutral ph containing5 15% non ionic surfactants, enzymes ( amylase, lipase & protease ) , fragrancessolubilisers, corrosion inhibitors, colouring agents. declared conformity as medical device according to mdd93 / 42 / eec.alcohol, c13 c15 branched and linear, butoxylated ethoxy, ethanol, alkyl polyethylenglycol polybutylenglycolether, sodium cumenesulfonate, pack size: 2 litre bottle 1288 multidet kit 1000ml 1289 multienzymatic cleaner, jar manufacturer / marketing company should be certifying according to din en iso 9001, 14100 & 13485 certificate 1290 multipurpose labelling tape 1291 mumps igm ( ab ) elisa 1 x 96 1292 mupirocin 200 mcg ( 250 disc ) 1293 mupirocin 5 mcg ( 250 disc ) 1294 myo d1 1 ml 1295 myogenin 1 ml 1296 myoglobin 1 ml 1297 myoglobin 100 ml 1298 myoglobin calibrator 100 ml 1299 n acetyl l cystine ( nalc ) 10 gm 1300 n, n dimethyl form amide ( sigma d 4551 ) – 500 ml 1301 n, n, n, n tetramethylethylenediamine ( temed ) 1302 n, n’ methylene bis acrylamide 1303 n.a. agar 1304 n 1 nepthyl ethylenediamine dihydrochloride ( 100g ) ( acs reagent, >98.0% ) 1305 na + k standard solution 100 ml 1306 na+ & k+ standard solution 500ml 1307 nadp 100mg ( purity ( hplc ) > 95 % / spectrophotometric purity > 95 % ) 1308 nadph 100mg ( powder, =97% ( dry weight ) , mol wt.833.4 ) 1309 nafcillin 1 mcg ( antibiotic disc ) ( 250 disc ) 1310 nalc 10 gm 1311 nalidixic acid ( antibiotic disc ) 30mcg ( 250 disc ) 1312 naphthol a s phosphate ( sigma n 5625 ) – 500 ml 1313 natidixic acid ( antibiotic disc ) p. size 5x 250 1314 n butanol 500 ml 1315 n butyl alcohol 500ml 1316 negative calibrator dau 100 ml 1317 neomycin 30 mcg ( antibiotic disc ) ( 250 disc ) 1318 neomycin 5 mcg ( antibiotic disc ) ( 250 disc ) 1319 netilmicin ( antibiotic disc ) 30mcg ( 250 disc ) 1320 neubauers counting cover slip each 1321 neurocysticercosis igg elisa 96 w 1322 neurocysticercosis igm elisa kit 96 w 1323 neuron specify enalase 1324 neutral red ( 0.62% aquor solution ) – 500 ml 1325 neutrophil alkaline phosphate reagent 1326 nh3 control 1 100 ml ( compactible with dirui cst240 ) 1327 nh3 control 2 100ml ( compactible with dirui cst240 ) 1328 nh3 reagent 100 ml ( compactible with dirui cst240 ) 1329 nigrosin powder–250 gm 1330 nigrosin powder– 100 gm 1331 ninhydrin 10 gm 1332 nitric acid 500 ml 1333 nitric acid ( conc ) 500 ml 1334 nitrofurantoin ( antibiotic disc ) 300mcg ( 250 disc ) 1335 nitrofurantoin 100 mcg ( antibiotic disc ) ( 250 disc ) 1336 nitrofurantoin 200 mcg ( antibiotic disc ) ( 250 disc ) 1337 nitrofurantoin 50 mcg ( antibiotic disc ) ( 250 disc ) 1338 nlgrosln stain – 25 gm 1339 no foam reagent 100 ml 1340 norfloxacin 2 mcg ( antibiotic disc ) ( 250 disc ) 1341 norfloxcin ( antibiotic disc ) 10mcg ( 250 disc ) 1342 normal saline 500 ml 1343 norovirus, stool, antigen, ridascreen; r. biopharma 1344 novacastraihc detection kit 1250 x 1 1345 novobiocin disc ( antibiotic disc ) 10mcg ( 250 disc ) 1346 novoline polymer 1kit 1347 nse 1 ml 1348 nuclear fast red 100ml 1349 nuclease free water or diethylpyrocarbonate ( depc ) 5 ml 1350 nutrient agar 500 gm 1351 nutrient agar 1000 gm 1352 nutrient broth 1353 nutrient gelatin 1354 o. toluidine – 200 gm 1355 o.g.6 powder 25 gm 1356 occult blood test kit immunochromatography 25tests 1357 octenidine based wash lotion with neutral ph, tested as per european norms containing octenidine hcl, aqua, cocamidopropylamine oxide, peg 7 glyceryl cocoate, glycerin, hydroxyethyl cellulose, lactic acid, contains allantoin, for full body wash head to toe, pack size: 500 ml bottle 1358 octenidine based wash mitts with pratical hand dimension, tested as per european norms containing octenidine hcl, aqua, glycerine, cocamidopropylamine oxide, sodium lactate, allantoin, ethylhexyl glycerine, pack size: 100 pcs per packet 1359 ofloxacin ( antibiotic disc ) 10mcg ( 250 disc ) 1360 ofloxacin 5 mcg ( antibiotic disc ) ( 250 disc ) 1361 oilminth peperment 1362 oleandomycin 10mcg ( antibiotic disc ) ( 250 disc ) 1363 oleandomycin 15 mcg ( antibiotic disc ) ( 250 disc ) 1364 oleic acid ( 5g ) ( ) purity ( gc ) > 99 % _cell culture test pass 1365 onpg disc100 disc ( 250 disc ) 1366 ophyde 5 ltrs 1367 optochin disc ( antibiotic disc ) 5mcg ( 250 disc ) 1368 orange g 100gm 1369 orange g 25gmappearance = orange coloured powder formsolubility ( turbidity ) 0.1% aqueous clear solutionloss on drying = max. 10 %absorbance of 1 % aqueous solution in a 1cm cell vs h20 @478nm = 380 500 1370 orange serum agar 1371 orcein 200 ml 1372 ornithine dec arbovylace test reagent 1373 ortho phosphoric acid 1374 orthotoluidine 20 ml 1375 oxacillin ( antibiotic disc ) 1mcg ( 250 disc ) 1376 oxacillin 5 mcg ( antibiotic disc ) ( 250 disc ) 1377 oxalate powder 250gm 1378 oxalic acid 500 gm 1379 oxalic acid 2% 500 ml 1380 oxford listeria selective agar 1381 oxford listeria selective supplement 1382 oxidase reagents disc 1 pack ( pack of 100 discs ) 1383 oxidase reagents powder 250 gm 1384 oxidative / fermentative medium with “ferric chloride” reagent 250 ml 1385 oxolinic acid 2 mcg ( 250 disc ) 1386 oxytetracycline 30 mcg ( 250 disc ) 1387 p 120 1 ml 1388 p 53 1 ml 1389 p 63 1 ml 1390 p.h. liquid handicator 1391 p.p.d. 10 tu 10ml 1392 p.p.d. 10 tu 5ml 1393 p.p.d. 2 tu 5ml 1394 p.p.d. 5 tu 5ml 1395 p.t kit prothrombin kit ( isi value = 1.1 liquid stable ) 5ml 1396 palcam listeria selective agar 1397 palcam listeria selective supplement 1398 pals solution 100 ml 1399 pan cytokeratin 1 ml 1400 panta 15 ml 1401 pap staining kit 1402 paper auto clave print paper sheets 1403 paper butter paper each 1404 paper cellulose acetate paper for electrophoresis each 1405 paper eto thermal printing paper sheets 1406 paper filter paper – 25 pcs. 1407 paper litmus paper blue – each 1408 paper litmus paper red – each 1409 paper ph indicator paper pack of 100 1410 paper r.a. printing paper each 1411 paper sample appicafor for cellulose acetate paper electrophoresis each 1412 paper thermal paper 4.2” 50 mtrs 1413 paper tissue paper – the tissue paper is hygienic, soft to touch, and highly absorbent. disposable 100 pcs / pack 1414 paper water filter papers 100 leaves 1415 paper whatman filter paper no2 1416 paraffin liquid 500ml 1417 paraffin sealing strip / tapeeach pack 1418 paraffin wax ( granules ) – 500 gm. 1419 paraffin wax = 2 kg 58 t0 60°c specification: alkaline / acid reacting substance passes test solidification point = 58 60°culphated ash =0.05%suitability for histopathology passes test. 1420 parafilm dispenser with cutter each 1421 paraformaldehyde 1422 parvo b 19 igm ( ab ) elisa 1 x 96 1423 pas and diastase enzyme 100 ml 1424 pasture pipette with rubber 1425 pax 5 1 ml 1426 pbs buffer 1x 500 ml each 1427 pbs buffer 1x 6ml 1428 pcr – primer for thalassaemia & sickle cell anamia – 500 ml 1429 pcr buffer 2x 25ml each 1430 pcr buffer 2x 500 ml each 1431 pcr buffer 5x 500 ml each 1432 pcr buffer 5x 25ml each 1433 pcr grade water 100 ml 1434 pcr microplate with septa 48 well ( polypropylene pcr microplate compatible with standard pcr machine, non skirted, clear, should be supplied with compatible plastic septas ) 1435 pcr microplate with septa 96 well ( polypropylene pcr microplate compatible with standard pcr machine, non skirted, clear, should be supplied with compatible plastic septas ) 1436 pcr plate 0.1 ul 1437 pcr plate 0.2 ul 1438 pcr plate 96 well 1439 pcr plate clear sealing films 96 well ( 100 per pack ) ( functional temperature range 40 to +104 °c ) 1440 pcr plate cover 0.1ul 1441 pcr plate cover film 0.2 ul 1442 pcr plate flexi – 96 well 1443 pcr primer ( 100 oligonucleotides, average 20b / oligo ) labelled with fam ( fam dye labelled customized oligonucleotidess for pcr reaction ) 1444 pcr primer ( 100 oligonucleotides, average 20b / oligo ) labelled with hex ( hex dye labelled customized oligonucleotidess for pcr reaction ) 1445 pcr primer ( 100 oligonucleotides, average 20b / oligo ) labelled with rox ( rox dye labelled customized oligonucleotidess for pcr reaction ) 1446 pcr primer ( 100 oligonucleotides, average 20b / oligo ) labelled with tamara ( tamara dye labelled customized oligonucleotidess for pcr reaction ) 1447 pcr primer ( 100 oligonucleotides, average 20b / oligo ) unlabelled ( unlabelled customized oligonucleotidess for pcr reaction ) 1448 pd 1 50ul ( 40ug ) 1449 pda agar 1450 peflox ( imported ) 5mcg ( 250 disc ) 1451 pefloxacin ( antibiotic disc ) 5 mcg ( 250 disc ) 1452 penicilin g ( antibiotic disc ) 10 units ( 250 disc ) 1453 pepsin 1 gm 1454 peptone 500gm 1455 peptone water media 500gm 1456 perchloric acid schiff ( pas ) kit 1457 perfumed liquid based softening agent with anti static property and biodegradable having ph of 6.5 7.5 ltr. 1458 periodic acid: 25gm specification: ph 1.2 ( 100gm / l, h2o, 20 degree celsius bulk density – 1400kg / m3, assay ( iodometric ) >98.0%melting point ( lower value ) >124 degree celsius melting point ( upper value ) >129 degree celsius 1459 periodic acid 0.5% 100 ml 1460 periodic acid 1% 100 ml 1461 peripheral blood karyotyping readymade culture media rpm1 16501 1462 peripheral blood karyotyping readymade culture media rpmi 1640 1463 perl’s staining reagent – potassium feno 250 ml 1464 perls iron stain1 & 2 ( twin pack ) specificationa. perls 1 potassium ferrocyanide 250ml b. persl2 hydrochloric acid 250ml 1465 petri disc 4” glass – each 1466 petri disc 4” pvc – each 1467 petri plate 100mm each 1468 petroleum ether 250 ml 1469 ph buffer ( buffer capsule ) ph 4.0 1470 ph buffer ( buffer capsule ) ph 7.0 1471 ph buffer ( buffer capsule ) ph 9.2 1472 ph meter each 1473 phenobarbital 100 ml 1474 phenol red indicator 100ml 1475 phenotoin 100 ml 1476 phenyl hydrogen hydrochloride 95 % 1477 phenyl phosphatedisodium salt 1478 phenylalanine agar 1479 phosphate buffer saline 120 ml 1480 phosphate buffer saline 500 ml 1481 phosphomolybdic acid 25 gm 1482 phosphoric acid 500 ml 1483 phosphorus 100 ml 1484 phosphorus kit 50 t 1485 phosphotungstic acid 100 gm 1486 phosphotungstic acid 500gmspecification: physical state at 20°c = solidappearance = white to yellowish powder or crystalodourlessmelting point / freezing point = 95°csolubility in water ( % weight ) = 200gm / 100gm watersubstance insoluble in water = max. 0.01 %chloride = 0.01 %sulphate = max. 0.01 %total nitrogen = 0.005 %loss on ignition at ( >50°c ) = max.17 % 1487 picric acid ( lyctophenol ) 250 ml 1488 picric acid 500 gm 1489 picric acid ( saturated ) 100 ml 1490 pilocarpine 2% & 4% 1491 pipemidic acid 20 mcg ( antibiotic disc ) ( 250 disc ) 1492 piperacillin ( antibiotic disc ) 100mcg ( 250 disc ) 1493 piperacillin + tazobactum ( antibiotic disc ) 100 ( 250disc ) 1494 piperacillin 100 mcg + tazobactam 10 mcg ( antibiotic disc ) ( 250 disc ) 1495 piperacillin 30 mcg ( antibiotic disc ) ( 250 disc ) 1496 piperacillin 30 mcg + tazobactam 6 mcg ( antibiotic disc ) ( 250 disc ) 1497 piperacillin 50 mcg ( antibiotic disc ) ( 250 disc ) 1498 piperacillin 75 mcg ( antibiotic disc ) ( 250 disc ) 1499 piperacillin 75 mcg + tazobactam10 mcg ( antibiotic disc ) ( 250 disc ) 1500 piperazine n, n’ bis ( 2 ethanesulfonic acid ) 1501 pipette –westerngren esr 1502 pipette – autopipette 0.1 10 ul 1503 pipette – autopipette 1 200 ul 1504 pipette bulb each 1505 pipette – disposable pipette single 1506 pipette – graduated pipettes 10 ml 1507 pipette – graduated pipettes 1ml 1508 pipette – graduated pipettes 2 ml 1509 pipette – graduated pipettes 5 ml 1510 pipette – hemoglobin pipette each 1511 pipette – pasteur pipettes with rubber blubs each 1512 pipette – pipette stand ( it should be madeup of polymethyl methacrylate, atleast 5 places for pipettes ) 1513 pipette – r.b.c. pipette ( german ) pcs 1514 pipette sterilized pasture pipette each 1515 pipette – sterilized pasture pipette with rubber each 1516 pipette variable pipette: micropipette, adjustable volume, fully autoclavable eight channel : 05 50 ul, 30 300ul & 100 1000ul 1517 pipette variable pipette: micropipette, adjustable volume, fully autoclavable single channel : 01 10ul, 02 20ul, 05 50ul, 10 100ul, 20 200ul, 100 1000ul spring loaded tip cone for connecting tips very tightly, adjustment opening for adjusting pipettes to a specific liquid and volume.control button with very low operating force, color indication for pipette volume. tip ejector with very low operating force, positioned for perfect ergonomics. volume display: 4 digits with magnifier. to provide thermal, mechanical and chemical stability piston should manufactured from fortro material very easy removable lower part for cleaning pipette no discoloration upon uv irradiation. confirmation to specification must 1518 pipette w.b.c. pipette ( german ) pcs 1519 plastic cassettes for automatic tissue processer – 500 ml 1520 plate elisa plate 96 well 1521 plate microtitre plate with lid 96 well flat bottom 1522 plate microtitre plate with lid 96 well round bottom 1523 plate count agar 1524 platelet count fluid 2.5 ltrs 1525 platelet count fluid 500 ml 1526 platelet diluting fluid 125ml / bottle 1527 poatato dextrose ( pda ) agar 1528 poivceu red staining solution 500 ml 1529 pollyf ( cement ) 1530 polyclonal rabbit anti human c1q complement / fitc one kit ( 2ml concentrated ) ( the reagent should be used for demonstration of human c1q in tissues, and may also be used for other immunofluorescence techniques. the anti human c1q complement conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g / l.antibody titre must be so that it could provide f / p ratio: e495 nm / e278 nm = 0.65 ± 0.05 corresponding to a molar fitc / protein ratio of >2.0.it should be compatible for frozen section and paraffin embedded tissues.should have high sensitivity and specificity.the shelf life must be 7 9 months at the time of delivery.the antibody should be compatible with manual and automated system.demonstration should be performed before supply of purchase order. ) 1531 polyclonal rabbit anti human c3 complement / fitc one kit ( 2ml concentrated ) ( the reagent should be used for demonstration of complement c3 in tissues, and may also be used for other immunofluorescence techniques. the complement c3 conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum conjugated with fluorescein isothiocyanate isomer 1. protein concentration must be labeled in g / l.antibody titre must be so that it could provide f / p ratio: e495 nm / e278 nm = 0.65 ± 0.05 corresponding to a molar fitc / protein ratio of >2.0.the antibody should react with human c3 c part of c3 and c3b.it should be compatible for frozen section and paraffin embedded tissues.should have high sensitivity and specificity. ) 1532 polyclonal rabbit anti human fibrinogen / fitc one kit ( 2ml concentrated ) ( the reagent is intended for demonstration of human fibrinogen in tissues, and may also be used for other immunofluorescence techniques. the fibrinogen conjugate should be prepared from a purified protein fraction of rabbit antiserum. protein concentration must be labeled in g / l.antibody titre must be so that it could provide f / p ratio: e495 nm / e278 nm = 0.65 ± 0.05 corresponding to a molar fitc / protein ratio of >2.0.it should be compatible for frozen section and paraffin embedded tissues.should have high sensitivity and specificity.the shelf life must be 7 9 months at the time of delivery.the antibody should be compatible with manual and automated system.demonstration should be performed before supply of purchase order. ) 1533 polyclonal rabbit anti human iga / fitc one kit ( 2ml concentrated ) ( the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human iga conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g / l.antibody titre must be so that it could provide f / p ratio: e495 nm / e278 nm = 0.65 ± 0.05 corresponding to a molar fitc / protein ratio of >2.0.it should be compatible for frozen section and paraffin embedded tissues.should have high sensitivity and specificity.the shelf life must be 7 9 months at the time of delivery.the antibody should be compatible with manual and automated system.demonstration should be performed before supply of purchase order. ) 1534 polyclonal rabbit anti human igg / fitc one kit ( 2ml concentrated ) ( the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human igg conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g / l.antibody titre must be so that it could provide f / p ratio: e495 nm / e278 nm = 0.65 ± 0.05 corresponding to a molar fitc / protein ratio of >2.0.it should be compatible for frozen section and paraffin embedded tissues.should have high sensitivity and specificity.the shelf life must be 7 9 months at the time of delivery.the antibody should be compatible with manual and automated system.demonstration should be performed before supply of purchase order ) 1535 polyclonal rabbit anti human igm / fitc – one kit ( 2ml concentrated ) ( the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human igm conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g / l.antibody titre must be so that it could provide f / p ratio: e495 nm / e278 nm = 0.65 ± 0.05 corresponding to a molar fitc / protein ratio of >2.0.it should be compatible for frozen section and paraffin embedded tissues.should have high sensitivity and specificity.the shelf life must be 7 9 months at the time of delivery.the antibody should be compatible with manual and automated system.demonstration should be performed before supply of purchase order. 1536 polyethylene glycol 6000 1537 poly l lysine 100mlsolution. 0.1% ( w / v ) in h20 p8920 1538 polymerase 1539 polymeric biguanide hydrochloride inhouse greated then 10% alkyle dimethyle benzyle ammonium chloride and didecyle dimethyle ammonium chloride in house greater then 10% quantative nonporous surface test for the evolution of bactericidal and or fungicial antvity of chemicals 1540 polymeric bigunide hydrocholide 10 % alkyl dimethyle benzyl ammonium chloride and dodecyl dimethyle ammonium 1541 polymixin b 50 mcg ( antibiotic disc ) ( 250 disc ) 1542 polymixinb ( antibiotic disc ) 300mcg ( 250 disc ) 1543 posaconazole ( mic e test strip ) 1544 posaconazole mic e strip 1545 posaconazole powder ( solubilized powder, g irradiated ) 1546 pot urinary urine collector – material plastic colour blue / white closure type screw pattern solidcapacity 50 millilitersproduct dimensions 8w x 5h centimeters shape round 1547 potassium acetate 500 gm 1548 potassium almunium sulphate 500 gm 1549 potassium aluminium sulphate 100 gm 1550 potassium carbonate ( khco3 ) 500 gm 1551 potassium chloride ( kcl ) 500 gm ( reagentplus®, =99.0% ) 1552 potassium citrate 1553 potassium dichromate ( powder ) 1554 potassium dihydrogen diphosphate 5 kg [ potassium po4 mono basic ) assay ( after drying ) = 99.0 101.0 %ph ( 5 % aqueous ) = 4.1 4.5maximum limits of impurities • chloride = 0.01 % • sulphate = 0.05 %• iron = 0.002 %• heavy metals ( pb ) = 0.002 %• sodium ( na ) = 0.2 % 1555 potassium dihydrogen orthophosphate 1556 potassium dihydrogen phosphate 500 gm 1557 potassium dihydrogen phosphate gr ( kh2po4 ) 500 gm 1558 potassium ferrocyanide 2% 500 ml 1559 potassium ferrocyanide 99% 500 gm 1560 potassium hydroxide ( koh ) 250gm 1561 potassium hydroxide ( koh ) 500gm 1562 potassium iodide 500 gm 1563 potassium iodide crystal 100 gm 1564 potassium iodide crystal 200 gm 1565 potassium nitrate – 500 gm 1566 potassium oxalate 500 g 1567 potassium periodate 1568 potassium permanganate ( acidified ) 100 ml 1569 potassium permanganate 500 gm 1570 potassium peroxomono sulphate 5 kg ( in house ) ( 50% w / w ) with 3rd party test report from reliable lab, or indian or european norm certificates 1571 potassium phosphate di basic ( k2hpo4 ) ( 250g ) ( bioultra, for molecular biology, =99.0% ) 1572 potassium phosphate monobasic ( kh2po4 ) ( 500g ) ( acs reagent, =98% ) 1573 potassium thiocyanate 99% 500 gm 1574 potassium thionate 100 gm 1575 potato dextrose agar 500 gm 1576 potato dextrose agar with chloramphenicol 1577 povidone iodine ip ( 7.5 % w / v ) 100 mli.e. available iodine ( 0.75 % w / v 1578 povidone iodine solution ip 5% w / v 250 mlavailable iodine 0.5 % w / vpurified water ip q.s 1579 povidone iodine ip 10 % w / v , ( 1.0 % w / v available iodine ) u.s.p equivalent to 1% available iodine, <10% nonylphenol, <10% ethoxylated, <10% polyethylene glycol 400, <10% citric acid, <10% sodiumphosphate, 30 70% water, pack size: 500 ml bottle 1580 povidone iodine ip 7.5 % w / v, ( equivalent to 0.75 % w / v available iodine ) , 0 10% ammonium nonoxynol sulfate, 0 10% glycerol, 0 10% , sodium lauryl sulfate, 0 10% sodium phosphate dibasic, 0 10% hydroxyethylcellulose, 0 10% potassium iodide, >20% , water with emollient & moisturiser, pack size: 500 ml bottle 1581 pre albumin 100 ml 1582 pre albumin calibrator 100 ml 1583 progestone receptor 3 ml 1584 protease inhibitor 1585 protein kit per kit 1586 protein mw marker 1587 protein, rust, coffee and ink spotting kit kit 1588 proteinase k ( powder ) 100mg ( 100mg powder, to be used in dna isolation, molecular biology use only, source from pichia pastoris or tritirachium album activity unit per mg =30 ) 1589 proteolytic enzymatic cleaner 1590 proteolytic enzyme ( proteas ) , instrument compatibility 1 ltrs 1591 proteus mirabilis 1592 prulifloxacin ( antibiotic disc ) 10mcg ( 250 disc ) 1593 prussian blue 500 ml 1594 psa 1 ml 1595 psa stain 100 ml 1596 pseudomonas aeruginosa 1597 pseudomonas agar base 1598 pseudomonas cfc selective supplement 1599 pseudomonas cn selective supplement 1600 pseudomonas selective agar ( cfc agar ) 1601 p toluidine 1602 pumic stone 500 gm 1603 purified mercury 100 gm 1604 qc for clinical chemistry 100 ml 1605 quality control for clinical chemistry high 1606 quality control for clinical chemistry normal 1607 quinpristine dalfopristine ( antibiotic disc ) 15mcg ( 250disc ) 1608 r.a. factor test ( r.a. latex 100 t ) 100 test 1609 r.b.c diluting fluid 500mlappearance = clear colourless solution 1610 r.b.c lysis solution 200 ml 1611 r.c.m. media 250 gm 1612 rabbies elisa 96 w 1613 rack 96 well rack for mct tubes ( for 2ml tube ) ( it should be made up of polycarbonate, must contain 96 places ( 8x12 ) for 1.5ml tube. ) 1614 rack pcr rack with cover 1615 rack pcr tube rack 96 set 1616 rack pipette rack 6 pcs capacity 1617 rack sample racks for sample tube each 1618 rack sample racks for sample tube each 1619 rack somersault rack universal each 1620 rack staining rack staining jarincluding lids – 8 numbersslide rack 1body type – stainless steel size – 47.5 x12.0x12.0 cm 1621 rack steelrack – formicroscope slides slide staining rack is made of aluminium and stainless steel staining rack comes with movable handle. stainless steel slide rack is resistant to staining solutions.hinged rack handle allows easy insertion and removal of the microscope slides.slide staining rack holds up to 25 microscope slides. 1622 rack steel rack – to hold 50 slides 1623 rack test tube rack 24 tube 1624 rack test tube rack ( 36 holes ) alumunium 1625 rack universal combi rack 1626 rack test tube rack 36t 1627 raffinose pentahydrate 1628 rapid kit for c.difficile 1629 rapid kit for h pylori 100 tests 1630 rapid test kit for clostridium difficile pack of 50 test 1631 rapid test kit for salmonella species pack of 50 test 1632 rappaport vassiliadis soya peptone broth 1633 rat repallent each 1634 ravuconazolepowder ( solubilized powder, g irradiated ) 1 mg 1635 ready plate chromogenic coliform agar 1636 reagent reservoir 200ml 1637 reagent reservoir / troughs autoclavable ( polypropylene, 75ml, ) 1638 reaty to use for drug assay methotrexate assay – 3.0 ml 1639 reaty to use for drug assay phenobarbital assay 28ml with calibrator 1640 reaty to use for drug assay phenobarbital assay 14 ml with calibrator 1641 reaty to use for drug assay phenytoin assay 14 ml with calibrator 1642 reaty to use for drug assay phenytoin assay 28ml with calibrator 1643 reaty to use for drug assay valporic acid assay 14 ml with calibrator 1644 reaty to use for drug assay valporic acid assay 28ml with calibrator 1645 reaty to use for drug assaycarbamazepine assay 14 ml with calibrator 1646 reaty to use for drug assaycarbamazepine assay 28ml with calibrator 1647 rectangular staining jar – 10 in no. 1648 red mercuric oxide 100 1649 red nucleic acid gel stain liquid ( non mutagenic, non hazardous for disposal, highly stable and environmentally safe fluorescent nucleic acid dye for agarose gel electrophoresis ) 1650 reels auto clave tape reels 1651 reels sterilization packaging reels 200 mtr 40 cmsreels 1652 reels sterilization packaging reels200 mtrs 10 cmsreels 1653 reels sterilization packaging reels200 mtrs 20 cmsreels 1654 reinforced clostridial agar 1655 resorcinol 50 g 1656 ret search ii 1 ltr 1657 reticulin stain kit 500 ml 1658 reticulocyte counting fluid 250 mlblue coloured fluid solubility = miscible with watersolubility test = passes test 1659 rf 100 ml 1660 rf latex calibrator 100ml 1661 rf quantitative with calibrator 100 ml ( standard compatible with dirui cs 240 system pack ) 1662 rhamnose disc 1663 rhodamine b 1664 riboflavin 1665 rifampicin ( antibiotic disc ) 5mcg ( 250 disc ) 1666 rifampicin 2 mcg ( antibiotic disc ) ( 250 disc ) 1667 rifampicin 25 mcg ( antibiotic disc ) ( 250 disc ) 1668 rifampicine 30 mcg ( antibiotic disc ) ( 250 disc ) 1669 rna extraction kit100 test 1670 rna extraction kit50 test 1671 rna extraction kit 250 test 1672 rna zap pcr dna degradation solutions500 ml 1673 rna later 1674 rnase free water 1675 rnase inhibitor 30 ml 1676 rnase zap ( 250ml ) , cleaning agent for removing rnase 1677 robo levels 1678 rod glass rod each 1679 roll bc robo 888 ( thermal paper ) 50 mm x 30 mm ( robo roll ) 1680 roll tissue paper roll 15 mtrs 1681 roll tissue paper rolls ( laboratory grade, 2 ply, 50 meter ) 1682 roll tsc priater carbon roll 5 ( 1 / 2 ) 1683 roll tyvek roll – 10 ” rolls 1684 roll tyvek roll – 15.5”rolls 1685 roll tyvek roll – 6” rolls 1686 rota virusfecal ag elisa 1 x 96 1687 rotary sealer nos. 1688 rpmi 1640 for fungal testing 500 ml 1689 rpr test kit – 100 test 1690 rt pcr covid 19 rt pcr kit 1691 rt pcr dengue serotyping rt pcr kit each 1692 rt pcr h1n1 rt pcr 1 x 96 ( 1 pack ) 1693 rt pcr h3n2 amplification rt pcr 1 x 96 ( 1 pack ) 1694 rt pcr hpv rt pcr high risk genotype detection kit 1695 rt pcr hpv rt pcr kit 1 x 96 t 1696 rt pcr respiratory syncytial virus rt pcr 96 test 1697 rt pcr rt pcr hbv dna viral load100 test 1698 rt pcr rt pcr hcv rna viral load100 test 1699 rt pcr superscript iii one step rt pcr kit – 100 r each 1700 rt pcr zika rt pcr kit 1701 rt pcr hbv dna viral load100 test 1702 rt pcr hcv rna viral load100 test 1703 rubber cork each 1704 rubber for burette 3 / 8” 1705 rubber teat round and large each 1706 rubber teat each 1707 rubber tubing 5 / 8” – each 1708 rubella igg elisa 1 x 96 1709 rubella igm elisa 1 x 96 1710 ruler metallic scale inch and cm marking exactly on the ends measurement can begin at zero and scale at end for rule, stainless steel and round safety edge grinding and polishing and thicker side great value as 1 set of 3 length 6 inch to 24 inch material?stainless steel colour ?silver graduation range ?0 60 centimeters product dimensions ?61l x 2.5w centimeters 1711 s 100 1 ml 1712 sabroud dextrose agar 500 gm 1713 sabroud dextrose agar with cap 1714 saccharomyces cerevisiae 1715 saccharose 1716 safety goggle each 1717 saffranin ( prepared solution ) 500 ml 1718 saffranine 250 gm 1719 safranine staining 1720 salicylic acid 500 ml 1721 salmonella poly o antiserum 1722 salt1 kg. 1723 sample cup 100 pc 1724 sample processing cup each 1725 sanidex opa withtest strip & deactivator, biodegradibility , instrument compatibility report 5 ltr 1726 saponin extra pure 100gmspecification: mol. formula = namol. wt. = nainsoluble matter in water max. 0.1 %loss on drying ( 150°c ) = max. 10 %sulphated ash = max. 10 %microbial limits = passes test 1727 saturated tartragine 500 ml 1728 scaald mucosa sampler each 1729 schiff reagent: 500ml specification: appearance clear colorless to slight pink coloredphysical state at 20 degree celsius liquid, ph<2density 1g / cm3, solubility in water ( % weight ) completely soluble 1730 scrub typhus igm elisa 1 x 96 ( 1 pack ) 1731 sda 500 gm 1732 sda 1000 gm 1733 sda with cycloheximide 500 gm 1734 selective enrichment secondary supplement for listeria 1735 selective enrichment supplement for listeria 1736 selective supplement for chromogenic listeria agar 1737 selenite cysteine broth 1738 selenite cystine broth base 1739 serum copper kit 25ml 1740 serum protein caibrator 100 ml 1741 shelf life of 5 years 500 ml bottle 1742 shikata orcein 100 ml 1743 shoes cover 100 pc 1744 sickle test kit 100 tests 1745 sickle test kit 50 tests 1746 silica gel for column chromatography 500 gmgrade 60 120 mesh size, grade 100 200 mesh size, grade 230 400 mesh size, 1747 silver allow 100 gm 1748 silver nitrate 10% 100 ml 1749 silver nitrate 5% 500 ml 1750 sim media 250 gm 1751 sim media 500 gm 1752 slanetz and bartley medium 1753 slide cavity slide for vdrl ( 24 wells ) 1754 slide concavity slide ( one cavity ) each 1755 slide concavity slide ( two cavity ) each 1756 slide double frosted slide 50pcs pkt 1757 slide glass monocavity slide 25 mm x 75 mm x 1.3 mm each pack 1758 slide glass slide – ground edges, refractive index isi 50 slides 1759 slide microscope slides – ( plain ) 50 pcs clear glass ground edges 26x76 + 0 / 1 mmthickness – 1.35+ 0.1 mm 50 pcs / pack 1760 slide microscope slides –for i.h.c. eachpositively charge slides & positively charge slides hydrophilic treating with reagents such as aminosilane, poly l lysine or others 1761 slide warming table 1762 sma 1ml 1763 sms wraps sheets 120 x 120cms sheets 1764 sms wraps sheets 75 x 75cms sheets 1765 soda lime 5 kg 1766 sodium acetate 100 ml 1767 sodium alginate 500 gm 1768 sodium alphanaphthy phosphate 250 ml 1769 sodium azide ( nan3 ) 100 gm 1770 sodium bicarbonate 500 gm• magnesium phosphate• deionized water• tungsto phosphoric acid hydrate• pas stain• pearl’s stain• mpo stain 1771 sodium bicarbonate ( nahco3 ) 150 gm 1772 sodium carbonate ( na2co3 ) 500gm ( powder, =99.5%, acs reagent ) 1773 sodium chloride [ nacl ] 5 kgassay nlt = 99.9 %ph ( 5 % aqueous solution ) = 5.0 8.0maximum limits of impurities • water insoluble matter = 0.003 %• bromide & iodide = 0.005 %• ferrocyanide = 0.0001 %• phosphate = 0.0005 %• sulphate = 0.002 %• total nitrogen = 0.001 %• arsenic = 0.00004 %• barium = 0.001 %• calcium = 0.002 %• iron = 0.0002 %• lead = 0.0002 %• potassium = 0.01 %• magnesium = 0.002 %• loss on drying = 0.5 % 1774 sodium chloride 500 gm 1775 sodium citrate500 gm 1776 sodium citrate 3.2 % 500 ml 1777 sodium citrate agar 500 gm 1778 sodium deoxycholate 100 gm 1779 sodium dichloroisocynanurate 500mg. excipeent q.s available chlorine 300mg, pack size: 50 tablets per bottle 1780 sodium dichromate dihydrate 1781 sodium dihydrogen phosphate 500gm 1782 sodium dithionate 85 % extra pure 1 kgspecification: mol. formula = na2s2o4mol. wt. = 1 / 4.11assay ( iodometric ) = 85 87.5iron ( fe ) = max. 0.002 % ( at the moment of batch analysis ) 1783 sodium dodecyl sulphate ( sds ) 1784 sodium fauro cholate 500 ml 1785 sodium fluoride powder 500 gm 1786 sodium hydrogen sulphite 1787 sodium hydroride 500 gm 1788 sodium hydrosulphite ( dithionite ) 100 gm 1789 sodium hydroxide ( naoh ) 500 ml 1790 sodium hydroxide ( naoh ) 500 gm 1791 sodium hydroxide based liquid alkali booster concentrate. ltr. 1792 sodium hydroxide maximum 5% based bleaching agent 5 ltr. 1793 sodium hydroxide pellets purified 500 gm 1794 sodium hydroxide pellets purified 250 gm 1795 sodium hydroxide ( naoh ) 500 ml 1796 sodium hypochlorite solution 5 ltrs 1797 sodium hypodiphosphate 1798 sodium lauryl sulphate solution fo 94.haemoglobin estimation 1799 sodium meta bi sulphate 500gm [ na2s2o5 , mol. wt. = 190.13 ] minimum assay ( iodometric ) = 95.0 %maximum limits of impurities • chloride = 0.1 %• iron ( fe ) = 0.01 % 1800 sodium meta bi sulphate 65% based rinsing aid kg. 1801 sodium nitrite 500gm ( acs reagent, =97.0% ) 1802 sodium nitrite 500gmpowder or crystals ( acs reagent, >96.99.0% ) 1803 sodium nitroprusside 100 gm 1804 sodium nitroprusside 500 gm 1805 sodium nitroprusside dihydrate for analysis 500 gmm = 297.95 g / molspecification: assay = 99.0 102.0 %substances soluble in water = 0.01 %chloride ( cl ) = 0.02 %sulphate ( so4 ) = conformshexacyanoferrate ( iii ) = 0.02 % 1806 sodium parborate monohydrate 50% w / w saniscop, 1 en 14561 bactericidal 2 ) en14562 pesticidal 3 ) en 13704 sporicidal 4 ) instrument compatibility report 5 ) en 14348 microbectericidal 1807 sodium perborate monohydrate 50% w / w saniscop, 1 ) en 14561 bactericidal2 ) en 14562 yeasticidal 3 ) en 13704 sporicidal 4 ) instrument compatibility report 5 ) en 14348 micobactericidal810 gm 1808 sodium perchlorate ( 500gm ) ( acs reagent, >98.0%, in powder or chunk form ) 1809 sodium perchlorate monohydrate 500 gm 1810 sodium phosphate dibasic ( na2hpo4 ) ( acs reagent, =99.0% ) 500 gm 1811 sodium phosphate dibasic dihydrate ( na2hpo4 ) ( 250 gm ) ( acs reagent, =99.5% ) 1812 sodium phosphate monobasic dihydrate [ nah2po4 h2o ] assay nlt = 98.5 %ph ( 5 % aqueous solution ) = 4.2 4.6maximum limits of impurities • chloride = 0.01 %• sulphate = 0.02 %• arsenic = 0.0001 %• iron = 0.002 %• heavy metals ( as pb ) = 0.0005 %• loss on drying ( 130°c ) = 21.0 24.0 % 1813 sodium pyruvate 1814 sodium taurocholate 500gm 1815 sodium thiocyanate 1816 sodium thioglycollate salt 1817 sodium thiosulphate250 ml 1818 sodium thiosulphate500 gm 1819 sodium thiosulphate 2% 100 ml 1820 sodium thiosulphate 5% 100 ml 1821 sodium tungstate 250 gm 1822 sodium tungstate dihydrate 1823 solica get for thin layer chromatography 500 gm 1824 soyabean casein digest agar ( scda ) 1825 sparfloxacin ( antibiotic disc ) 5mcg ( 250 disc ) 1826 spatula ayre”s spatula for cervical pap smear – sterile ayre spatula wood / plastic lenght: 18 cm / 18.8 cm individually packed in sterile pouch, in box of 100 1827 spatula sazaly – spatula with cyto brush ( ratable 360deg ) 1828 spatula spatula chattaway 5” 1829 spatula spatula one end flat , one endspour 12” 1830 spatula spatula one end flat, one endspour 6” 1831 spatula spatula both side 8” 1832 spectinomycin ( antibiotic disc ) 100mcg ( 250 disc ) 1833 spiramycin 100 mcg ( antibiotic disc ) ( 250 disc ) 1834 spirit ( burning ) 5 ltrs 1835 spirit ( rectified ) 5 ltrs 1836 spirit alcohol5 ltrs 1837 spirit lamp each 1838 spirit lamp ss each 1839 spirit ( methylated ) 500 ml 1840 ssc 20 x buffer 1841 stabilized formulation of hydrogen peroxide 10% v / v, silver 0.01% w / v for critical area fumigation and surface disinfection, non toxic, non irritating, eco friendly, pack size: 1 litre bottle 1842 stabilized hydrogen peroxide ( 11 % w / v ) diluted silver nitrate solution ( 0.01 % w / v ) 1843 staining reagent red panceaus stainer each 1844 staining solution 500 ml 1845 staining trough glass trough with cover, approx. 9 x 7 x 6.5 cmglass coverstaining tray made of stainless steelstaining tray made of stainless steel with extended handlestaining trough 1846 staining trough glass trough without coverglass coverstaining tray made of stainless steelstaining tray made of stainless steel with extended handlestaining trough 1847 staining trough ( for bulk staining ) 1848 staining trough plastictrough with cover, approx. 9 x 7 x 6.5 cmplastic cover staining tray made of stainless steel staining tray made of stainless steel with extended handle staining trough 1849 stainless steel 1850 stand e.s.r. stand 10 tube 1851 stand loop stand each 1852 stand pcr tube stand 48 pc 1853 stand pipette stand 6 pcs capacity 1854 stand test tube stand 12 tubes 1855 stand test tube stand 24 tubes 1856 stand tripod stand each 1857 stand universal test tube stand 6 pcs capacity 1858 staphylococcus aureus 1859 starch 500 gm 1860 starch sluble ( acs grade ) 1861 steri pette xl 1862 sterile connector for connnecting device each 1863 sterilized yellow – 1000 pcs. 1864 sticker 1500 sticker pack 1865 stop watch – square design, plastic construction and lcd displayshow hour, minute, second, am / pm indicator, month, data, and day of the weekselect 12 or 24 hour user with chronograph stopwatches 1 / 100 second chronograph up to 23hours, 59 minutes, 59 seconds timer stopwatches alarm with 4 minutes snooze powered by one ag13 button cell ( included ) hourly chime function and alarm function are includednylon fabric neck strap for easy carryingsplit / reset, mode and start / stop buttons for convenient operation dial window material type: plasticdial display: digital 1866 straight wire each pack 1867 strains 250 ml 1868 streptomycin ( antibiotic disc ) 10mcg ( 250 disc ) 1869 streptomycin 300 mcg ( antibiotic disc ) ( 250 disc ) 1870 streptomycin 50 mcg ( antibiotic disc ) ( 250 disc ) 1871 strip tube retainer ( should be certified dnase and rnase free, must hold 0.2ml 96 tubes or 12 strip tubes at a time ) 1872 stromato lyser fba 5 ltrs 1873 stromato lyser ffs 42 ml 1874 stromatolyser fourth dl ( 4dl ) 5 l 1875 stroptozotocinz 500 gm 1876 substrate for alp conjugated 2 ab tmb ( 3, 3, 5, 5 tetramethylbenzidine ) dab ( 3, 3 diaminobenzine ) tetrahydrochlor 5 gm 1877 substrate for alp conjugated 2* ab nitro blue tetrazolium chloride ( nbt ) 1 gm 1878 sucrose 500 gm 1879 sucrose powder 250 gm 1880 sucrose powder 500 gm 1881 sudan black 500ml 1882 sudan black b powder 250 gm 1883 sudan black: 10gm specification: colour dark brown black, appearance ( form ) powder molar extinction coefficient @ 596nm , min20, 000 loss on drying max 5% 1884 sudan black: 100gm 1885 sudan black: 25 gm 1886 sugar disc cellotrise 4% 1887 sugar disc dulcitol 4% 1888 sugar disc fructose 4% 1889 sugar disc glucose 4% 1890 sugar disc inositol 4% 1891 sugar disc lactose 4% 1892 sugar disc maltose 4% 1893 sugar disc melibiose 4% 1894 sugar disc ruffinose 4% 1895 sugar disc sucrose 4% 1896 sugar disc trehalose 4% 1897 sugar disc xylose 4% 1898 sulfadiazine 0.25 mcg ( antibiotic disc ) ( 250 disc ) 1899 sulfamethoxazole 23.75mcg ( antibiotic disc ) ( 250 disc ) 1900 sulfamethoxazole 23.75 mcg + trimethoprim 1.25 mcg ( antibiotic disc ) ( 250 disc ) 1901 sulfathiazole 0.25 mcg ( antibiotic disc ) ( 250 disc ) 1902 sulfisoxazole 0.25 mcg ( antibiotic disc ) ( 250 disc ) 1903 sulfolyser 5l 1904 sulphosalic acid 500 gm 1905 sulphosalicylic acid 500 gm 1906 sulphur powder 500 gm 1907 sulphuric acid ( h2so4 ) 20 % 500 ml 1908 sulphuric acid ( h2so4 ) conc 500ml 1909 sultax ( cefoaximen + sulbactam ) ( antibiotic disc ) p. size 5 x 250 1910 super mix 25ml each 1911 supersensitive wash buffer 500 mlspecification: concentrated wash bufferdilute 1 part with 19 parts deionised water. 1912 swab stick – for pap smear 100 pcs 1913 swab stick sterile swab stick with cover 100 pcs 1914 syaptophysin 1 ml 1915 syber safe ( gel stain , dna ) 1916 sybr green pcr mix ( 500 reactions ) 1917 synaptophysin 1 ml 1918 syphillis card 1919 syphillis elisa 96 w 1920 syringe filter ( 0 2 ) ul 1921 system calibrator 100 ml 1922 tank serological pipette tank 1923 taq dna polymerase 500u ( to be used in pcr reaction ( 500u minimum ) ) 1924 taq polymerase each 1925 tartaric acid 500 ml 1926 t butyl alcohol 500ml 1927 tcbs media 250 gm 1928 tcbs media 500 gm 1929 teasing needle for mycology 1930 teicoplanin ( antibiotic disc ) 30mcg ( 250 disc ) 1931 telithromycin 15 mcg ( antibiotic disc ) ( 250 disc ) 1932 tellurite cefixime supplement 1933 temocillin 30 mcg ( antibiotic disc ) ( 250 disc ) 1934 temperature thermometer 1935 terbinafine mic e strip 1936 tetra methyl phenylene 250 ml 1937 tetracycline ( antibiotic disc ) 30mcg ( 250 disc ) 1938 tetracycline 10 mcg ( antibiotic disc ) ( 250 disc ) 1939 tetracycline 5 mcg ( antibiotic disc ) ( 250 disc ) 1940 tetrathionate broth 500 gm 1941 tetrazolium salt 1942 thc 100 ml 1943 thermofisher automated rna extraction kit 1944 thiamin hydrochloride 1945 thio urea 500gm 1946 thioacetamide 1947 thiosemicarbaxide 0.5 % 100 ml 1948 thiosulfate citrate bile sucrose ( tcbs ) agar 1949 thymol 1 kit 1950 thymol blue 500 gm 1951 tibc 150ml 1952 ticarcilin ( antibiotic disc ) 75mcg ( 250 disc ) 1953 ticarcilin –clavulanic acid ( antibiotic disc ) 10mcg ( 250 disc ) 1954 ticarcilin –clavulanic acid ( antibiotic disc ) 75mcg ( 250 disc ) 1955 tigecyclin ( antibiotic disc ) 15mcg ( 250 disc ) 1956 tincture benzoin 1957 tincture iodine 1958 tips blue tips 500 pcs 1959 tips filter tips 10 ul 100 ul 1960 tips filter tips 10μl 96 tipes 1961 tips filter tips 100 ul 1000 ul 1962 tips filter tips 2 ul 10 ul 1963 tips filter tips 20 ul 200 ul 1964 tips filter tips 1000μl 96 tipes 1965 tips filter tips 20μl 96 tipes 1966 tips filter tips 200μl 96 tipes 1967 tips filteredtips200 1000ul 96 t 1968 tips sterilefiltered tips 01 10ul 1969 tips sterilefiltered tips 02 20ul 1970 tips sterilefiltered tips 100 1000ul 1971 tips sterilefiltered tips 10 100ul 1972 tips sterilefiltered tips 20 200ul 1973 tips sterile filtered tips 1 50ul 96pc 1974 tips sterile microtips ( 0.5 10ul ) ( clear pre sterile, nonfilter microtips ) 1975 tips sterile microtips ( 1000ul ) ( clear pre sterile, non filter microtips ) 1976 tips sterile microtips ( 20 200ul ) ( polypropylene, pre sterile, non filter, yellow microtips without tip box ) 1977 tips yellow tips – 1000 pc pack 1978 tissue capsule / embedding cassette ( large ) 1979 tissue capsule / embedding cassette ( small ) 1980 tissue cassate leica 1000 pc 1981 tissue embedding cassette – ( large ) made from acetyl polymer resistant to histological solventsnon cytotoxic, non metallic colorsstorage temp. room temp eachmeasures: 3x2.5x0.4 cm. 1982 tissue embedding cassette – ( small ) made from acetyl polymer resistant to histological solventsnon cytotoxic, non metallic colors storage temp. room temp each slot measures: 1 x 5 mm, total 128 slots per cassette 1983 tissue freezing media 200 ml 1984 titriplex 1985 tobidine blue 250 gm 1986 tobramycin ( antibiotic disc ) 10mcg ( 250 disc ) 1987 toluene 250 ml 1988 toluidine blue 100ml 1989 torniquate 1 meter 1990 total iron kit 150ml 1991 total protein kit3 x 150ml 1992 total protien csf / urine 100 ml 1993 total rna isolation from blood ( 50 reactions ) 1994 tough spots assorted colours 1995 toxo igg elisa 1 x 96 ( 1 pack ) 1996 toxo rapid igg / igm 50 tests 1997 transferin 1 kit 1998 tray draining tray it should be madeup of polycarbonate, autoclavable, dimention should be ( mm ) 400x300x100 ( lbh ) 1999 tray ice tray each 2000 tray slide tray 2001 tray tray 3000ml 2002 tray utility tray each 2003 tri sodium citrate dihydrate purified 250 gm 2004 tri sodium citrate dihydrated purified 500 gm 2005 tributyrin agar 2006 trichlorgacetic acid 500 ml 2007 trichloro acetic acid ( 250g ) ( acs reagent, =99.0% ) 2008 trichrome stain ( masson kit ) : specification: aniline blue solution 250mlbiebrich scarlet acid fuschin solution 250ml phosphomolybdic acid solution 250ml phosphotunngstic acid solution 250ml 2009 trifluoroacetic acid 2010 triglyceride kit 2x150ml 2011 triglycerides 100 ml 2012 trimephoprim ( antibiotic disc ) 5mcg 250 disc 2013 trimolol 0.25% 2014 trimolol 5% 2015 triphicasepepten 250 gm 2016 triple sugar iron agar 500 gm 2017 tripple enzymatic cleaner 2018 tris base 500 gm 2019 tris buffer 500 g 2020 tris buffer ( 0.2 mol / l ) plt 9.0 – 500 ml 2021 tris hydrochloride 100 gm 2022 tris hydrochloride 250 gm 2023 tris powder ( 500gm ) ( acs grade, for molecular biology use ) 2024 tris chloride 500gm 2025 tris saturated phenol 2026 triton x 100 2027 trizol ( 500ml ) ( to be used for isolation of rna, dna, and protein ) 2028 troporine i stripe 10 t 2029 trypsin powder 250 gm 2030 tryptic soya broth 2031 tryptone broth 2032 tryptone soya yeast extract agar 2033 tsi 1000 gm 2034 tsi 250 gm 2035 tsi 500 gm 2036 tube 15 ml falcon tubes ( sterile, conical bottom, autoclavable, medical grade pp / hdpe confirming to usp class vi ) 2037 tube 50 ml falcon tubes ( sterile, conical bottom, autoclavable, medical grade pp / hdpe confirming to usp class vi ) 2038 tube acd buffer tubes ( 9ml yellow capped tube filled with acd buffer ( anticoagulant ) to be used for blood collection ) 2039 tube blood rna tube ( blood transport tubes for rna stability, containig 50 tubes per pack ) 2040 tube capillary tube 100pcs pack 2041 tube centrifuge tube 10 ml 2042 tube centrifuge tube 15 ml 2043 tube conical falcon graduated 15 ml each 2044 tube conical falcon graduated 50 ml each 2045 tube culture tube 10 x 100 mm – each 2046 tube cylindrical glass tubes for column chromatography each 2047 tube dreyers tube 500pcs 2048 tube durhams tube 1inch size 1000 pcs 2049 tube felix tube 500 pcs 2050 tube hemoglobin round tube each 2051 tube hemoglobin square tube – each 2052 tube hemoglobin tube ( german ) pcs 2053 tube id sample tube 96w 2054 tube kahn test tube 100 pcs pack 2055 tube mcfarland tube with autoclavable cork 2056 tube microcentrifuge tube 0.5ml ( sterile, clear, should have frosted cap surfaces for labeling ) 2057 tube microcentrifuge tube 1.5ml ( sterile, clear, should have frosted cap surfaces for labeling ) 2058 tube microcentrifuge tube 2.0ml ( sterile, clear, should have frosted cap surfaces for labeling ) 2059 tube microcentrifuge tube amber microcentrifuge tubes 1.5ml ( sterile, brown color mct tubes ) 2060 tube pcr 0.2 ml strip tubes with cap ( 8 tube strip ) ( it should be madeup of polypropylene, each strip should contain 8 tubes, must supplied with separate domed cap strip ) 2061 tube pcr strips tubes ( 200 ul ) with flat caps [ 500 strips ] ( packs ) ( polypropylene pcr tube, 0.2ml, 8 tubes / strip, dome caps should be supplied separately ( not attached to the tubes ) ) 2062 tube pcr tube with cap 0.1ml– 100 pc 2063 tube pcr tube with cap 0.2ml – 100 pc 2064 tube pcr tube with caps 0.1ul strip 2065 tube pcr tube with caps 0.2ul strip 2066 tube robo tube each 2067 tube test tube size – 12 x 75 mm 100 pc pack size 2068 tube test tube size – 12x 100 mm 100 pc pack size 2069 tube test tube size – 13 x100 mm 100 pc pack size 2070 tube test tube size – 15 x125 mm 100 pc pack size 2071 tube test tube size – 16 x150 mm 100 pc pack size 2072 tube test tube size – 18 x150 mm 100 pc pack size 2073 tube test tube size – 20 x150 mm 100 pc pack size 2074 tube test tube size – 25 x150 mm 100 pc pack size 2075 tube tissue carrier rna tube 2076 tube treated tubes 2077 tube tube with transparent label 1000 each 2078 tube wintrobetube 2079 tube leveler 2080 tween 20 100ml 2081 tween 80 100 ml 2082 typhidot igm test kit 50 tests 2083 typhidot kit for salmonella typhi 2084 typhidot test ( rapid test kit ) for typhoid fever 50 test 2085 udp glucose ( 250mg ) ( % purity ( hplc ) > 98 ) 2086 uibc 100 ml 2087 uibc / tibs 100 ml ( standard compatible with dirui cs 240 system pack ) 2088 uracil dna glycosylase ( 1 vial of 1 unit / ul 200 ul ) 2089 urea 100 ml 2090 urea 250 gm 2091 urea 500 gm 2092 urea kit 2x150ml 2093 urea solution 40 %5ml 2094 uric acid 100 ml 2095 uric acid kit 2x150ml 2096 urinalysis control 5 ml 2097 urine calibrator 100 ml 2098 urine chemistry control 5 ml 2099 urinometer each 2100 uristrix 100 t 2101 uristrix ten parameter multistix for urinalysis 10 pack ( 100 strips / pack ) specification 1. the pack size should be of 100 reagents strips per pack. 2. each reagents strips should be measure ph, specific gravity, protein, sugar, blood ( both hemolyzed and non hemolysed ) , bilirubin, ketone, urrobilinogen, leukocytes, nitrite with or without ascorbic acid. 3.the reaction priniciple for each test should be accouding to the latest and validated testing method and as per recent advancement like peroxidase test for glucose, ehrlich test for urobiligone, fauchet test for bilirubin etc.4. each strips should be of long expiry.5. maximum analysis time for each reagent strips must be less than 2 minutes.6. the color production for every reaction will be bright enough so that analyzed adequately.7. the readings for every test must be provided in both semi quantitative and standad units.8. the color comparator provided with the pack should of standard quality with color shades exactly matching with what appears on the strips so that no discrepency between color of reagent strip and comparator will occur. 2102 uv safety goggles 96w 2103 valproic acid 100 ml 2104 vancomycin ( antibiotic disc ) 35mcg ( 250 disc ) 2105 vancomycin mic e strip 2106 vancomycin powder 50gm 2107 varicella zoster igm ( ab ) elisa 1 x 96 2108 vial bomin vial 10 ml each 2109 vial cryo vial 1.0 ml 1000 pcs 1pkt 2110 vial cryo vial 1.8ml ( each pack 500 vials ) 2111 vial cryo vial 5ml 500 pc 2112 vial disposable vial – 100 pcs. 2113 vial edta vial ( vaccum ) 100 pcs. 2114 vial edta vial ( non vaccum ) 100 pcs 2115 vial fluid vial 100 pcs 2116 vial lithium heparin vacutainer ( green ) 100 pcs 2117 vial plain ( red non vaccum ) 100 pcs 2118 vial plain vial 100 pcs pack 2119 vial plain vial 5 ml glass 100 pcs 2120 vial plain vial ( white ) 5 ml 100 pcs pack 2121 vial proteinase k 20 mg ( vial ) 2122 vial ria vial each 2123 vial s.s.t tubes ( yellow / gold ) 100 vials 2124 vial sodium citrate 3.8% vial ( e.s.r non vaccum ) 100 pcs ( black ) 2125 vial sodium citrate 3.8% vial ( e.s.r vaccum ) 100 pcs ( black ) 2126 vial vacutainer with transparent level ( yellow ) : gel 100 pcs 2127 vial vacutainer with transparent level: oxo – flo / glucose ( grey ) 100 pcs 2128 vial vacutainer with transparent level: plain ( red ) ( clot activator ) 100 pcs 2129 vial sodium citrate 3.2 % vial ( ptinr ) 100 pc ( sky blue ) 2130 victoria blue 1.5 % 500 ml 2131 vimentin 1 ml 2132 violet red bile glucose agar 2133 von kossa stain 100 gm 2134 voriconazole mic e strip 2135 voriconazole powder ( solubilized powder, g irradiated ) 2136 vortex 2137 vp reagent 100 ml 2138 vtm / utm 96 w 2139 w.b.c diluting fluid 500mlappearance = bluish violet colouredphysical state @ 20°c = liquidodourlessph = 2.5 3.5absorption max. 588 594 nmabsorption ( ? max. diluted 1.25, 1cm ) = 0.450 0.600 2140 wash concentrate 100 ml 2141 wash solution 5 ltr 2142 weigerts iron hematoxylin 25 gm 2143 west nile igm elisa 1 x 96 2144 white petroleum jelly ( white vaseline ) 100 gm 2145 white petroleum jelly ( white vaseline ) 250 gm 2146 whole blood extraction kit 250 test ( 1 pack ) 2147 widal antigen ( for tube method ) 4x100ml 2148 widal antigen ( for slide test ) 4x100ml 2149 wipes 0.5% ahp based high level surface disinfectant tuberculocidal wipes wipes 2150 wipes kim wipes each 2151 wipes tissue wipes ( big towels packs ) ( size 37cm x 42cm. should be made from 100% virgin fiber, low lint and low extractable. for sensitive instrument / lens cleaning. ) 2152 wipes tissue wipes ( small towels packs ) ( size 21cm x 11cm. should be made from 100% virgin fiber, low lint and low extractable. for sensitive instrument / lens cleaning. ) 2153 x ray developer 1 kg 2154 x ray fixer 1 kg 2155 xld media 500gm 2156 xtum ( ceftriaxone + sulbactam ) ( antibiotic disc ) p. size 5 x 250 2157 xylene 2.5 ltrs ( specification: boiling range ( 95% ) = 137°c 142°cweight per ml at 20°c = 0.850 0.865nvm = 0.01% max.solution in alcohol = clear ) 2158 xylene 250 ml 2159 xylene 500 mlc6h4 ( ch3 ) ( specification: boiling range ( 95% ) = 137°c 142°cweight per ml at 20°c = 0.850 0.865nvm = 0.01% max.solution in alcohol = clear ) 2160 xylene cyanol 10 gm 2161 xylocaine 2% 25 ml 2162 yeast nitrogen base 500 gm 2163 zinc chloride 2164 zinc oxide 500gm 2165 zinc powder 500gm 2166 zinc sulphate 500gm 2167 zn stain fast kit 250 ml 2168 zymokeen ltr. 2169 list of reagents ( dedicated system pack for erba em 360 ) fully automatic biochemistry analyzer ( instruction : all parameters should be quotedby bidder ) 2170 glucose 100 ml 2171 urea 100 ml 2172 creatinine ( enzymatic ) 100 ml 2173 uric acid 100 ml 2174 total bilirubin 100 ml 2175 direct bilirubin 100 ml 2176 sgpt 100 ml 2177 sgot 100 ml 2178 lipase 100 ml 2179 amylase 100 ml 2180 alkaline phosphatase 100 ml 2181 total protein 100 ml 2182 albumin 100 ml 2183 calcium 100 ml 2184 phosphorus 100 ml 2185 total cholesterol 100 ml 2186 hdl cholesterol 100 ml 2187 triglyceride 100 ml 2188 direct ldl cholesterol 100 ml 2189 ck nac 100 ml 2190 crp quantitative with calibrator 100 ml 2191 ldh 100 ml 2192 gamma gt 100 ml 2193 micro albumin with calibrator 100 ml 2194 micro protein with calibrator 100 ml 2195 quality controll1 100 ml 2196 quality controll2 100 ml 2197 system multi calibrator 100 ml 2198 list of reagents dedicated system pack for dirui cst240 fully automatic biochemistry analyzer ( instruction : all parameters should be quotedby bidder ) 2199 glucose 100 ml 2200 urea 100 ml 2201 creatinine ( enzymatic ) 100 ml 2202 uric acid 100 ml 2203 total bilirubin 100 ml 2204 direct bilirubin 100 ml 2205 sgpt 100 ml 2206 sgot 100 ml 2207 lipase 100 ml 2208 amylase 100 ml 2209 alkaline phosphatase 100 ml 2210 total protein 100 ml 2211 albumin 100 ml 2212 calcium 100 ml 2213 phosphorus 100 ml 2214 total cholesterol 100 ml 2215 hdl cholesterol 100 ml 2216 triglyceride 100 ml 2217 microalbumin with calibrator 100 ml 2218 microprotein with calibrator 100 ml 2219 quality controll1 100 ml 2220 quality controll2 100 ml 2221 system multi calibrator 100 ml 2222 evacuated blood collection ( plastic ) tubes with serum separating gel and clot activator i. tube dimensions: ( a ) 13mm x 75mm with draw volume 3.5ml ( b ) 13mm x 100mm with draw volume 5ml ii. gel: resin based acrylic gel with consistent bias angle, density and volumeiii. clot activator: spray coated silica, amount adequate for draw volume to clot within 15 mins iv. stability of gel consistency to be maintained for six months at 18 25°c v. documented stability of results for routine chemistry and therapeutic drug monitoring parametersmaterial of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2223 evacuated blood collection tubes with powdered sodium fluoride and na2edta for glucose estimations i. dimension: 13mm x 75mm with 2ml draw ii. anticoagulant: naf 2.5mg / ml of blood with 1 2mg / ml of disodium edta, spray dried iii. documented evidence of stability of glucose levels upto 24hrs material of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2224 evacuated blood collection tubes with clot activator i. dimensions: ( a ) 13mm x 75mm with 4ml draw ( b ) 13mm x 100mm with 6ml draw ii. clot activator: spray coated silica, amount adequate for draw volume to clot within 15 mins iii. documented stability of results for routine chemistry parametersmaterial of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2225 evacuated blood collection tubes with k2edta ( violet cap ) i. dimensions: ( a ) 13mm x 75mm with 2ml draw and 3.6mg k2edta ( b ) 13mm x 75mm with 3ml draw and 5.4mg k2edta ( c ) 13mm x 75mm with 4ml draw and 7.2mg k2edta ( d ) 13mm x 100mm with 6ml draw and 10.8mg k2edta ii. documented stability of results for hematological parameters iii. pack size: 100 / self pack material of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2226 evacuated blood collection tubes with 3.2% sodium citrate i. dimension: 13mm x 75mm ii. draw volume: ( a ) 2.7ml blood + 0.3ml citrate and ( b ) 1.8ml blood + 0.2ml citrate iii. minimal headspace iv. content: 3.2% buffered sodium citrate 0.105 to 0.109m v. pack size: 100 / self pack material of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2227 evacuated blood collection tubes with spray coated lithium heparin i. dimensions 13mm x 75mm with 4ml draw ii. clot activator: spray coated with lithium heparin iii. pack size: 100 / self pack material of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2228 blood collection tubes for pediatric patients i. silicone coated, 250 500 ul fill volume with anti spillage caps ii. with k2edta additive, 250 500 ul fill volume with anti spillage caps iii. with naf / na2edta additive, 400 600 ul fill volume with anti spillage capsiv. with 3.2% sodium citrate, 500 1000 ul fill volume and anti spillage capsv. contact activated lancets for high flow: 1.5mm width x 2.0mm depth material of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2229 flashback needles with holders i. 21g x 1.5” ii. 22g x 1.5”visibility of blood flow at the needle junction is a must material of tube: polyethylene terephthalate ( pet ) , safe for incineration: environmental safety data must be provided, suitable to withstand centrifugation forces between 1000 2000 rcf, . spillage proof rubber caps ( non screw type ) , stability of draw volume to be maintained for six months at 18 25°c with <10% intra lot and inter lot variation. us fda / european ce / iso 6710 ( for evacuated blood collection tube ) certification 2230 chlorhexidine gluconate solution ip 20 % v / v ( equivalent to chlorhexidine gluconate 4 % w / v ) with isopropanol<10%, ethoxylated alkylphenol<10%, fatty acid diethanolamide<10%, acetic acid glacial<1%, cellulose and fragrance<10%emollient & moisturising agents with automatic dispenssorpasses en 1499 standards 2231 povidone iodine ip 7.5 % w / v ( equivalent to 0.75 % w / v available iodine ) 0 10% ammonium nonoxynol sulfate, 0 10% glycerol, 0 10% sodium lauryl sulfate, 0 10% sodium phosphate dibasic, 0 10% hydroxyethylcellulose, 0 10% potassium iodide, >20% waterwith emollient & moisturiser 2232 octenidine based wash lotion with neutral ph, tested as per european norms containing octenidine hcl, aqua, cocamidopropylamine oxide, peg 7 glyceryl cocoate, glycerin, hydroxyethyl cellulose, lactic acid, contains allantoinfor full body wash head to toe 2233 chlorhexidine gluconate solution ip 10 % v / v ( equivalent tochlorhexidine gluconate 2 % w / v ) isopropyl alcohol ip 70% v / vpasses en 13727, en 13624 and en 14476 standards 2234 chlorhexidine gluconate solution ip 10 % v / v ( equivalent tochlorhexidine gluconate 2 % w / v ) ethanol ip 80% v / vpasses en 13727, en 13624 and en 14476 standards 2235 stabilized formulation of hydrogen peroxide 10% v / vsilver 0.01% w / v for critical area fumigation and surface disinfection, non toxic, non irritating, eco friendly, 1 litre 2236 each 100 g containsisopropyl alcohol ip 70% w / v . surfactant, corrosion inhibitor, stabilzer provided with hand sprayer 500 ml pack 2237 multi enzyme cleaner with neutral ph containing5 15% non ionic surfactants, enzymes ( amylase, lipase & protease ) , fragrancessolubilisers, corrosion inhibitors, colouring agents. declared conformity as medical device according to mdd93 / 42 / eec. alcohol, c13 c15 branched and linear, butoxylated ethoxy, ethanol, alkyl polyethylenglycol polybutylenglycolether, sodium cumenesulfonate 2238 innovative tenside system containing 5 15% anionic surfectants, < 5 % nonionic surfectants, <5% polycarboxylate, enzymes. other excipients: solubiliser, corrossion inhibitorssodium cumenesulfonate, sodim etasulfate, 2 aminoethanol, alcohols, c13 15 branched and linear, butoxylated ethoxylated, alkylpolyethylen glycol polybutylen glycolether, subtilisin, glucerol 2239 100 g of granules contain the following active ingredients: 43 g sodium per carbonate, 22 g tetraacetylethylenediamine.passes en 13624, en 13727, en 14348, en 14561, en 14562, en 14563, en 13704 and en 14476 standards 2240 hydrogen peroxide disinfectant cleaner wipes, cdsco approved. en 13727 bactericidal in 1 min. en 13624 fungicide in 1 min 1.4% w / v of hydrogen peroxide ( 100 vol ) i.p and 0.01% w / v of silver nitrate i.p...

Rural Development Department - Jharkhand

40814736 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at itkhori, g.p itkhori of block itkhori, distt. chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40814735 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at banhe, g.p banhe of simaria block, distt. chatra. rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at banhe, g.p banhe of simaria block, distt. chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40814734 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at pratappur, g.p pratappur of pratappur block, distt. chatra. rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at pratappur, g.p pratappur of pratappur block, distt. chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40814732 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at gadilong g.p gadilong, block tandwa, distt. chatra. rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at gadilong g.p gadilong, block tandwa, distt. chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40814729 rate contracts for the supply and installation of medical equipment / appliances etc. of child ward at sajna of panchayat paradih in chatra block, distt. chatra. rate contracts for the supply and installation of medical equipment / appliances etc. of child ward at sajna of panchayat paradih in chatra block, distt. chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40814726 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at nawadih, g.p nawadih of block hunterganj, distt. chatra. rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at nawadih, g.p nawadih of block hunterganj, distt. chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40686031 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at sajna of panchayat paradih in chatra. rdd / sd / chatra / eoi 18 / 2023 24 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at sajna of panchayat paradih in chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40686030 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at nawadih, g.p nawadih of block hunterganj in chatra. rdd / sd / chatra / eoi 20 / 2023 24 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at nawadih, g.p nawadih of block hunterganj in chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40686025 rate contracts for the supply and installation of medical equipment/appliances accessories etc. of child care ward at banhe,g.p banhe of simariya block, chatra. rdd/sd/chatra/eoi 19/2023 24 rate contracts for the supply and installation of medical equipment/appliances accessories etc. of child care ward at banhe,g.p banhe of simariya block, chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine (ms) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine (ms) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress (manual) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker (single ss top) , general over bed table , saline stand (airport type) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley (ss top, ms base) , wheel chair , baby cot (ms) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40686024 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at gadilong g.p gadilong, block tandwa, in chatra district. rdd / sd / chatra / eoi 21 / 2023 24 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at gadilong g.p gadilong, block tandwa, in chatra district. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40686023 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at pratappur, g.p pratappur of pratappur block in chatra. rdd / sd / chatra / eoi 22 / 2023 24 rate contracts for the supply and installation of medical equipment / appliances accessories etc. of child care ward at pratappur, g.p pratappur of pratappur block in chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine ( ms ) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress ( manual ) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker ( single ss top ) , general over bed table , saline stand ( airport type ) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley ( ss top, ms base ) , wheel chair , baby cot ( ms ) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Rural Development Department - Jharkhand

40686021 rate contracts for the supply and installation of medical equipment/appliances accessories etc. of child care ward at itkhori, g.p itkhori of block itkhori in chatra. rdd/sd/chatra/eoi 23/2023 24 rate contracts for the supply and installation of medical equipment/appliances accessories etc. of child care ward at itkhori, g.p itkhori of block itkhori in chatra. , icu uniticu mechanical bed with abs pannel collapsible side railings, wheel & mattress , 4” icu bed mattress , deluxe bed side locker , cardiac table with gas spring system , multipara patient monitor , monitor stand powder coated , defibrillator machine , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , icu ventilator , crash cart trolley full ss 304g , instavac suction machine (ms) , abg machine , icu bed side curtain with track , pediatric icuelectric icu pediatrics bed 5 function with nurse panel, abs pannel, butterfly railings, wheel & ss iv rod , 4” icu pediatric bed mattress , deluxe bed side locker , multipara patient monitor , monitor stand powder coated , led x ray view box double , syringe pump , infusion pump , bipap machine , icu ventilator , crash cart trolley full ss 304g , instavac suction machine (ms) , icu bed side curtain with track , single bed cabinhospital fowler bed with abs pannel , collapsible side railings & wheels , fowler bed mattress , semi deluxe bed side locker , cardiac table with gas spring system , icu bed side curtain with track , emergency & recovery unit emergency hydraulic recovery trolley with mattress , emergency recovery trolley with mattress (manual) , defibrillator machine , multipara patient monitor , ward unit hospital semi fowler bed with abs pannel , semi fowler bed mattress , bed side locker (single ss top) , general over bed table , saline stand (airport type) , 3 para patient monitor , three fold bedside screen , dressing trolley full ss 304g , medicine trolley with 4 drawer , stretcher trolley (ss top, ms base) , wheel chair , baby cot (ms) with mattress , opd unitexamination couch with mattress , led x ray view box double , revolving stool full ss , stethoscope , other equipments100 ma x ray machine with table , usg color doppler machine , endoscopy full set , child play eqpplay eq....

Indian Army - Jharkhand

40632521 bids are invited for creche baby feeding big table for preparing feeds , electric kettle , induction stove , sauce pan with lid , steel container with lid 3 5 ltr , small plates , small bowl , ss spoon , hand towel , baby bib set of 6 , baby sheet , mosquito nets , baby blankets , small mattress , fridge 184ltr , chair , small baby chairs , water drum 50 ltr , wall posters , bucket , tub plastic , bath stool , water dispenser for drinking water , baby cot , play pan , slide for kids , rocking horse , vacuum cleaner , wall to wall carpet , av display monitor , all wheather ac 1.5 ton , stabiliser for ac total quantity : 128...

Indian Army - Jharkhand

40632471 bids are invited for creche baby feeding big table for preparing feeds , electric kettle , induction stove , sauce pan with lid , steel container with lid 3 5 ltr , small plates , small bowl , ss spoon , hand towel , baby bib set of 6 , baby sheet , mosquito nets , baby blankets , small mattress , fridge 184ltr , chair , small baby chairs , water drum 50 ltr , wall posters , bucket , tub plastic , bath stool , water dispenser for drinking water , baby cot , play pan , slide for kids , rocking horse , vacuum cleaner , wall to wall carpet , av display monitor , all wheather ac 1.5 ton , stabiliser for ac total quantity : 128...

Institute Of Food Technology - Jharkhand

40541508 auction sale of for disposal of unserviceable/condemned items such as office equipments/scientific equipments/it equipments item quantity 3 4 9 1 3 2 1 sl. no. 1. split ac 2. window ac 3. stabilizer 4. inverter 5. blower 6. ceiling fan 7. cooler 8. halogen heater 9. pedestal of 10. water cooler 11. water purifier 12. refrigerator godrej 13. geyser 25ltr. 14. grass cutter 15. s type chair 16. revolving chair 17. plastic chair 18. iron folding chair 19. revolving lab stool 20. steel table 21. steel trunk 1 2 1 1 6 46 1 3 3 2 22. cash box 23. telephone 24. set top box 25. cctv camera 26. exhaust fan 27. camp cot 28. sprayer 29. trolley for inverter 30. hero bicycle 31. kettle without plate 32. changer switch 33. vehicle trailer 34. battery 35. 36. wall clock digital camera 37. camera 2 13 7 3 1 1 1 1 1 1 1 12 2 12 38. oil extraction machine 39. weighing machine 40. insect light trap 41. 42. oz atrsozone generator precision balance. quantity 1 1 1 1...

Indian Council Of Forestry Research And Education - Jharkhand

40469208 auction for disposal of unserviceable/condemned items such as office equipments/scientific equipments/it equipments split ac window ac stabilizer inverter blower ceiling fan cooler halogen heater pedestal fan. water cooler water purifier refrigerator godrej geyser 25ltr. grass cutter s type chair revolving chair plastic chair iron folding chair revolving lab stool steel table steel trunk cash box telephone set top box cctv camera exhaust fan camp cot sprayer trolley for inverter hero bicycle kettle without plate changer switch vehicle trailer battery wall clock digital camera camera oil extraction machine weighing machine insect light trap oz atrsozone generator pricision balance heating mantle. socsplus rotary microtome spectrophotometer soxhlet apparatus gps deep freezer microwave oven hot plate rotary horizontal shaker mist propagator made of high grade aluminum printer cpu computer system monitor laptop workcentre 7428 photocopier online ups skva luminous ups nokia 1200 mobile sony ericsson mobile tab samsung gionee mobile...

Military Engineer Services - Jharkhand

40427006 special repair of furniture ( wooden and steel ) against sureyed off ( ber ) furniture under ge ranchi , sch a part i ( wooden furniture ) , almirah mess utencil fd 93 ( m ) , chair easy cushioned fd 358 , side board fd 241 , sofa set 04 seater ( 2+1+1 ) fd 281 , sofa set 05 seater ( 3+1+1 ) fd 281 , table dressing ladies with stool fd / map ii / 07 , table dining 06 personfd / map ii / 03 , table dining 04 person fd / map ii / 03 , table centrefd 274 , sch a part ii ( steel furniture ) , almirah large steel 1 / 2 h x1 / 2 shelffd / e6 / map / 18 , almirah large steel fd 1031 , book case steel 04 doors fd 1028 , locker bedside steel fd 1029 , rack steel six tiers fd 1038 , table 900x600x760mm with drawer steel fd 1008 , table 900x600x760mm without drawer steel fd 1007 , teapoy veramdah fd / e6 / map / 17 , s&f steel work in tubular trusses including special shaped washer etc complete using erw or induction butt welded tubes confirming to i.s. 1161 1998...

Nagar Panchayat - Jharkhand

40397503 tender for supply of furniture for operation of urban health and wellness centre, office table doctor chair staff chair almirah godrej rack for medicine patient examination table wall clock door mat lock (link) patient waiting chair patient stool office chair...

Ranchi University - Jharkhand

40304790 bids are invited for gumla principal room table table , headclerk table table , accountant table , staff table table , staff table conference table , principal room back storages , sofa , visitor table with glass top , visitors chair , revolving chair , curtain complete set , computer table , chair for computer , almirah_locker , clc counter made of prelaminated board with stores capacity , office table made of mdf board , stainless steel visitors chair , four seater bench desk with back support , wooden podium , notice board , face to face_wall facing computer table with tbpt and cpu trolley , teachers table with 3 drawer pedestal , student fixed revolving chair , teachers revolving chair , proper supply and fixing of wooden flooring complete , cup board with locker , bed , doctors tool , saline stand , small almirah , green board , wooden podium , wardrobe , island_wall facing workbench , stores rack with display and lock , wooden stools sunmica top and paint , master chair , ceramic board scratch proof , first aid kid , office table made of mdf.board , library cum reading room table top , students fixed chair , steel glass door almirah , library reception table with extended top and under , 8 seater library reading table. , printer table with extended top and under storage , periodical display rack , fire extinguisher , fire extinguisher 5 ltr supply and installation of furnitures in model mahila college total quantity : 1634...

Nagar Panchayat - Jharkhand

40170465 tender for supply of furniture such as office table doctor chair staff chair almirah godre rack for medicine patient examination table wall clock by matt lock (link) patlent waiting chair patient stool office chair...

Rural Development Department - Jharkhand

40027072 rate contracts for the supply and installation of medical equipment / appliances accessories etc. and construction of modular ot. rdd / sd / chatra / eoi 16 / 2023 24 rate contracts for the supply and installation of medical equipment / appliances accessories etc. and construction of modular ot. , wall panels •standard wall partitions in operation theatre are composite construction of two skins of ppgi / ppgi with a panel thickness of 50 mm, over a gi framework with a sealed and insulated interior. the standard panel has of dimensions 1000mm x 2425mm. standard panels are an overall thickness 50 mm. the self supporting internal walls are constructed with an interior gi framework. partition to partition connections are maintained with precision with gi profiles that create uniform seams.the partition seams are sealed by silicone with a perfectly flush finish. puf insulation material is sandwiched between two skin layers and sealed from the exterior by a gi framework. self supporting wall provide in modular units consisting of external skins ( exposed to room ) in ppgi, outer ( skin not exposed into the room ) ppgi, which will be 0.6mm thick, with a protective film to prevent surface damage during shipping and installation. the movable wall includes the following: a ) puf insulation 40 kg / cum ( high pressure ) b ) gi profile c ) silicone sealant ( clear, white ) d ) sheet thickness 0.6 for ppgi , after erection of gfrg wall panels, seal all gfrg wall joints with paper tape temporarily. water proofing treatment of vertical joints with zycosil / equivalent water proofing solution ( 1 litre of zycosil / equivalent & 20 litres of water stirred first & 2 litres of zycoprime / equivalent added and stirred ( total 23 litres ) ) with 50 ml syringe till the gap and in filled concrete is completely saturated. after removing the paper seal, seal off the vertical joints with water proofing material grout rw / equivalent ( sealing cost excluded. ) , ceiling panels • ceiling panels are designed to fit within each other and suspended by threaded tension bars with adjustable turnbuckles fastened to the overhead support at fixed intervals, standard ceiling panels are 50 mm thick, walkable type, and have a composite construction of two skins of ppgi / ppgi, over a gi framework with a sealed and insulated interior. the ceiling includes the following: a ) puf insulation 40 kg / cum ( high pressure ) b ) gi. c ) silicone sealant ( clear & white ) . , flooring • one main advantage of vinyl floors is that they are durable. vinyl flooring can last for a very long time with minimum maintenance. this flooring is highly recommended for operation rooms as it can withstand high levels of foot traffic and is resistant to stains. operation theatre flooring will be 2mm thick with covings, with welded joints with the following specifications: a. flooring in each operating room will be seamless with perfectly curved flash covings. b. it shall have anti bacterial and fungicidal properties. c. flooring is a static conductive, flexible homogeneous vinyl floor. , hermetically sealed manual sliding door • hermetically sealed sliding doors are specially designed to control the clean air pressure in the room which is of utmost importance at a hospital. the door is developed especially for operation theatres and sterile areas. normally an operation theatre runs under pressure. at this pressure and leakage losses will still not be measurable due to the hermetic sealing property of the door. • hermetically sealed manual in icu / ot with the size 1500 mm*2100 mm for fixing on the wall with the following specifications: a ) door blade: door core of 50 60mm thick built up with hpl sheet as the skin at both sides of the door to provide better strength cfc free, high density polyurethane puff ( density 40 kg / m^3 ) , thickness. b ) door profile: the door core is surrounded by 2.5mm thick high grade aluminium extrusion profiles with natural anodizing of 15 microns finish. the aerodynamic design of profiles shall make the door robust in its segment league. c ) gaskets: the door blade is made with a 3 tier specially designed 3 side’s heavy duty replaceable epdm gasket against the wall frame. bottom sealing with 2 tier heavy duty epdm gasket to flush with the finished floor. d ) window: high quality double glazed flush vision window of 300mmx300mm view size on both sides flush with the door blade. e ) wall frame: high grade al extrusion with natural anodized 15 micron finish wall frame profile. this wall frame profile is 3 sided blind fixed with cladding on the wall cut out section from inside & outside of the room. f ) operation: door opening / closing options manual. , laminar air flow system 1 no • laminar flow is defined as airflow in which the entire body of air within a designated space is uniform in both velocity and direction. • specialized air distribution based on total pressure displacement so as to ensure uniform air quality & quantity along the complete laminar airflow ( laf ) area. minimum total air changes are maintained by more than 30 per hour. it is a terminal filter ( hepa filter is fitted across total filtration area i.e. 8 sq. ft & 24sq.ft = 2 nos. ) , ultra clean ventilation system with unidirectional flow. it is a draft free, comfortable room climate, and minimal, undisruptive noise level. it has a filtration area of at least 600 mm x 300 mm and ( 1220x1830mm ) = 2 nos and capable of filtering 4500 cfm of air. it has minimal pathogen concentration < 10 c.fu. / cum. specifications are as follows: a ) plenum body filter housing and pressure chamber made out of high end stainless steel 304 medical grade steel with matt polish sheet thickness 1.2mm specially designed to deliver uniform velocity across the entire hepa plenum to maintain uniform linearity of air 01 no. plenum fitted with ss grill with perforation. b ) return air risers of stainless steel 0.8mm thick with matt polish with aluminum polished / powder coated grill from where the return air shall be picked up. return air grills in the main sterile zones are located such as to avoid dead air pockets. they are placed at the level of approx. 8 inches above the floor level.uv lamps are placed inside the risers. the quantity for each ot is 4 pieces with 9mm insulation antibacterial foam. c ) fresh air positive pressure consisting a of 5 micron washable filter eu4 grade & made of hdpe non woven material. the fresh air component of the air change is required to be a minimum of 12 15 air changes / hour. d ) mini plate ( h 14 ) hepa, low pressure drop filter to remove practices sizing up to 0.3 microns with 99.97% particle removing efficiency. e ) 2 air handling unit capacity 4500 cfm. f ) the air handling unit has electrical safety and has en 1886 certification for mechanical strength. the air handling in its double skin construction, internal coving design, and thermal break panel’s draw throw type consisting of various sections, filter section fan section, coil section, and mixing box. flexible canvas connection will be provided between fan outlets and panels, to avoid fan vibration to the body of ahu. the fan motor is energy efficient and shall 415 volts, 50 cycles, 3 phase totally enclosed fan cooled class f with ip 55 protection motor, drives fbe provided with belt drive arrangements. g ) the coil is designed with inter winding circuits to suit the dx system. the coil is in 2 sets with 6 rows in each set. h ) dampers are opposed to blade type. they are made of a double skinned aero foil aluminum section with an internal gasket and assembled within a rigid extruded alloy frame. i ) fine filter and miscellaneous accessories are microvee filters ( 2 pieces ) with 98% efficiency down to 5 microns 610x610x305 mm and gi b class drain piping with insulation. fresh air arrangement with louvers, bird screen & damper. j ) surgeons control panel & ahu control panel are membrane type control panels, comprising complete of the following features. i. day time clock – 1 no. ii. time lapse clock – 1 no. iii. ahu, ac, peripheral light controls – 1 no. iv. lighting control. k. ahu control panel is with vfd ( variable frequency drive ) ip 20 with provision for hand on / bypass mode for appropriate blower fan motor, mains failure relays, electrical distribution equipment, and circuit protection equipment for all circuits within the operation theatre. all internal wiring is terminated in connectors with screw and clamps spring connections of the clip on type mounted, on a din rail and labeled with indelible proprietary labels. individual fuses or miniature circuit breakers protect all internal circuits. l. integration of 1 ahu with the outdoor unit is 5.5 tr with proper copper piping, expansion valve & dryer filter. m. integration of ahu with outdoor unit with expansion valve, dryer filter, side glass, proper copper tubing, etc. , ducting • ducting is an approach to air management that uses a series of metal or plastic pipes to carry heated or cooled air from one place to another. a duct system is often referred to as ductwork. • duct in modular operation theatre is made by assembling and erecting gi sheet with flange rectangular / square of l shaped hollow profile which includes all accessories such as carriage bolt, gasket & appropriate sealant on longitudinal joints, etc. complete set of 24 gauge. , uv system • uv rays are very effective in killing a large number of pathogenic organisms of bacterial, viral, and fungi commonly seen in operating theaters such as pseudomonas, clostridium difficile, mrsa, and vre , de fumigation system • fumigation in operation theatre is a process of gaseous sterilization that is used for the killing of micro organisms and prevention of microbial growth in the air, the surface of the wall, or the floor. • de fumigation control panel is installed outside the operation theatre to monitor the room pressure and to start the de fumigation system from outside the operation theatre. it will de fumigate the theatre in a given time and will switch on the ahu to increase operation theatre pressure without operating the surgeon control panel , pendent • medical services pendants, also known as booms, are one of the most important pieces of equipment within the operation theatre, which ensure efficient use of space to provide staff with a method of transporting required medical services to the patient quickly and effectively. • traditionally, staff has been required to run hoses and cables across the floor to power the tools they use each day in the pursuit of improved patient outcomes. this approach creates many issues, including trip hazards for staff, decreased theatre usability from unintended no walk zones, and the need to install equipment on mobile trolleys which require storage outside of the theatre after each procedure. • medical services pendants address all of these issues by relocating the necessary electrical, gas, audio visual, and data services from their usual wall panel to thependant carrier unit, which can be moved around the theatre and positioned in close proximity to the surgeon, anesthetist, and patient. • this carrier is suspended from the ceiling via one or two rotating arms allowing the required services to be brought right to the area of work. this allows for maximum configurations of the operating theatre and provides the staff unhindered access around the room, without the risk of injury to themselves or others. , x ray viewer • the x ray viewing screen is a device, which is placed behind a transparent screen to view the developed x rays. these are specifically designed to offer backlighting for a radiographic picture. these devices are also used in operation theatres, as they aid them greatly in seeing the developed x rays with enough detail. , writing board • the magnetic writing board usually in the size of 2 x 3 feet for operating rooms is used for writing down information by doctors / surgeons. the information might be the list of instruments / implants or how the operation needs to be performed. the magnetic writing board is flushed into the cleanroom wall. , peripheral light • peripheral light provides overall room illumination and is designed to create a consistent light level across the space, irrespective of any special lighting required in specific locations. • a specially designed peripheral light for operation theatre with dimensions of 585 x 585m.m. and 36 watt with led life of minimum 50, 000 hours and lumen of 3000 lux to be installed in the ceiling. , electric c arm compatible multipurpose ot table electric c arm compatible multipurpose ot table • length of table:1900 m • width of table top: 520 mm • minimum height ( without mattress ) : min. 750mm • maximum height ( without mattress ) : max. 1000mm • trendelenburg:25° • reverse trendelenburg: 25° • lateral tilt: ±20’ • back section: ±70° • head section : ±60° • leg section: 0° 90° • floor locking system: center floor locking , orthopedic attachment • color: silver • finishing: powder coated • material: stainless steel • adjustable & portable , double dome led ot light • intensity: 1, 80, 000 + 1, 80, 000 lux • shadow less feature: yes • numbers of leds: 48 + 48 • intensity control: 10~100 digital capacitive feather touch ( fully remote controlled ) • fitting options available: ceiling 180 degree, ceiling 360 degree, mobile, wall mounted • spot diameter: 200 250 mm • depth of light penetration: 150 mm • color temperature: 3800 – 4800 k • color rendering index: 95 ra • focusing: adjustable • led average life: >50000 hrs. • diameter of light: 700 mm • power supply: 220v / 50hz ac • power consumption: 100 watt • optional special features: battery backup , instrument trolley instrument trolley with two s.s shelves, frame made of stainless steel mounted on five 7.5 cm. swivel castors. wholly made of 304g stainless steel. size: ( 30l x 18w x 32h ) inch , instrument trolley ( big size ) instrument trolley with two s.s shelves, frame made of stainless steel mounted on five 7.5 cm. swivel castors. wholly made of 304g stainless steel. size: ( 38l x 20w x 32h ) inch. , revolving stool 1. four legs full ss. 2. ht: 18 39inch ( screw adjt. ) ss top dia: 30cm. , double bowl stand full ss 304g with bowl. , foot step double • overall approx. step size:505mml x 305mmw • first step height230mm and second step size 450 mm • step made of full ss 304g , crash cart trolley 1. overall approx. size: 37 lx 19w x 60h inch. 2. s.s tubular frame. 3. six removable plastic bins and two polystyrene lockable storage units with three drawers each. 4. four swivel castors, 150mm dia. ( two with brakes. ) 5. complete with corner buffers, oxygen cylinder holders’ iv rods’, cardiac massage board and electric lamp. , electrical works • conduits & bends • switch boxes • light boxes • fan boxes • junction boxes • wires • switches & plates • mcbs , peripheral light • peripheral light provides overall room illumination and is designed to create a consistent light level across the space, irrespective of any special lighting required in specific locations. a specially designed peripheral light for operation theatre with dimensions of 585 x 585m.m. and 36 watt with led life of minimum 50, 000 hours and lumen of 3000 lux to be installed in the ceiling , electric ophthalmic ot table • ophthalmic ot table with three section for drainage system in the head section. the table should have sturdy base, column made of stainless steel, antibacterial and is easy to clean. electromotive height and trendelenburg positions with light weight hand held control unit. i. length of table 1900 mm ii. width of table top 520 mm iii. minimum height ( without mattress ) min. 750 mm iv. maximum height ( without mattress ) max.1000 mm v. trendelenburg 25 degree vi. reverse trendelenburg 25 degree vii. leg section 0 90 degree , neuro attachment • mayfield attachment: 1. stable, high precision 3 point fixation of the head during surgery. 2. suitable for children and adults. 3. made up of ss 304 g. • horse shoe attachment: 1. made up of ss 304 g. 2. horse shoe shaped section for positioning of head and desired level during surgery. 3. stable and comfortable. • sujita attachment: 1. 4 pin attachment. 2. made up of ss 304 g. 3. suitable for children and adult. 4. stable and comfortable , scrub station • hv electrical components should be in the junction box. a ) it should be fully automatic and foot operated b ) 24 vac operated fascia. c ) it should comply with lv requirement. d ) the bowl must be constructed in such a manner that it should eradicate back splash of water. e ) drainage should be precisely designed to avoid any overflowing. f ) the sinks should have the capability to provide the convenience and it should also work on water saving concept. g ) material : stainless steel h ) color: silver , air conditioner air conditioner ( 02 ton with 5 star & 5kv stabilizer ) , dustbin ( trio ) , power backup supply & installation ups of rating 10.0kva with battery of backup time120 minutes , fiber optics supply & installation offiber optics , mayo table hydaulic supply & installation ofmayo table hydaulic , storage unit supply & installation of storage unit , view window with motorized blinds supply & installation of view window with motorized blinds , view window with motorized blinds supply and installation of imported avsu module 5 services ( oxygen, n20, ma4 2 air, sa7 air and vacuum ) area valve service unit + medical gas area alarm all fitted in on box it should fully complies and meets with the requirements of the uk doh health technical memorandum 02 01 ( htm 02 01 ) or nppa 99 standards of usa. it should fully be compliant with nhs c11 model engineering specification. it shall be ce marked with the notified body number specified or ul listed , electrical wiring from aggs plant of 1 hp supply and installation of electrical wiring from aggs plant of 1 hs , miscellaneous item for medical gas supply and installation of miscellaneous item for medical gas , manpower supply for operation of machine , add gst @18% , add labour cess @1%...

Department of Higher Education - Jharkhand

39836810 bids are invited for title 1 lab workbench , water connection inlet , water connection outlet , basin 18x12 , swan neck tap , intrument table , electric connection , storag rack , chemical rack , 4 way gas tape , bunsen burner , gas pipe rubber , sitting stool , exhaust fan , gas cylinder grill , electric point , wall facing workbench , over head cabinet , white board or green board , basin , swan neck tape , instrument table , museum specimen rack total quantity : 182...

Indian Army - Jharkhand

39753497 bids are invited for office almirah large , paper shredder , camp stool , pa equipment , digital clock total quantity : 55...

Department of Higher Education - Jharkhand

39710374 bids are invited for title 1 lab workbench , water connection inlet , water connection outlet , basin 18x12 , swan neck tap , intrument table , electric connection , storag rack , chemical rack , 4 way gas tape , bunsen burner , gas pipe rubber , sitting stool , exhaust fan , gas cylinder grill , electric point , wall facing workbench , over head cabinet , white board or green board , basin , swan neck tape , instrument table , museum specimen rack total quantity : 182...

Urban Development And Housing Department - Jharkhand

39611006 bids are invited for furniture equipment and it communication cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , a 4 paper white , pen , floor wiper rubber , floor wiper jut , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , garbage poly bag black 10 kg. , garbage poly bag red 10 kg. , hand wash liquid , hand wash soap , bed sheet , patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold bedside screenwith curtain stand , plastic chair , desktop computer with ups , printer hp , speaker , aebas fingerprint scanner device total quantity : 1330...

Health Department - Jharkhand

39485354 supply for office stationery, equipments etc. , items names : , executive chair , revolving chair , study chair , office table , almirah ( for office use ) , glass almirah , journal rack , computer table , dinning table set ( 1 table + 6 chairs ) , dinning table , lab table , examination table , stool steel chair , bed side locker , single bed ( for hostel ) ( double decker ) , almirah , chair , table , needleholder : , 6 , 7 , 8 , suture cuttingscissors , sutureneedle : , straight , curved , mackintosh roll : , full bed length ( qtyin meters ) , draw mackintosh , extra for treatment and dressing , hot water bag , ice caps , ice collar , corrugated rubber sheet , gloves different sizes , catheters : , urinary catheters , foleys catheters , nasal catheters , plain catheters , rectal catheters , finger stalls different sizes ( set ) , air rings , mucus sucker , breast pump , nipple shield , gastric lavage tube , ryles tube , flatus tube , blakemore sange staken tube , rubber tubes with different diameter and size , rectale syringe with nozzle , ring pressories each size , douche nozzle different sizes , mortar and pestle , nelsons inhaler , spirit lamp , test tube stand , test tube holder ( in dozen ) , sterilizer small , portable autoclave , weighing scales , adult weighing scale , baby weighing scale , back rest , splints different sizes , i. v .stand , microscopes , sphygmomanometer ( mercury ) , a regular ( dial ) , b electronic ( digital ) , stethoscope , over bed table ( cardiac table ) , screens / bed side curtains , three way adapter , mattress: , adult , child , mattress cover: , adult , child , bed sheets , baby cot sheets , draw sheets , sandbags with covers , sponge cloth , hot water bag covers , ice cap covers , air ring / cushion covers , gowns masks , patient s clothes: , male ( set ) , female ( set ) , baby dresses of different sizes ( set ) , diapers different sizes ( set ) , trolley cover , dirty linen bag / box , leggings ( pair ) , perineal sheets , triangular bandages , many tailed bandages , eye shields , dusters , slings , t binder , screen curtains ( set ) , adult human articulated skekelton with hanging facility in a glass cupboard with locking facility. , full set of dis articulated human skeleton. , full size human body showing all muscles and articals , human torso : , male , female , skin cross section , heart and large blood vessels , heart with detachable parts on a stand , eye with different sections , ear with different sections , human brain with spinal cord , lungs and trachea , larynx , digestive system: , stomach , female reproductive system: , uterus on stand , male reproductive system , urinary system: , kidney: , joints and ligaments: , wrist , elbow , shoulder , ankle , knee , hip , teeth , skeleton system , muscular system: , showing different muscles of the body , joints and ligaments: , nervous system: , brain , cardio vascular system , respiratory system , lungs , trachea , larynx , digestive system , oral cavity , teeth , stomach pancreas and spleen , small intestine , large intestine , liver and gallbladder , kidney macroscopic structure , skin , eye , ear , female reproductive system , menstrual cycle , male reproductive system , endocrine glands , first aid for burns , cardiac pulmonary resuscitation: , adult , children , infant , first aid charts or emergencies such as fracture, drowning, wounds, poisoning, bites ( each ) , stages of development of embryo ( set ) , female bony pelvis , foetal skull , female dummy ( zoe model ) / obstetrical training with doll , placenta , full size fetus , new born baby , baby cradle , breast changes in pregnancy , uterine changes in pregnancy showing height of uterus at different terms of pregnancy , stages of labour , first stage , second stage , third stage , breech presentation , complete breech , incomplete breech , foot presentation , shoulder presentation , face presentation , brow presentation , twin pregnancy , placenta previa different stages , caput succedaneum, cephalhaematoma , congenital malformation of new born: , cleft lip palate , spina bifida , hydrocephalus , anencephalus , all in one computer set , laptop , xerox machine , color printer , air conditioner , lcd projecter , lcd screen , over head projecter , community health nursing for anm , community health nursing for anm ( hindi ) , health worker keliyepathyapustak , community health nursing ( samudayikswasthvigyan ) ( hindi ) , nursing manual of nutrition and therapeutic diet , essentials community health nursing in hindi , where there is no doctor a village health care handbook , where there is no doctor hindi , mecical surgical nursing , fundamentals of nursing , principal & practice of nursing , health promotion for anm , aaharavumposhan , text book of anatomy & physiology for nurses , anatomy & physiology anotomy and physiology for nurses ( sharirrachanavigyanevamsharirkriyavigyankewalnursonke live ) ( hindi ) , prathamiksahayataevamsankatkalindekhbbal ( hindi ) first aid and emergency care , manual of first aid ( prathamikupcharka manual ) ( hindi ) , health promotion , nurse keliyemanovigyanavumswasthya , psychiatric meantal health nursing , text book of microbiology for nurses , sukhamjivvigyankipathyapustak ( text book for microbiology for nurses ) ( hindi ) , primary health care nursing for anm , psychology and sociology for anm and bt students , nursing arts proceduces ( nursing kemoolsidhanth ) valume i ( hindi ) , fundamentals of nursing ( hindi ) , senior nursing procedure ( nursing kemoolsidhant volume ii ( hindi ) , sociology for nurses , pharmacology for nurses , medicine kipathyapustak , baal swasthya nursing for anm , child health nursing for anm ( hindi ) , quick look nursing pathophysiology , comprehensive manual of pediatric nursing procedures , pediatric nursing , english for nursing , textbook of computer in nursing , textbook of obstetrics , midwifery & gynecological nursing ( hindi ) , maternal & neonatal nursing care plans , midwifery for anm , midwifery and gynecological , nursing ( hindi ) , manual of midwifery procedures , pedicatric nursing care plans , cumulative record for general nursing midwifery course , health centre management , imnci module for basic health worker , chart booklet , simplified partograth ( big size ) , family planning , journal of midwifery, women health &gynaecological nursing. , journal of community & social health nursing , patient cots adult , child , bed side locker , revolving stools / chair , manikins for demonstrating nursing procedure: , adult male imported , adult female , child manikin , new born , cpr ( full body ) , trays different sizes: , 24x16 , 14x10 , 11x9 , 8x5 , trays with cover assorted sizes , bowls: , 16diameter , 10diameter , 4diameter , 2 3diameter , bowls with cover , 6diameter , 4diameter , enema can , 1 1t. capacity , 1 / 2 1t. capacity , kidney trays of assorted sizes ( big ) , measuring jugs , 1000 ml. , 500 ml. , 250 ml. , assorted size basins , catheter dish with cover , knife dish with cover , feeding cups , douche can , sputum mugs , bed pans , urinals male , funnel: , 4diameter , 2diameter , jars with covers: , 12x8 , 6x4 , dressing drums: , 8x4 , 12x9 , tub for sitz bath , saucepan with lid: , 1 1t. capacity , 2 1t. capacity , kettle: , 1 1t. capacity , 2 1t. capacity , trolleys with upper and lower shelves ( without steel top ) , pint measure , gallipots , mugs , bottle brush , cheatle forceps , sponge holding forceps , artery clamps: , straight 6 , curved6 , dissecting forceps: , toothed , non toothed , mosquito forceps , kocher’s , scissors: , surgical 8 , bandage , mayos cutting scissors , tissue forceps , sinus forceps , biopsy forceps , liver biopsy needle , alice forceps , probe , groove director with probe , mouth gag , tongue depressor , tongue holding forceps , nasal speculum , aural speculum , re tractors: , single hook , double hook , bladder sound , male urethral dilator ( set ) , packing forceps: , nasal , oral , ear irrigation syringe , ear speculum , shaving set , safety razor with blades , bard parker knife handle , surgical blades different sizes set ) , catheters , airway , laryngoscope: , paediatric , adult , proctoscope , infusion set , autoscope , ophthalmoscope , tracheostomy set with various size of tracheal tubes ( set ) , head mirror , tanning fork , oxygen cylinder with stand , oxygen mask , measuring cups: , 240ml. , 120 ml. , 30 ml. , undine , eyebath cup , pipettes & droppers , glass connection: different types e.g. y.t.l. ( each ) , wolfs bottle , conical flasks , ounce glass , dram glass , thermometers : , oral , rectal , bath , room , lotion , pulse meter , urinometer , lactometer , heamoglobinometer , specimen glasses , test tubes ( dozen ) , glass slides with cover ( box ) , bottels500 ml. capacity for lotion and mixtures , automizer , manometer , glucometer , head mirror , tuberculin syringe , insulin syringe with needle , needle all sizes ( one dozen each ) , lumbar puncture needle , trochar, cannula for abdominal paracentesis , i.v. cannula different type sand sizes , biopsy needle : , adult , children...

Health Department - Jharkhand

39468446 supply for materials supply for materials and medical equipments , equipments name: , hospital seat bed , semi flower bed with ms side rail , flower bed with ms side rail , hospital i.c.u bed , hospital bed matress , hospital pellow , hospital sline stend , hospital bed side locker , hospital 3 fold screen , hospital strecture on trolly , pediatric bed , pediatric flower bed , ecg machine computerized , ventilators ( adult ) , pulse oxymeter , a.c1.5 ton 5 star with fitting , a.c 2ton 5 star with fitting , stabilizer automatic for ac double phase 5 kva , stabilizer automatic for ac double phase 3 kva , b.p apparatus stand model (isi mark) , stehoscope (isi mark ) , thermometer ( isi mark) , ecg paper roll cardiart gen x 3 cardiart 6208 view , suction machine , foetal doppler ( pocket doppler ) , foetal doppler ( tabple top ) , r o water machine , autocalve double drum , kidney tray big , curve kocher clamp , iv set ( adult ) , uro bag , sanitary pads , focus light , plastic apron , shoe cover , disposable cap , rubber sheet , eb x49 xga projector brightness: 3600lm with hdmi port (optional wi fi) , dustbin with lid 30 ltr. , hub cutters ( mannual ) , hub cutters ( electric ) , water container ( steel 20 ltr) , stools for immunization room (steel ) , torch light 4 cell , air rotor , bed pan (ss) , coolers big (isi mark) , table cloth , double door 308 litres 5 star refrigerator , 205 l direct cool single door 5 star refrigerator , chromic catgut 1/0no , chromic catgut 2/0no , chromic catgut 3/0 no , shadoless cellar light led , mersilk 1/0 no , mersilk 2/0 no , surgical instrument set , foelys cather 14 no , foelys cather 8 no , foelys cather 10 no , foelys cather 16 no , foelys cather 18 no , disposable syringe 3 ml , disposable syringe 10ml , disposable syringe 5 ml , disposable syringe 20 ml , b.p blade ( 15 no. ) , b.p blade ( 20 no. ) , b.p blade ( 22 no. ) , spinal needle 25 no , skin hook single , skin hook double , foreign body remover , foreign body extractor , needle holder ( big) 9’’ , needle holder ( small ) 6’’ , tooth forceps , plainforceps , scissors mayo’s ( 7’’ & 9’’) , scissors ( suture cutting ( 7’’ & 9’’) ) , b.p handle no 3 , b.p handle no 4 , surgical spirit 500 ml , scissors 8’’ , pen elkos first , handi palast ( round ) , lifter , intrument sterliser ( electric ) small , intrument sterliser ( electric ) medium , intrument sterliser ( electric ) large , arteriforcep medium straight , arteriforcep medium curve , arteriforcep large , elices forceps , niddle holder 8’’ , abdominal retracter small , abdominal retracter medium , abdominal retracter large , doins retracter , bone lever small , bone lever large , bone holdinyforcep small , bone holder forcep large , periostium elevator , pop 50 kg drum , towel clip , k wire1 , k wire1.5 , k wire2 , ss – wire 20 , ss – wire 22 , ss – wire 24 , k – nail all size , v – nail , sq – nail , cotton roll 400gm nett. , cotton roll 100gm nett. , kit kath 16 no , kit kath 18 no , kit kath 20 no , kit kath 22 no , kit kath 24 no , bandage 6 inch , bandage 4 inch , gauze than , green cloth , cotton bed sheet , blanket ( 4x 6 )2.5 kg , blanket ( 4x 6 )3 kg , carpet ( dari )( 30/ 30) , bp instrument electronic chargeable , glucose meter (isi mark) , hemoglobin test machine , stethoscope (isi mark) , thermometer genral , x ray view box large size , pulse oximeter , blood bag ( singal ) hl , hiv rapid card aspen , hbsag papid card aspen , hcv rapid card aspen , para hit total (mp) , r.p.r test card aspen , r.p.r test strip aspen , blood group kit (abd) arkary , anti ab arkray , anti human globulin arkray , 22% bovine albumin arkray , hiv elisa kit , hbsag elisa kit , hcvelisa kit , hiv rapid card retroquik , hbsag rapid card hepaview , hcv rapid flaviscreen , refrigerator digital thermometer , blood bag collection monitor , glass slide blue star , distilled wateer , sodium hypochlorite solution. , khan/khans test tube borosil , copper sulphate crystal , lancetblood , dobule cap e.d.t.a tube , khan/khans test tube stand 60 hole plastic , colorimeter , digital weight machine baby , digital adult weight machine , b.p machine ( mercury ) , elisa processor transasia elan 30 s , pumping ball/smiley ball , electric insects killer , elisa reader , elisa washer , autoclave electric vertical( pressur & temp display) , blood bag tube sealer , drabkins reagent , measuring cylinder 50ml , hydrometer ( specific gravity ) , pippet stand , cuvette ( for colorimeter) , needle destroyer ( electric ) , blood bag storage refrigerator , blood bag storage refrigerator thermofisher 650 ltr. , hydrogen peroxide 500 ml , hydrogen peroxide 100 ml , ec( 500 ml ) , stirrup pump ( ddt spray machine ) , cotton roll 25 gm nett. , cotton rol l 50 gm nett. , cotton roll 200 gm nett. , cotton roll 400 gm nett. , crepe bandage 6’’ , crepe bandage 4’’ , office table t9with two drawer , examination table , office table t104( three drawer ) , office table t8both side drawer , patient stool revolvingtable , impres table 1800mm , premium visitor chair with full arm , chair ch7b , laseda high back chair , sedna high back chair , bandage 6 , bandage 4 , revolving chair with arm , barvo high back chair , computer table c3d , strowel plain (almira 20 gauge )7’’/3.5’’ , strowel plain (almira 20 gauge )4’’/3.5’’ , steel rack 6’’/3’’ ( 5 rack ) , mattrics 3 seeter chair with arm , mosquito net small , mosquito net medium , mosquito net large , xerox machine (mp 2014) , didital ups eb 1650 ah inverter with inva tubular battery 220 ah , computer i3/11 gen/ 8 gb ram / 512 gb ssd rom/ windows 11/20” display/web came , • printers • laser printer • m438nda laserjet a3 monochrome all in one printer with network, duplex & adf , scannerlide 120 , coolers big ( isi mark ) , pillows covers , pillows , wire cutter , digital x ray machine 100ma , pen drive 32gb(hp) , pen drive 16gb(hp) , floor duster with handle , plastic chiar , epson ecotank m3170 wi fi all in one monochrome ink tank printer ith adf & duplex , computer table , office table size 4ft x 2.5ft double drawers , office table size 3ft x 2ft single drawers , laptop core i5 12th gen. 8gb ram, 1tb/ssd hard disk/ 2gb graphics, windos 11 , 3.8% sodium citrate solution 500 ml , abo & rh(anti ab&d) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent gauze than 18 m x 90 cm special , adenosine , airway 0 no. , airway 1 no. , airway 2 no. , airway 3 no. , airway 4 no. , ambu bag adult , ambu bag pediatric , ambu bag neonatal , apron , aso latex (span) (20 pcs) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , baby cap , baby dress , baby socks , baby tag , barium chlorine 500 ml , bendicts solution 500 ml , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blood bag350 ml , blood bag 100 ml , botroclot 10ml , bovine albumin 22% (5 ml) , bt set , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 24 no , cannula 26 no , capillary tube , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , cleansole , color coded bins black 20 litre , color coded bins black 40 litre , color coded bins black 60 litre , color coded bins black 80 litre , color coded bins blue 20 litre , color coded bins blue 40 litre , color coded bins blue 60 litre , color coded bins blue 80 litre , color coded bins red 20 litre , color coded bins red 40 litre , color coded bins red 60 litre , color coded bins red 80 litre , color coded bins yellow 20 litre , color coded bins yellow 40 litre , color coded bins yellow 60 litre , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , lam/i gel 01234 , lancet (100 pcs) , leishmans stain (500 ml) , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malaria pf/pv antibody card rapid test (50 kits) , malaria pf/pv antigen card rapid test (30 kits) , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , memantine , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micropore 1 inch , micropore 1/2 , micropore 2 , mucus sucker , iron bed , mattress 3x6 , foot step , dustbin plan , hydraulic bed , bucket , bed side screen , test tube (khan tube) , test tube (khan tube) 2.5 3 ml , test tube (khan tube) 3 4ml , test tube holding clamp , test tube rack , thiopentone , thrombophob ointment , tissue paper roll , tourniquet , color coded bins yellow 80 litre , cord clamp , cotton roll 400gm nett , cotton thread , cover glass (100 pcs) , cpr (latex) (20 pcs) , creatinine(creast) (35 pcs) , crescent blade disposable , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1ltr , distilled water 5ltr , donepezil , duolin respules , ec (700 ml) (agrawal) , ecg jelly , edta vial , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , enoxaparin , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , g.v. paint lotion 400ml , glacial acetic acid (500 ml) , glass slide (100 pcs) , gloass rod , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer strip , glucometer (ozocheck) , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hbsag card rapid test kit (50 pcs) , hcv rapid (30 kits) , heavy duty gloves , hiv card rapid test (50 kits) , nasal prongs (neonats) (cannula) , needle straight , new born diaper , oxygen mask adult , oxygen mask child , paraffin mesh , pedia set , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial , pottasium permagnate (400gm) , povidone iodine lotion 500ml , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pyrethrum extract 2% , rhyles tube16 no. , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , saline set , shoe cover disposable , side port disposable , slide dying rack , sodium calcium hypochloride (5 litre) , spirit 100 ml , spirit 1000 ml , spirit (methylated) 1000ml , sprit lamp , stritching thread , suction catheter , suction tube6fr , suction tube 8 fr , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , uro bag , vdrl (strip) , vdrl (syphilis) card rapid test (100pcs) , vdrl rapid card , vdrl rapid latex , vicryl(1 0) , vicryl1no , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl (2 0) , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , yellow tips for micropipette , temophos 25 ltr , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , swab , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , towel (24x18) , plastic mug 1 ltr , plastic bucket 20 ltr , anteseptic soap 75 gm , plastic sputum container with sticker , lence paper , potasium per magnate , zipper pouch , falcun tube , oxygen regulator with flow meter , non chlorinated biohazard bags black size 80kg , non chlorinated biohazard bags blue size 80kg , non chlorinated biohazard bags red size 80kg , non chlorinated biohazard bags yellow size 80kg , non chlorinated biohazard bags black size 2litre , non chlorinated biohazard bags red size 2litre , non chlorinated biohazard bags black size 40kg , non chlorinated biohazard bags blue size 40kg , non chlorinated biohazard bags red size 40kg , non chlorinated biohazard bags yellow size 40kg , hemogllobin test kit , hemogllobin test strips , lancet , glucometer , glucometer strips rate per pc , urine strips , hiv and syphilis test kit , hiv test kit , syphilis test kit , sickle cell rapid test kit , iodine test kit , hbsag test kit , filariasis test kit , malaria test kit , sanitary pad , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , oxygen cylinder small , oxygen cylinder medium , oxygen cylinder large , tubular battery 220 ah , ambu bag , eletric automatic unicron demmart star dental chair , dental x ray machine , vatech rvg sensor , desktop & color printer , dentail air compresor , auto clave , ultrasonic scalerhand pic walldent , waldent digital glass bed sterlizer , gdc extraction forcep kit set of 12 , gdc root elevator set kit10 , local anesthesia with aderenaline , dental micro moter with straight contra hand pic , walldent pro dental set 15 , mask , waldent dental lead appron , dental patient drape , gdc surgical curettee 3 (186) , air rotor handpic 2 lead (nsk) dyna , type 1 glass ionomer restorative , type 2 glass iconomer restrative , waldent composite kit , ewaldent eco plus light curring unity 2 , waldent endomeeter hand pic esw 2 , super endogald hand portopear file ( pack og of ) , waldeent flexgald rotry file 21 mm 25 mm , waldeent h hand file gald rotry 21 mm 25 mm , waldent e dta gutta percha paint 6% , waldent seal pexrin baid roat camal sealing matrial , raund barrel , stat barrel , farama cresal , calsium hydroxide podear 10 , saliva ejector , un chamber with 12 tray , gownpreparatior kit , endo2 bur , flish box , dj 16 , k hhand file , k file 6 to 15 , k file 8 to 15 , micro tourch & gas , skin mirar , mouth mirror , dental probe , dental twerer , dental cement carrier , steel visitor chair , transmittance / absorbance photometry based digital haemoglobinometer with auto / self calibration (no manual code / chip insertion) and 0 25gm/dl , strips / cuvette compatible with above digital haemoglobinometer , fad gdh enzyme based glucometer strips (1 glucometer free on 1,000 strips) , boronate affinity chromatography method based hba1c glycated haemoglobin analyzer with inbuilt bluetooth for wireless data transfer, in built rechargeable battery and weight less than 100g , strips compatible with above hba1c glycated haemoglobin analyzer , reflectance photometry based lipid analyzer for measuring tc, hdl, tg, ldl & tc / hdl ratio and inbuilt bluetooth for wireless data transfer , strips compatible with above lipid analyzer , auto disable / safety lancet (28g) with ec declaration of conformity / usfda & iso 13485:2016 , nt probnp rapid card , vitamin d rapid card , troponin i rapid card , troponin t rapid card , point of care device for hemoglobinopathies (sickle cell &? thalassemia) testing , point of care rapid test kit for sickle cell anaemia and beta thalassemia screening compatible with above device , portable automated abrneonatal hearing screeningdevice : based onbrainstem evoked response audiometry (bera) method batteryoperated device high sensitivity and specificity (more than 97%) test time: less than 5 minutes usb port and wi fi enabled non invasive and easy to use easy interpretable report: pass, refer and redo as the result validated and recommended by icmr (indian council of medical research) & department of health research (dhr) ministry of health,government of india...

Rajendra Institute Of Medical Science - Jharkhand

39466584 supply of chemical items at rims, ranchi , name of chemical goods , 20*c mini cooler (it should be made up of polycarbonate and non toxic gel, must contain atleast 12 places for 1.5ml tube. ) , 0.1 gparacetic acid other ingredients : corrosion inhibitors, surfactants, stabilising agents, excipients. hydrogen peroxide, acetic acid passes en 13624, en 13727, en 14348, en 14347, en 14476 standards, pack size: 5 litre jar , 0.5 % w/v chlorhexidine gluconate and 70 % v/v ethanol , 1% w/v available iodine in nonoxynol iodine surfactant500 ml , 1*tae buffer , 1,4 dithiotreytol (dtt) ()solid (powder) 25 gm , 100 g of gigazyme x tra contains: 7.7 g didecyldimethylammonium chloride, 0.4 g of polyhexamethylene biguanide (monomer: 1,5 bis(trimethylen) guanylguanidinium monohydro chloride) (phmb) contains subtilisin tridecylpolyethylenglycolether propan 2 ol, glycerol passes en 13624, en 13727, en 14561 and en 14562 standards, pack size: 2 litre bottle , 2* ab enzymatic reaction stop solution h2so4 paraformaldehyde glutaraldehyde solution,25% w/w 1 gm , 2.45% w/v glutaral dehyde with a powder activator completely free of surfactants 5ltrs , 20 40% phosphoric acid based scale remover ltr. , 2 mercaptoethanol (? me) liquid 100 ml , 2 methoxy ethanol (250mg) (purity (gc) > 99.75 %) , 2 propanol ip: 45 g / isopropanol, 1 propanol: 30 g /n propanol ethyl hexadecyl dimethyl ammonium ethylsulphate: 0.2 g emollient and moisturiser with skin protecting substances 500 ml bott with dispenser passes en 13727, en13624, en14476, en1500, en12791 standards, pack size: 500 ml bottle , 4 methylumbelliferone (100gm)(purity (hplc) =98 %, mol. wt 198.2) , 4 methylumbelliferyl ? d glucopyranoside (25mg)(to be used in prenatal diagnosis, analytical grade) , 4 methylumbelliferyl ? d galactopyranoside (1gm )(=99% (tlc)) , 4 methylumbelliferyl ? d galactopyranoside 6 sulfate sodium salt (5gm) (hplc purified, =90%) , 4 methylumbelliferyl 6 sulfo n acetyl ? d glucosaminide, potassium salt (25mg) (to be used in prenatal diagnosis, analytical grade) , 4mu beta d glucopyranoside (250mg)(purity (hplc) > 99 %) , 4 mu alpha d gluco pyronoside (100mg) (purity (tlc) > 99 %) , 50x tae 500 ml , 60%v/v ethyl alcohal with benzalkonium chloride, glycerine, dimethiconecyclopentasiloxane, c12 15 alkyl lactate, proylene glycol, methylparaben, phenoxythanol, stearyl alcohol, aminomethyl propanol, diazolidinyl propanol,diazolidinyl aurea with moisturizer 500 ml , 6 mercaptohexanoic acid (1gm)(laboratort reagent grade, 90.0%) , 7 colour setup 1000 pcs , a.s.o. titre (rapid test kit) 100 test , absolute acid 500 ml , absolute alcohol 2.5 ltrs should be 99.9 % boiling point = 78.3°c ( 1013 hpa) melting point = 117°c density = 0.7895 gm/cm3 ( 20°c ) flash point = 12°c ( closed cup ) ethanol content percent by volume at 15.6°c = 99.50 alkalinity = nil acidity as acetic acid percent by weight = max. 0.006 ( 60 ppm) residue on evaporation percent by weight = max. 0.005 ( 50 ppm ) copper as gm/100ml = max. 0.0004 ( 4 ppm ) ester as ethyl acetate gm/100ml = max. 0.02 ( 200 ppm ) aldehyde as acetaldehyde gm/100ml = max. 0.01 ( 1000 ppm ) , absolute alcohol 500 ml , ace control level 1 100 ml , acetamide agar 500 gm , acetic acid 500ml ( laboratory chemical ) only for industrial, institutional and research purposes, not for drug , acetic acid 2.5 ltrs , acetic acid 200 ml , acetic acid 250 ml , acetone 25 ml , acetone 5 l mol. wt. = 58.08 gm/mol density = 0.7845 gm/cm3 melting point = 94.7°c boiling point = 50.05°c smell = fruity , acetone 500 ml , acetonitrile (ico grade) liquid 100 ml , acid based liquid neutralizer concentrate to be used with dosing pump.nos. , acid fuchsin 1% 100 ml , acid fuchsin solid (powder) 25 gm , acid glycoprotein 100 gm , acid orthophoaphoric 500 ml , acid phosphatase 10x2ml , acp 100 ml , acrylic cold curve liquid 500 ml , acrylic cold curve powder 250 gm , acrylic colours 500ml a. black b. dark green c. maroon d. ultramarine blue can be used on variety of surfaces. stays permanent on paper earth ware, wood, thermocot, stone etc., wash proof rich in colour value, quick drying and ready to use and requires no separate medium , actidione with agar 500 gm , activated charcol 500 gm , ada control 100 ml (compactible with dirui cst240) , ada enzymetic 25ml , ada with calibrator 100 ml (compactible with dirui cst240) , adenovirus, stool, antigen, premiere adenoclone, ridascreen; r.biopharma , adrenaline hydrochloride 500ml , af media 100ml bottle (ready to use, media should contains fetal bovine serum (fbs), gentamicin, and l glutamine.) , afp 1 ml , afst disc fluconazole amphotericin itraconazole 100 disc , agar powder 500 gm , agarose 500 gm , agarose powder 250gm(to be used for nucleic acid separation, tested dnase and rnase free, high grade) , ahg 5 ml , albert’s stain – a – 250 gm each , albert’s stain – b – 250 gm each , albumin bcg 100 ml , albumin kit 3x150ml , alcian blue 500ml , alcian blue 8gx 100 ml , alcian blue satain ( ph 2.5, 100ml/ pack size) , alcian blue solid (powder) 5 gm , alcohol 90% 2 ltrs , alcohol ethyl 500ml , aliquote cup (centrifuge tab 1.5 ml) 500 pc , alizarin red s 100 ml , alkalian blue 100 ml , alkaline peptone water 25 x 5 ml , alkaline phosphatase kit 20x15ml , alkyl alcohol ethoxilate 20 40%, sodium benzoate, 5% based emulsifier ltr. , alkyl dimethyl benzyl ammonium chloride (in house) (2.37 %) alkyl dimethyl ethyl benzyl ammonium chloride (in house) (2.37 %) inert ingredients (95.26 %) , alkyle dimethyle benzile ammonium chloride (in house) (2.37%) inert ingrediets 95.26% , alp 100 ml , alpha nepthyl butyrate 500 ml , alt (sgpt) 2x150ml , altl/sgpt 2x150 ml , aluminium ammonium sulphate 500 ml , aluminium foil each pack , aluminium potassium sulphate [ potash alum] f. wt. = 474.39 assay nlt = 99.0% ph (10% solution at 20°c) = 3.0 4.0 chloride ( cl ) nmt = 0.0005 ammonia ( nh4 )nmt = 0.005% iron (fe)nmt = 0.005% lead (pb)nmt = 0.0005 % , amacr 1 ml , amdinocillin 10 mcg , amh elisa kit 96 tests , amikacin (antibiotic disc)30mcg (250 disc) , amikacin(antibiotic disc) 10 mcg (250 disc) , ammonia solution 2.5 ltrs about 25% m = 17.03 g/mol ( 1l = 0.90 kg ) specification: assay ( nh3 ) = 25 % non volatile substance = 0.002 % , ammonia solution extrapure ar, 25% liquid 500 ml , ammonium acetate solid (powder) 100 gm , ammonium chloride 500 gm , ammonium citrate – 500 ml , ammonium hydroxide 500 ml , ammonium molybdate 100 gm , ammonium molybdate 500 gm , ammonium oxalate 250gm , ammonium oxalate 500ml , ammonium persulphate, solid (powder) 25 gm , ammonium solution 500 ml , ammonium sulfonate 500g bottle (acs reagent, 99.0 100.5%) , ammonium sulphate 250 gm , ammonium sulphate 500 gm assay = 98.5 % nvm = 0.2 % chloride = 0.005 % iron = 0.002 % lead= 0.002 % 10 % aqueous solution clear and colourless specification: specific rotation ( [ ? ] 20°/d; c = 10 water ) = +51 to +53° melting range = 145°c 150°c chloride = 0.005 % sulphate = 0.01 % sulphites = passes test arsenic = 0.0001 % iron = 0.0005 % heavy metals ( as pb ) = 0.0005 % loss on drying ( 105°c )= 0.5 % sulphated ash = 0.1 % , amoxicillin 10 mcg(antibiotic disc) (250 disc) , amoxicillin 2 mcg + clavulanic acid 1 mcg (antibiotic disc) (250 disc) , amoxicillin 25 mcg(antibiotic disc) (250 disc) , amoxicillin clavulanate disc 20 mcg (antibiotic disc) (250 disc) , amoxycillin clavulanate (antibiotic disc) 10mcg (250 disc) , amphetamines 100 ml , amphotericinb powder (solubilized powder, g irradiated ) 50 gm , amphotericin b (mic e test strip) , ampicillin (antibiotic disc)10 mcg (250 disc) , ampicillin 2 mcg (antibiotic disc) (250 disc) , ampicillin 25 mcg (antibiotic disc) (250 disc) , ampicillin sulbactum(antibiotic disc)10mcg(250 disc) , amulgeum pluger , amyl of isoamy alcohal 500ml , amylase 100 ml , amylase kit 2x30ml , ana screening elisa kit 96 tests , anaerobic indicator strip , ? naphthol 500 gm , andrades indicator 100 ml , anhydrous ammonium bicarbonate anhydrous liquid 500 gm , anhydrous anhydrous aluminum chloride 100 ml , anhydrous anhydrous ferric chloride 30% 100ml , anhydrous anhydrous sodium hydroxide( naoh) pellet 250 gm , anhydrous anhydrous sodium hydroxide( naoh) pellet 500 gm , anhydrous anhydrous sodium phosphate monobasic (nah2po4) 500 gm , anhydrous calcium carbonate anhydrous , anhydrous dextrose anhydrous purified 500 gm specification: specific rotation ( [ ? ] 20°/d; c = 10 water ) = +51 to +53° melting range = 145°c 150°c chloride = 0.005 % sulphate = 0.01 % sulphites = passes test arsenic = 0.0001 % iron = 0.0005 % heavy metals ( as pb ) = 0.0005 % loss on drying ( 105°c )= 0.5 % sulphated ash = 0.1 % should be 99.9 % histopathology grade , anhydrous diethylenediamine anhydrous (piperazine ) , anhydrous di sodium hydrogen phosphate anhydrous , anhydrous lithium chloride anhydrous , anhydrous phenol anhydrous , anhydrous potassium phosphate di basic anhydrous 5 kg [ di potassium hydrogen phosphate anhydrous ] assay nlt = 98.0 % ph ( 5 % aqueous solution ) = 8.5 9.6 maximum limits of impurities • chloride = 0.005 % • loss on drying ( 105°c ) = 1.0 % , anhydrous potassium phosphate di basic anhydrous 500 gm ( di potassium hydrogen phosphate anhydrous ) k2hpo4mol. wt. = 174.17 , anhydrous sodium acetate anhydrous 500 gm , anhydrous sodium carbonate anhydrous 500ml minimum assay ( acidimetric ) after drying = 99.5 % maximum limit of impurities moisture = 1.5 % chloride = 0.01 % silicate = 0.02 % sulphate = 0.02 % lead = 0.03 % , anhydrous sodium phosphate dibasic anhydrous assay nlt = 99.0 % ph ( 5 % aqueous solution ) = 8.7 9.4 maximum limits of impurities • loss on drying ( 105°c ) = 0.5 % • heavy metals ( pb ) = 0.001 % • chloride = 0.01 % , anhydrous sodium sulphate anhydrous 500 gm , anhydrous sodium thiosulphate anhydrous , anhydrous tetra sodium pyrophosphate anhydrous , anidulafungin (mic e test strip) , anidulafungin powder (solubilized powder, g irradiated ) , aniline blue solution 500 gm , anti – a 10 ml , anti – b 10 ml , anti – d 10 ml , antisera for escherichia coli o157:h7 2 ml , anti a1 lactin 10 ml , anti ab serum 10 ml , anti d igm 10 ml , anti d rhofinal 10 ml , anti h lactin 5 ml , anti hcv ab elisa 1 x 96 , anti human globin 5 ml , anti sera for salmonella typhi poly h 2 ml , anti sera for salmonella typhi poly o 2 ml , anti sera for shigella species 2 ml , anti sera for vibrio cholerae classical 2 ml , anti sera for vibrio cholerae eltor 2 ml , anti streptosylin 100 ml , antigen v.d.r.l. 250t , antitrypsin 100 ml , apo cal 5 point 100 ml , apo calibrator 100 ml , apo a 100 ml , apo b 100 ml , apt broth 500 gm , aptt reagent 3ml , aptt reagent 5 ml , aq potassium permanganate 0.25% 100 ml , aqua peg 40 hydrogenated castor oil, glycerin, aroma, sodium gluconate, sucralose, octinidine hcl, citric acid, bht , aqua winth apip 500 ml , aqua, cocanidopropylamine oxide peg 7 glyceryl cocoate, glycerin hydroxyethyl cellolose, lactic acid, octenidine hcl, allantion , aqua, glycerine cocamidopropylamine oxide, sodium lactate, allantion, octenidine hcl ethylhexyl glycerine , aqueous citric acid 0.5% 100 ml , aqueous phenol 5% 500 ml , aqueous silver nitrate 5% 100 ml , aqueous sodium metabisulphite 1% 100 ml , aqueous sulphuric acid (h2so4) 3 % 250 ml , arginine decarboxylase broth , asparagine proline broth , asparagine 100gm , ast (sgot) 100 ml , ast (sgot) kit 2x150ml , ast sensitivity disc 5x250 d , astrovirus,stool, antigen, ridascreen, drg international r.biopharma , atropine 500 ml , atropine sulphur 500 ml , au consumables kit 1 kit , auramine o 1000 ml , auramine o 250 ml , auramine o 500 ml , australia antigen (0.3 ng/ml) 100 test , automated rapid mycobacterium culture differentiation and sensitivity system (liquid culture) , available iodine (1.0 % w/v) in water soluble base (contains sodium iodide and surfactants) ( ) , available iodine (1.0% w/v) and watersoluble base (contain sodium iodide and surfactant) manufacturer / marketing company should be certifying according to din en iso , available iodine 1% w/v in an aqueous <5 sodium iodide, <1 surfactant base, <88 water shelf life of 5 years, pack size: 500 ml bottle , azithromycin (antibiotic disc) 15mcg (250 disc) , azlocillin(antibiotic disc)75mcg (250 disc) , azlocillin 30 mcg (antibiotic disc) (250 disc) , aztreonam (antibiotic disc)30mcg (250 disc) , bacitracin 20 mcg (antibiotic disc) (250 disc) , bacitracin disc (antibiotic disc)16mcg 100 disc , bacterial antigen rapid latex agglutination test for meningitis 100 test , bag autoclavable bags 900g (size 12x24, transparent bags ) , bag autoclavable bags, size s (8x12) (should be high grade plastic, for autoclavable, for laboratory use) , bag autoclavable bags, size l (14x19) (should be high grade plastic, for autoclavable, for laboratory use) , bag b bag double – each , bag b bag paediatric each , bag b bag penta – each , bag b bag quadruple – each , bag b bag triple – each , bag biohazard bag medium (discarding pouch (red – black) sizes 12 x 12 for syringe & needle discarding (100 pieces/pack)) , bag biohazard bag small (discarding pouch (red – black) sizes 8 x 12 for gel & tips discarding) , bag biohazard bags large (autoclaveable) , bag biohazard bags medium (autoclaveable) , bag blood bag single – each , bag sample bags 96w , bag top to bottom each , bag top to top each , bag zip lock bags each , band aid round , baramathymol blue 500 ml , barbitone 500 ml , barbiturates 100 ml , barbituric acid, solid (powder) 25 gm , barium carbonate 500gm , barium chloride 500 gm , barrit reagent a 250 ml , barrit reagent b 250 ml , basic fuchsin 0.15% 500 ml , basic fuchsin 0.5% 500 ml , bd facc lysing solution 1pc , bd facs permebilizing solution 1 pc , b d glucan test for aspergillus each kit , beaker 100 ml , beaker 1000 ml , beaker 250 ml , beaker 500ml each , beaker 2000ml each , beef extract powder 250 gm , beef extract powder 500gm , benedict’s reagent 5l qualitative laboratory reagent for detection of sugar in urine. , benedict’s solution 500ml appearance = clear pale blue liquid odourless melting point = 0°c ( 32°f ) water boiling point = 100°c ( 212°f ) water evaporation rate < 1 vapour pressure ( mmhg ) = 14 water vapour density ( air ) =1 = 0.7 water specific gravity = 1 ( water ) solubility complete , benzalkonium chloride solution ip (0.5 % v/v), equivalent to benzalkonium chloride (0.25 % w/v) , benzidine powder 100 gm , benzidine powder 25 gm , benzidine powder 250 gm , benzidine powder 500gm melting range = 127°c 129°c solubility in ethanol to pass test sulphated ash = max. 0.05 % sulphate to pass test. , benzodiazepines 100 ml , benzoic acid 500 ml , beta mercaptoethanol 200 ml , beta 2 macroglobulin 100 ml , betadine 10% 250 ml , betadine 10% 500 ml , betaxolol 25% , betaxolol 85% , bicarbonatecalibrator 100 ml , bile esculin azide agar 500 gm , bile esculin disc pack of 100 disc , bile esculin powder 250 gm , bile esculin powder 500 gm , bilirubin kit 2x250ml , billirubin d 100 ml , billirubin total 100 ml , biotin 4 amidobenzoic acid sodium salt50mg (purity (tlc) > 95 %, mol wt. 385.4) , bismarck brown 1 kg 100gm glan bottle dye content 50 % solubility = h20 : 10mg/ml clear to turbid red orange to red form = powder grade = certified by biological stain commission quality level = 100 , bismarck brown 25 gm , bismuth sulphite agar , blade blade for cryostat (frozen) , blade cryostat blade for leica – 50 pcs( proprietary item)low profile made of stainless steel with high durability. disposable blades819 80 mm long x 8 mm high x 0.25 mm thick blades , blade microtome blades – 50 pcs ( proprietary item)high profile disposable blades818 stainless steel , bleach hydrogen peroxide of minimum 30% and oxygen based bleaching agent 5 ltr. , bleach sodium hydroxide maximum 5% based bleaching agent 5 ltr. , blood agar base – 250 gm , blood agar base 500 gm , blood free campylobactor agar , blood urea nitrogen 2x150ml , bolton broth (base) , bolton selective supplement , bone marrow aspiration needle – metal,reusable , salah type with component includingtrocar , cannula & adjustable side guard size –no 14 , no – 16 & no – 18 g , 5 cm longneedle , bone marrow biopsy needle ergonomic handle. material : stainless steel remover guide provided with indicators to facilitate the sample expulsion and that allows samples lenght check. provided with a special lock for a safe removal of the sample , boric acid 500 gm , bottle blood culture bottle (conventional) adult each , bottle blood culture bottle 100ml , bottle blood culture bottle 125ml , bottle blood culture bottle 30 ml , bottle blood culture bottle(conventional) pediatrics each , bottle brown bottle reagent 1000 ml , bottle brown bottle reagent 250 ml , bottle brown glass bottles 100 ml , bottle clear glass bottles, volume 1000ml (clear glass bottle with screw cap for laboratory use ) , bottle clear glass bottles, volume 250ml, (clear glass bottle with screw cap for laboratory use ) , bottle clear glass bottles, volume 500ml (clear glass bottle with screw cap for laboratory use ) , bottle clear glass bottles, volume 2000ml (clear glass bottle with screw cap for laboratory use ) , bottle drop bottle each , bottle mc cartney bottle 30ml each , bottle myco f bottle each , bottle reagent bottle – 100 ml (silicate with droper cap – 100 pc) , bottle reagent bottle 1lit , bottle reagent bottle 500ml , bottle reagent bottle 100ml , bottle reagent bottle 250ml , bottle spray bottles each , bottle sprey gun with bottle (500 ml) nos. , bottle sqeeze bottle each , bottle universal bottle 30 ml with screw cork , bottle universal bottle glass withrubber washer and cap 500 pcs , bottle wash bottle 500ml , bottle wash bottle 250ml , bovin serum albumine 10mg (agarose electrophoresis > 96 %cell culture test pass) , bovine albumin 22% 10 ml , box autoclave biological indicator box (geo.atropheus ) 50 x 1 ml , box bowie – dick compact box , box cap box each , box cryo box(1 ml)(each pack 500 vials) , box cryo box 1.8ml box of 04pcs , box cryo boxes (5ml) each , box eto indicator box , box gluffs boxeach , box micro pore box each , box plasma casset box , box slide box , box softner water kit box each , box steam emulating indicator box , box sterilization indicator box , box tip box 0.2 10?l ( 10pcs ) , box tip box 200 1000?l (10pcs ) , box tip box 2 200?l ( 10pcs ) , brain heart infusion agar 250 gm , brain heart infusion agar 500 gm , brain heart infusion broth 250 gm , brain heart infusion broth 500 gm , brain heart infusion broth powder 250gm , brain heart infusion broth powder 500gm , bramathymol blue 125ml , bramathymol blue 500 ml , brilliant cresyl blue solution 100gm , brilliant cresyl blue solution 25gm dark green colour powder absorption maxima = 623 628 specific absorptivity of 1%/1cm ( ?max = 0.005 gm/l ) melting point = 233 236°c , brilliant green bile broth 2% , bromine sample 250 gm , bromo phenol blue 500 ml , bromo phenol blue powder 10 gm , bromothymol blue 125gm , brush cyto brush – material plastic color white packaging type box to minimize trauma , brush test tube brush each , brush washing brush 12” , brush washing brush 6” , buffer saline sodium citrate buffer 500 ml , buffer for seroprotin electrophoresis each , buffer solution hemoglobin 1000 ml , buffered formal acetone 500 ml , buffered peptone water , butane gas , c reactive protein kit (rapid test kit) 100 test , c3control level 1 100 ml (compactible with dirui cst240) , c3with calibrator 100 ml (compactible with dirui cst240) , c3 100 ml , c4control level 2 100 ml (compactible with dirui cst240) , c4 100 ml , c4 with calibrator 100 ml (compactible with dirui cst240) , ca125 1 ml , calamine powder 250 gm , calcium arsennazo111 100 ml , calcium chloride powder 500 ml , calcium choride solution for aptt 10ml , calcium kit 2x150ml , calcium oxide 250 ml , calcium phosphate dibasic dihydrate , calcium sulphate 500 ml , calcium sulphate dihydrate , calcoflour white 100 ml , calcoflour white 25 ml , calcoflour white 50 ml , calibrator ldl ( us ) 100 ml , calponin 1 ml , calretinin 1 ml , candida albicans , candle jar 5 ltr. , carbamezapine 100 ml , carbenicillin 100 mcg (250) , carbo red 500 ml , carbohydrate consumption broth base , carbolfuschin 250 ml , carbol fuschin 500 ml , carbol fuschin 125ml , carbolic acid 500 ml , cardiac controls 5 ml , carmine powder 250 gm , casein 500 ml , caspofungin (mic e test strip) , caspofungin powder (solubilized powder, g irradiated ) , ccda selective supplement , cd 10 10 ml , cd 10 apc 1 pc , cd 10 pe 1 pc , cd 100p , cd 117 1 ml , cd 117 apc 1 pc , cd 13 cy 7 1 pc , cd 15 10 ml , cd 19 1 ml , cd 19 pe cy 7 1 pc , cd 20 1 ml , cd 20 fitc 1 pc , cd 3 1ml , cd 3 cy 5.5 1 pc , cd 3 per cp cy5.5 1 pcs , cd 30 1 ml , cd 31 1 ml , cd 33 pe 1 pc , cd 34 apc 1 pc , cd 34 endothelial cell marker 1 ml , cd 38 c 5.5 , cd 4 pe cy 7 1 pc , cd 45 1 ml , cd 45 apc h7 1 pc , cd 5 1 ml , cd 5 pe 1 pc , cd 56 1 ml , cd 64 fitc 1 pc , cd 7 apc 1 pc , cd 79 a pe 1 pc , cd 8 fit c 1 pc , cd 99 1 ml , cd k4 1 ml , cdna synthesis kit (50 reactions) , cea 1 ml , cedar wood oil –100ml , cedar wood oil 25 ml , cefaclor (antibiotic disc)30mcg(250 disc) , cefadroxyl 30 mcg (antibiotic disc) (250 disc) , cefamandole (antibiotic disc) 30mcg(250 disc) , cefazoline (antibiotic disc)30mcg (250 disc) , cefdiniar 5mcg (antibiotic disc) (250 disc) , cefepime (antibiotic disc) 30 mcg (250 disc) , cefixime 5 mcg (antibiotic disc) (250 disc) , cefmatazole (antibiotic disc) 30mcg (250 disc) , cefoaximen + sulbactam (antibiotic disc) 10 mcg (250 disc) , cefoaximen + sulbactam (antibiotic disc) 30 mcg (250 disc) , cefonicid (antibiotic disc)30 mcg (250 disc) , cefoperazone (antibiotic disc)75 mcg (250 disc) , cefoperazone 30 mcg (antibiotic disc) (250 disc) , cefoperazone salbactum 10mcg (antibiotic disc) (250 disc) , cefotaxime (antibiotic disc)30 mcg (250 disc) , cefotaxime 5 mcg (antibiotic disc) (250 disc) , cefotaxime clavulanic acid (antibiotic disc) 10mcg (250 disc) , cefotaxime clavulanic acid (antibiotic disc) 30 mcg (250 disc) , cefotetam (antibiotic disc)30mcg (250 disc) , cefoxitin(antibiotic disc)30mcg (250 disc) , cefoxitin 10 mcg (antibiotic disc) (250 disc) , cefperazone 75 mcg +sulbactum 30 mcg (antibiotic disc) (250 disc) , cefpodoxime(antibiotic disc)10mcg (250 disc) , cefprozil 30 mcg (antibiotic disc) (250 disc) , cefsulodin 30 mcg (antibiotic disc) (250 disc) , ceftaroline(antibiotic disc)30mcg (250 disc) , ceftazidime 10 mcg (antibiotic disc) (250 disc) , ceftazidime clavulanic acid(antibiotic disc)30mcg (250 disc) , ceftazidime clavulanic acid 10mcg (250 disc) , ceftazidime(antibiotic disc)30mcg(250 disc) , ceftazidime avibactum (antibiotic disc)20 mcg (250 disc) , ceftazidime avibactum (antibiotic disc)30 mcg (250 disc) , ceftiofur 30 mcg (antibiotic disc) (250 disc) , ceftizoxime(antibiotic disc)30mcg (250 disc) , ceftriaxone (antibiotic disc) 30mcg ( 250 dics) , ceftriaxone + sulbactam (antibiotic disc) 10 mcg ( 250 dics) , ceftriaxone + sulbactam (antibiotic disc) 30 mcg ( 250 dics) , ceftriaxone 30mcg+ sulbactam 15mcg+ edta 100mcg(antibiotic disc) ( 250 dics) , cefuroxime (antibiotic disc)30 mcg ( 250 dics) , cefuroxime 5 mcg (antibiotic disc) (250 disc) , cell clean 50 ml , cell pack 20 ltrs , cellulose acetate strip 25 x 130 , cellulose acetate strip 57 x 130 , cellulose powder , cephalexin 30 mcg (250 disc) , cephalothin(antibiotic disc) 30mcg ( 250 dics) , cephradine 30 mcg (antibiotic disc) (250 disc) , cepodoxime (antibiotic disc) p. size 5 x 250 , c erb2 onco proton her2neu 3 ml , cerbenicillin (antibiotic disc) p. size 5x 250 , ceruloplasmin 100 ml , cetrimide agar , chamber dark humidity chamber , chamber multipurpose staining chamber body yype – plastic size – 46x25x4 cm slide capacity – 24 , chamber neubuers chamber with silver lining each , chaps (cholamidopropyl)dimethylammonio] 1 propanesulphonate}) , charcol , chart marker pen each , chemical indicators class6 steam strips , chemistry controls (more than 30 parameters) 5 ml , chikungunya igm elisa kit ( 1 x 96) , chikungunya igm, igg rapid kit single , chloramphenicol (antibiotic disc)30 mcg (250 disc) , chloramphenicol 10 mcg (antibiotic disc) (250 disc) , chloramphenicol yeast extract glucose agar , chlorhexidine gluconate and cetrimide antiseptic 500 ml (equivalent tosavlon) , chlorhexidine gluconate and cetrimide antiseptic lotion pack 1l (like savlon) , chlorhexidine gluconate solution ip 10% v/v equivalent to chlorhexidine gluconate2% w/v ethanol ip 70% v/v 500 ml , chlorhexidine gluconate solution ip 20 % v/v, (equivalent to chlorhexidine gluconate 4 % w/v) , with isopropanol<10%, ethoxylated alkylphenol<10%, fatty acid diethanolamide<10%, acetic acid glacial<1%, cellulose and fragrance<10% emollient & moisturising agents passes en 1499 standards, pack size: 500 ml bottle , chloroform 1000ml (molecular bio use only, molecular weight 119.38) , chloroform 200 ml , chloroform 2.5 ltrs , chlorophenol red 500 ml , chloroxylenol 4.8 % w/v(equivalent todettol) 1 ltr , chocolate agar plate , cholesterol hi co 100 ml , cholesterol kit 2x250ml , cholinesterase 24 ml , chopping board – each( grossing boards ) features measurement guides printed onto board made of heavy duty, stain resistant, thick polyethylene will not dull fine surgical blades features a drain groove, carved into the edge to contain fluids durable design will make the board last for years, without changing shape, bending, or swelling , christensen’s urea , chrom agar 500 gm , chromium (iii) chloride hexahydrate , chromium oxide 5% 100ml , chromogenic agar listeria (listeria ottaviani agosti agar base) , chromogenic carbapenem resistant gram negative bacterial screening agar , chromogenic colistin resistant gram negative bacterial screening agar , chromogenic esbl producing gram negative bacterial screening agar , chromogranin a 1 ml , cinoxacin(antibiotic disc)100 mcg (250 disc) , ciprofloxacin (antibiotic disc)5 mcg (250 disc) , ciprofloxacin 1 mcg (antibiotic disc) (250 disc) , circular chart recorder each , citric acid (c6h8o7) 500 ml , ck –mb kit 75 ml , ck mb with calibrator 100 ml (compactible with dirui cst240) , ck 20 1 ml , ck 5 / ck 6 1 ml , ck 7 1ml , ck mb calibrator 100 ml , ck nac 100 ml (compactible with dirui cst240) , clarithromycin (antibiotic disc) 15 mcg (250 disc) , clarithromycin 2 mcg (antibiotic disc) (250 disc) , cleaning & disinfecting sol ( like lysol) 5 ltrs , cleaning solution 1 kit , cled cystine lactose electrolyte deficient (cled) agar 500 gm , clindamaycin (antibiotic disc)2 mcg (250 disc) , cloxacillin 1 mcg (antibiotic disc) (250 disc) , cmpo fitc 1 pc , cmv igg elisa 1 x 96 (1 pack) , cmv igm elisa 1 x 96 (1 pack) , coagulas plasma , cocaine 100 ml , colchicine powder , colcimed 5 mg , coliform agar , colistin 10 mcg (250 disc) , colistin 25 mcg (250 disc) , colistin disc(antibiotic disc )( 1x100) each , colistin sulphate salt powder1 gm , combistrix 100 t , complete haemacytometer set (neubeur blood counting chamber brightlined) number of memory sticks ?1 item weight ?100 g package dimensions ?5 x 3 x 1 cm; 100 grams country of origin ?germany , congo red 100 ml , container autoclavable biohazards waste container large , container autoclavable biohazards waste container medium , container microtube container 1000ml(it should be madeup of medical grade polypropylene or polycarbonate, confirming to us fda code of federal regulations title 21, and should be autoclavable) , container microtube container 500ml (it should be madeup of medical grade polypropylene or polycarbonate, confirming to us fda code of federal regulations title 21, and should be autoclavable) , contains subtilisin tridecylpolyethylenglycolether propan 2 ol, glycerol passes en 13624, en 13727, en 14561 and en 14562 standards, pack size: 2 litre bottle , cooked meat broth , coomassie brilliant blue g250 , coomassie brilliant blue r250 , coplin jar –made of polypropylene microwave safe can hold 10 slides (slide size: 25 x 75 x 1.0mm) & 50 slides interior is grooved to hold slides vertically domed and shallow thread screw cap , coplin jar plastic , copper acetate 500 gm , copper sulphate crystal 500 gm , corn meal agar 500 gm , cotrimoxazole(antibiotic disc)1.25 mcg (250 disc) , cotrimoxazole(antibiotic disc)23.75mcg (250 disc) , cotton tip applicator , covid 19 igg , cpk kit 2x75ml , creatinine 100 ml , creatinine enzymatic 100 ml (compactible with dirui cst240) , creatinine kinase (ck – nac) 100 ml , creatinine kinase (ck) kit 2x75ml , creatinine kit 2x500ml , creatinine powder 25 gm , creatinine zinc chloride 500 gm , cresyl blue powder 250 gm , cronobacter isolation agar , cronobacter sakazakii , cronobactor selective broth , crplatex high sensitative calibrator 100 ml , crplatex normal calibrator 100 ml , crp 100 ml , crp quantitative 100 ml (compactible with dirui cst240) , crp quantitative (range 0 100) 100 ml (compactible with dirui cst240) , crp reagent (rapid test kit) 100 test , crp latex , cryo globes large – 100 pc , cryo globes medium – 100 pc , cryo globes small – 100 pc , cryo tags each , cryptococcal latex agglutination test 50 tests , crystal blue powder 500 gm , crystal sulphate 125ml , crystal sulphate 500 ml , crystal violet , crystallin phenol powder 250 gm , crystalline phenol powder 500 gm , ctla 4 (monoclonal ab) 100ug , ctla 4 (polyclonal ab) 200ul (0.5 1.5 ug/ul) , cuprous chloride (cu ii chloride) , cylinder glass measuring cylinder 250 ml , cylinder glass measuring cylinders 100ml , cylinder glass measuring cylinders 1000ml , cylinder glass measuring cylinders 2000 ml , cylinder glass measuring cylinders 25ml (it should be madeup of polymethylpentene, confirming to us fda code of federal regulations title 21, and should be autoclavable) , cylinder glass measuring cylinders 500ml , cylinder glass measuring cylinders 50ml , cystatin 1 ml , cyto fix 125 ml , cytomegalovirus, serum, igm, biorad, drg international , dapi 10 mg , dapi dihydrochloride (4,6 diamidino 2 phenylindole dihydrochloride) , d biotin , dca media 250 gm , dca media 500 gm , d dimer 100 ml , d dimer control level 1 100 ml (compactible with dirui cst240) , d dimer control level 2 100 ml (compactible with dirui cst240) , d dimer with calibrator 100 ml (compactible with dirui cst240) , decarboxylase base 500 gm , decotrorising reagent destainer (german) electrophoresis each , dengue igg elisa , dengue igm elisa 1 x 96 , dengue ns1 elisa 1 x 96 , dengue nsi igm, igg, rapid kit 50 tests , dental cement 1 kg , deoxycholate citrate agar , deproteinising solution 1000ml , desmin 1 ml , destainer & clearing solution 500 ml , d gluconic acid , di sodium hydrogen phosphate dihydrate purified 500 gm , di sodium hydrogen phosphate dihydrate purified 250 gm , diaectyl monoxime 25 gm , diamond pencil marker 50 in no.(used for marking slide or test tube etc.diamond pencil for writing information onto histological and cytological slides.suitable for most laboratory glass surface, metal and ceramic. thin diamond tip for a perfect writing.) , diastic 100 t , dichloro phenol 2 6 – 10 gm , dichloro phenol indo phenols 2 6 – 10 gm , diethyl ether (hplc grade) 500 ml , differential reinforced clostridial broth (drcm) , digitoxin ( tdm calibrator ) 100 ml , digoxin 100 ml , dimethyl sulfoxide (dmso) , di potassium hydrogen ortho phosphate (k2hpo4) 500 gm , dipotassium hydrogen phosphate 500 gm , disinfectant 100 g of granules contain the following active ingredients: 43 g sodium per carbonate, 22 g tetraacetylethylenediamine. passes en 13624, en 13727, en 14348, en 14561, en 14562, en 14563, en 13704 and en 14476 standards, pack size: 1.5 kg box , disinfectant chlorhexidine gluconate solution ip 20 % v/v, equivalent to chlorhexidine gluconate 4.0 % w/v 1) en 13624 yeasticidal 2) en 13727 bactericidal500 ml , disinfectant ortho – phthalaldehyde 0.55% w/wwith test strip & deactivator quantitative suspension test for the evaluation of mycobactericidal activity of chemical disinfectants in the medical area including instrument disinfectants test method and requirements (phase 2/step1) , disinfectant ortho phthalaldehyde – 0.55% non corrosive, high level instrument disinfectant surfactant free, pack size: 5 litre jar , disinfectant polymeric biguanide hydrochloride (in house) (< 10 %) alkyl dimethyl benzyl ammonium chloride & didecyl dimethyl ammonium chloride) (in house) (< 10 %) quantitative non porous surface test for the evaluation of bactericidal and/or fungicidal activity of chemical disinfectants , disinfectant sodium parborate monohydrate in house 50% w/w quantitative suspension test for the evolution of sporicidal activity of chemical disinfectant of used in food industrial domestic & institutional , disinfectant sodium perborate monohydrate (in house) (50 % w/w) quantitative suspension test for the evaluation of sporicidal activity of chemical disinfectants used in food, industrial, domestic and institutional areas , disinfectant 500 ml , disinfectant powder disinfectant powder for surface cleaning containing potassium monopersulphate 40 50 % sodium c10 – 13. alkybenzen sulphonate 10 20 % sodium ( like virkon) 5 kg , disinfectant solution 4.25% ahp based surface disinfectant concentrate. ltr. , disinfectant solution 5th generation qac based disinfectant having didecyl dimethyl ammonium chloride and n alkyl dimethyl benzyl ammonium chloride ltr. , disinfectant solution aldehyde surface & environmental disinfectant – 5 ltr. , disinfectant solution aldehyde surface & environmental disinfectant – 500 ml , disinfectant solution disinfectant containing electrolysed water with neutral ph, hypochlorous acid, sodium hypochlorite – 5 ltr. , di sodium hydrogen orthophosphate dodecahydrate , di sodium hydrogen phosphate 500 gm , di sodium metasilicate upto 30%, nonionic surfactant and anionic surfactant based powder with optical brightner kg. , di sodium tetraborate decahydrate (borax) , disposable fluid collection system each , distilled water/ di water / deionised water 5 l appearance density = 999.972 melting point = 0°c ( 32°f ) thermal conductivity = 0.58 w/mk 1 refractive index = 1.3325 viscosity = icp specific heat capacity = 75.375 ± 0.05 j/mk 1 , dixon agar 250/ 500 gm , dmso (dimethyl sulfoxide)100/250/500 ml , dna extraction kit 250 r , dna extraction kit 50 test , dna isolation kit from 200 ul blood sample 100 tests , dna ladder (100 bp) 100 ul (0.5 ug/ul) , dna ladder (50 bp) each vial , dna loading dye 20 ml , dna zap pcr dna degradation solutions 5 x 1ml , dnase inhibitor (50 reactions) , dnph (2 4, dinitrohphenylhydrazine) 500gm laboratort reagent grade, >97.0% , dntps (10 mm) each 10 ml , documentation hand labeler gun nos. , doripenam(antibiotic disc)10 mcg (250 disc) , doxycycline (antibiotic disc) 30 mcg (250 disc) , dpx mountant 500 ml , dropper each , dulcitol discs each , dulcitol powder 25gm , dutp 2 gm , e.s.r fluid 500ml , each 100 g contains didecyldimethyl ammonium chloride: 7.0 g corrosion inhibitors, fragrance, excipients q.s. (alcohol free, aldehyde free), pack size: 500 ml bottle , each 100 g contains ethanol ip: 10.0 g, 2 propanol ip: 9.0 g/ isopropanol 1 propanol: 6.0 g/ n propanol provided with convenient hand sprayer, pack size: 250ml bottle , each 100 gm contain dodecylbiyspropylene triamine 9.2 gm and didecyldimethyl ammoinum chloride 13 gm , each 100 gm containes 1.6 dihydroxy 2.5 dioxyhexane (chemically bound formadehyde) in house 11.2gm, glutadehyde 5gm, benzalkonium chloride 5gm, alkyle urea derivative in house 3 gm test report from reputed indian or international lab , each 100 gm contanes true propanol 40 gms 1 propenol 22 gm saniocid , each 100 gms contains : sodium salicylate ip0.46 g sodium benzoate ip 0.59 g water soluble baseq.s , each 100 gms contains 2 propanol (63 gm) benzalkonium chloride (0.025 gm) , each 100 gms contains: 2 propanol40 gm1 propanol22gm saniocid250ml , each 100 gms contains: 1,6 dihydroxy,2 5 dioxyhexane (chemically bound formaldehyde), (in house) (11.2 gm) glutaraldehyde (5.0 gm), benzalkonium chloride (5.0 gm), alkyl urea derivative (in house) (3.0 gm), test report from reputed indian or international labs against viruses as per dvv guideline , ec broth , e cadherin 1 ml , e check 123 1pc , ecoshield solution – 1 ltr. , edta, disodium salt 2 hydrate , egfr 1 ml , ehrlich’s aldehyde reagent 100 ml , ehrlich’s aldehyde reagent 125 ml , ehrlichs aldehyde test 250 ml , ehtnol ip 10gm, truepropenol 9gm, 1 propenol 6 gm , electric ph metre , electrical digital timer , electronic cell counter with 10 keysfor dlc digital blood cell counter bcc 10 is a feature loaded cell counter with perfect quality no. of cells: 10 no. of keys: 12 body material: abs power source: 2 x 1.5v (aa) , electronic cell counter with 9 keys for dlc , electrophoresis hemoglobin & protein buffer 500 ml , elelay (gel) 1 kg , elisa kit neurocysticercosis igm/igg 1 x 96 , ellners broth , ema 1 ml , enoxacin 10 mcg (250 disc) , enrofloxacin 5 mcg (250 disc) , enterobacter aerogenes / klebsiella aerogenes , enterococcus faecalis , eorin 0.1%– 500 ml , eosin & nigrosin stain: ( twin pack)specification: a.. 0.5% eosin y , 290 mosm/kg nacl 1x 30mlb. 10% nigrosin , 290 mosm/kg nacl 1x 30ml , eosin yellowish indicator for microscopy 25 gm specification: assay ( on dried substance ) = 90% ph (1%, water ) = 6.5 7.5 adsorb on maxima (in water) = 515 518 nm absorption ratio ( max 15nm/max+15nm ) 1.21 1.77 specific extinction ( e1% 1cm; ? = 516nm, water ) [ on dried substance ] = 1230 1280 tlc analysis passes test loss on drying ( 105°c ) = 8% suitability for microscopy passes test , epson (ribbon cartridge) nos. , epstein barr virus igm (ab) 1 x 96 , equivalent to cetrimide ip (15 % w/v) chlorhexidine gluconate solution ip (7.5 % v/v) equivalent to chlorhexidine gluconate (1.5 % w/v , erg 1 ml , ertapenem (antibiotic disc)10mcg (250 disc) , erythromycin (antibiotic disc)15 mcg (250 disc) , erythromycin 10 mcg (antibiotic disc) (250 disc) , erythromycin 2 mcg (antibiotic disc) (250 disc) , erythromycin 5 mcg (antibiotic disc) (250 disc) , estrogen receptor 3 ml , etbr– 100 r each , ethambutol/myambutol 25 mcg (antibiotic disc) (250 disc) , ethambutol/myambutol 50 mcg (antibiotic disc) (250 disc) , ethanol 100% (molecular grade) 500 ml , ethanol 1000 ml , ethanol 250 ml , ethanol 500 ml , ethanol ip (10 gm) 2 propanol (9 gm), 1 propanol (6 gm) , ethanol ip (3.0 % v/v) benzalkonium chloride solution ip (0.5 % v/v), equivalent to benzalkonium chloride (0.25 % w/v) , ethidium bromide solution 10ml (hplc purified, suitable for use in gel electrophoresis) , ethionamide/trecator 25 mcg (250 disc) , ethnol ip 10 gm to propanol 9gm 1 propanol 6 gm, bottle manufacturer / marketing company should be certifuing accourding to din en iso 9001, 14100 & 13485 certificate , ethyl acetate 250 ml , ethyl alcohol 500ml (high grade, for use in molecular biology experiments, purity =99.99%, should contain isoamyl alcohol =0.05, 2 propanol =0.01, and higher alcohols =0.01. ) , ethyl violet azide broth (eva broth) , ethylacetate(1 litre) (laboratort reagent grade, =99.0%) , ethylenediaminetetraacetic acid powder (500gm) (acs grade, for molecular biology use) , ethyl hexadecyl dimethyl ammonium ethylsulphate 0.2 gms (mecetronium ethylsulphate) each 100 gms contains 2 propanol 45 gms, 1 propanol 30 gms, with third party test report from reliable lab, or indian or european norm certificates , eto cartridge nos. , external quality contro immunology controls (immno tubidimetric methods > 5 parameters) , external quality control clinical chemistry (more than 30 parameters) , external quality control hba1c and a2f , external quality control immunoassay (more than 20 parameters) , fail safe pcr pre master mix kit 60 units (should capable of amplify high gccontent or secondary structure template, must contain all 12 premixes,) , faropenem (antibiotic disc) 5mcg (250 disc) , fast blue bb salt – 500 gm , fast gernet bgbc salt 500 gm , febrile antigen set (widal tube test) 10 pieces , ferric alum 2% 500 ml , ferric alum 99% 250 gm , ferric chloride 25 gm , ferric chloride 5% 100 ml , ferric nitrate , ferritin 100 ml , ferrous ammonium sulfate , ferrous chloride , fetal bovine serum gold 500 ml , ficoll , fixative solution , flask conical flask 1000ml , flask conical flask 125ml , flask conical flask 250 ml , flask conical flask 500ml , flask round bottom flask 250ml , flask round bottom flask 1000ml , flask round bottom flask 125ml , flask t 25 flask , fli 1– 1 ml , floater (3 4) , flouride powder 500 gm , fluconazole (mic e test strip) , fluconazole powder (solubilized powder, g irradiated ) 50 gm , flucytosine (mic e strip) , flucytosine powder (solubilized powder, g irradiated ) 50 gm , fogging kit – each , forcep blunted dissecting , forcep pointed , forcep ptfe pointed , formaldehyde solution 1 ltr , formaldehyde solution 250 ml , formaldehyde solution 5 ltrs hcho [ mol. wt. = 30.08 ] solubility = miscible with water and absolute alcohol forming colourless solutions. weight per ml at 20°c=1.085 1.095g assay = 37.0 41.0 w/v hcho maximum limits of impurities acidity 3 ml ash = 0.02% chloride (cl) = 0.001 % , formaldehyde solution 500 ml , formaline tab 100 pcs , formic acid 500 gm , fosfomycin (antibiotic disc) 200 mcg (250 disc) , fosfomycin 50 mcg (antibiotic disc) (250 disc) , fosfomycin with glucose 50 mcg (antibiotic disc) (250 disc) , fouchet’s reagent 250 ml for bile pigment bilirubin for lab use only , fouchet’s reagent 500 ml , fraser broth , fraser listeria selective supplement , fructose powder 500 gm , fuchsine acid 500 ml , furaxone 100 mcg (250 disc) , furazolidone 100 mcg (250 disc) , fusidic acid 10 mcg (250 disc) , g.v. lotion 100ml , g.v. powder 500 gm , g 6 pdh 100 ml (compactible with dirui cst240) , galactomannan lateral flow assay – 50 t , galactose 1 phosphate (40 units) (purity (hplc) > 98 %) , gatifloxacin (antibiotic disc) p. size 5x 250 (250 disc) , gcdep 1 ml , gds e coli , gel red 1 x 0.5 ml , gel scoup each , gelatin agar , gelatine powder 500 gm , gentamicinhs (antibiotic disc)120 mcg (250 disc) , gentamicin (antibiotic disc) 10 mcg (250 disc) , gentamicin 30 mcg (antibiotic disc) (250 disc) , geobacillus stearothermophilus ampoules , geobacillus stearothermophilus spores (biological indicator) 50 x 1 ml , gfap 1 ml , ggtp 10x2ml , giemsa powder 25 gm appearance = dark green to black crystal or powder melting point = 300°c ( lit ) solubility = 10mg soluble in 10ml of methanol to give clear blue solution with greenish fluorescence. loss on drying at 110°c nmt = 8.0 % , giemsa powder 250 gm , giemsa powder 500 gm , giemsa stain 250 ml , giemsa stain 500 ml , glacial acetic acid 2.5 l boiling point = 116 118°c assay ( acidimetric ) = 99.7 colour = 10 hazy titratable base = 0.0004 meq/gm acetic anhydride = 100 ppm chloride = 1 ppm heavy metal ( as pb ) = 0.5 ppm sulphate = 1 ppm iron = 0.2 ppm evaporation residue = 10 ppm , glacial acetic acid 500 ml , glacial acid/glocalic acid 500ml , glasspetridish (90 mm) , glasspetridish(100 mm) , glasspetridish(120 mm) , glasspetridish(90 mm ) , glass beads (small size) 1000 gm , glass beads (small size) 250 gm , glass beads (small size) 500 gm , glass cover silips 22 x 22 mm 10 gm , glass cover silips 22 x 24 mm 10 gm , glass cover silips 22 x 60 mm 10 gm , glass cover slip square shape (18 mm x 18 mm) 10 gm , glass cover slip square shape (22 mm x 40 mm) 10 gm , glass innomer cement grade , glass marking pencil each , glass wool , glove cryo gloves 1 pair , glove nitrile gloves (large) (disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) , glove nitrile gloves (medium) (disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) , glove nitrile gloves (small) (disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) , gloves autoclave/ microwave gloves , glucofuranose , glucose ( hexokinase) 100 ml (compactible with dirui cst240) , glucose hk 100 ml , glucose kit 1 kit 1000 ml , glucose powder 500 gm , glucose salt teepol broth , glutaraldehyde (2.45 % w/v) with test strip & activator , glutaraldehyde 2.45 % w/v purified water 3 7% butylated hydroxyanisole, pack size: 5 litre jar , gluteraldehyde solution 5 ltrs , glycerine 2.5 ltrs , glycerine 400ml , glycerine 500 ml98% w/w min. aqua and rose flavour , glycerol 500 ml , glycine powder(ar) 250 gm (acs reagent, =98.5%, analytical grade) , glycocylated hemoglobin kit 25 t , glycogen kit , glycolic acid 500 ml , glycosylated kit 100 ml , gold chloride 0.1% 100 ml , gold chloride 0.2% 100 ml , gram stain kit 250 ml , gram stain kit 500 ml , grams iodine(crystal) 100 gm , griess assay reagent 500 ml , guanidine hydrochloride , guanidinium thiocyanate , h.c.v. kit rapid 50t , h.i.v. rapid kit50 t , h2o2 250 ml , h2so4 (sulphuric acid) conc 500ml , haematoxylin powder 1 kg , haematoxylin powder 25gm appearance = yellow to brown to tan colour form = powder dye content = 80% solubility in alcohol passes test water 8 % max. spectroscopy peak at 253, ratio 0.98 @ 508/538nm density @ peak 0.519qu , haematoxylin powder stain 125 ml , haemocystin 100 ml , haemocyto meter (german) pcs , haemoglobin estimation , hand rub alcoholwith moisturizer 500 ml 2.5 % v/v chlorhexidine gluconate solution i.p equivalent to 0.5% w/v chlorhexidine gluconate 70 % v/v ethyl alcohol, skin emollients, perfume, fast green as fcf colour. , hand wash solution scrub 500 ml , handrub ethanol 70% v/v handcrub 250 ml , haptoglobin 100 ml , hardness testing kit (for water analysis) each , harris haematoxylin solution ( papanicolaou solution ) 25 gm density = 1.04 gm/cm3 ( 20°c ) ph = 2.3 2.8 ( 20°c ) ci75290 5.3 gm/l al2(so4)3 18h2067gm/l , hav + hev igm elisa 96w , hav igm elisa – 1 x 96 test , hba1c 100 ml , hba1c calibrator 100 ml , hbdh 100ml , hbsag elisa 1 x 96 test , hcv dna extraction kit , hdl cholesterolcalibrator 100 ml , hdl cholestrol direct 100 ml , hdl cholestrol kit 10ml , hdl control 50 ml , hdl cholesterol 100 ml , heamatoxlene powder 250 gm , heamoglobin denatarant 1000 ml , heat block , hektoen enteric agar , hematology external quality control , hematology controls(compatible within sysmex xn 1000) 3 ml , hematoxylin monohydrate 82% , hematoxyllin powder 5 gm , hemo dialysis solution 10 ltrs , hemoglobin electrophoresis kit 100 tests , hemoglobin set – each , hemoglobino meter(0 30 g/dl)(german) pcs , hemoglobinometer calorimetry set , hepatitis a, serum, igm, wantai, dia pro, srl, italy, hepavase (gbc taiwan) , hepatitis b, serum, hbsag, j mitra, biorad , hepatitis c rpd kit (detects core, ns3, ns4 ns5 all hcv genotypes ) – 50 t , hepatitis c, serum, total antibody, j mitra, ortho hcv 3.0, biorad , hepatitis d virus, serum, total antibody, dia pro, srl, italy, gbc taiwan (for research use only) , hepatitis delta each , hepatitis e, serum, igm, wantai, mp diagnostics,dia pro , hepes sodium salt , hev igm elisa 1 x 96 test , hexane 500 ml , hini elisa 96w , hippurate broth , hla dr cy5.5 1 pc , hla b27 pcr kit 96 tests , hma 45 1ml , hmb 45 1 ml , holdar vacutainer holder – each , holder test tube holder each , homocysteine with standard 100 ml (compactible with dirui cst240) , hsv i + iiigg (ab) elisa 1 x 96 , hsv i + ii igm (ab) elisa 1 x 96 , hsv i igg (ab)elisa 1 x 96 , hsv i igm (ab) elisa 1 x 96 , hsv ii igg (ab) elisa 1 x 96 , hsv ii igm (ab) elisa 1 x 96 , hugh leifson medium , hydrated disodium hydrogen phosphate 250 gm , hydrochloric acid ( 35 % ) 500 ml , hydrochloric acid 500 ml , hydrochloric acid 500ml , hydrochloric acid hcl conc 500ml , hydrochloric acid n/10 500 ml , hydrogen peroxide 500 ml , hydrogen peroxide of minimum 30% and oxygen based bleaching agent 5 ltr. , hydrogen peroxide solution 2.5 ltrs contains 6.5% w/v hydrogen peroxide ( non medicinal ) , hydrogen peroxide solution 500 ml , hydrophobic barrier marker pen – reagent blocker (pap pen) use in immunohistochemical applications , hydroquinone 250 gm , hydroquinone buffer 500 ml , hydroxylamine hydrochloride (500gm) (laboratory grade, 99%) , hypochloride 10 % 500 ml , hypochlorite (l) , hypochlorous acid (hocl – 0.003%) + sodium hypochlorite (naocl – 0.004%) + electrolysed water – 99.97% (wound care spray) – 500 ml , hypochlorous acid (hocl – 0.008%) + sodium hypochlorite (naocl – 0.002%) + electrolysed water – 97.64% (wound care gel) – 60 gm. , ice bucket each , iga 100 ml , ige calibrator 100 ml (compactible with dirui cst240) , ige reagent 100 ml (compactible with dirui cst240) , igg 100 ml , igm 100 ml , imidazole , imipenem (antibiotic disc)10mcg (250 disc) , imipenem relebactum(antibiotic disc)10 mcg (250 disc) , imipenem relebactum(antibiotic disc)25mcg (250 disc) , immunoassay controls (more than > 30 parameters) 5 ml , immunohistochemistry (ihc) estrogen receptor kit (a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents.) , immunohistochemistry (ihc) her2 receptor kit( a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents.) , immunohistochemistry (ihc) progesterone receptor (pr) (a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents.) , immunology controls including (crp/aso/rf) 5 ml , india ink – 100 gm , india ink 100 ml , indian ink 250 ml , inhibin 1 ml , innovative tenside system containing 5 15% anionic surfectants, < 5 % nonionic surfectants, <5% polycarboxylate, enzymes.other excipients: solubiliser, corrossion inhibitors sodium cumenesulfonate, sodim etasulfate, 2 aminoethanol, alcohols, c13 15 branched and linear, butoxylated ethoxylated, alkylpolyethylen glycol polybutylen glycolether, subtilisin, glucerol, pack size: 5 litre jar , iodine 500 gm , iodine apex 100 gm , iodoacetamide (iaa) , iron alum 5% 100 ml , iron binding kit 150ml , iron sulfite agar , iron tibc 100 ml , iso amyl alcohol 500 ml , iso butanol , isoniazid / isonicotinyl hydrazine 1mcg (250 disc) , isopropanol 1000ml(acs purity 69 71 %) , isopropyl alcohol 2.5 ltr c3h80 [ mol. wt. = 60.10 ] specification: assay ( gc ) nlt = 99.0% weight per ml at 20°c = 0.784 0.786 maximum limits of impurities. residue after evaporation = 0.002% water = 0.2% , isopropyle alcohol(molecular grade)2.5 ltrs , itraconazole (mic e test strip) , itraconazole powder (solubilized powder, g irradiated ) 1 mg (250 disc) , japanese encephalitis igm elisa 1 x 96 , kanamycin(antibiotic disc)30mcg (250 disc) , karyotyping media (500ml) (ready to use liquid media, to be used to culture peripheral blood lymphocytes, 1x preparation, must supplemented with fetal bovine serum, l glutamine, and phytohemagglutinin, media use must be certified for “in vitro diagnostic use”. it should be manufactured at fda registered cgmp compliant facility only.) , kel 500ml , ketoconazole powder (solubilized powder, g irradiated ) 1 mg (250 disc) , ketone bodies ( blood) with calibrator 100 ml (compactible with dirui cst240) , ki67 antigen 1 ml , kovac’s indole reagent 250 ml , kovacs reagent – 100 ml , l spreader , l arginine hydrochloride 10 gm , l j media slant (solid media) 250 gm , l j media slant each , l lysine hydrochloride 10 gm , l shaped wire each pack , l.d test kit (rk39) – 100 tests , l.d test kit (rk39) – 25 tests , l.d test kit (rk39) – 50 tests , lab coat , lab goggles each , lab shoes size 10 , lab shoes – size 7 , lab shoes size 8 , lab shoes size 9 , laboline , laboratory deodorizing pearls , lactate control 100 ml (compactible with dirui cst240) , lactate with calibrator 100 ml (compactible with dirui cst240) , lactic acid , lactophenol cotton blue 250 ml , lactose 500 gm , lactose broth , lactose powder250 gm , lactose ttc agar with tergitol 7 , large ruler metallic scales each , l arginine hydrochloride 10 gm , lavofloxacin 5 x 250d , lb broth (lennox) , lb broth with agar , ldh kit – 2x25ml , ldl cholesterolcalibrator 100 ml , ldl control 50 ml , lead acetate 500 gm , leeming notman agar 250 gm , leeming notman agar 500 gm , leica freezing media for cryostat ( 125 ml ) leicapack size 40z ( 118 ml ) optimal cutting temperature ( oct ) compound is formation of clear, water soluble glycols and resin, providing a solid matrix to specimen holder for consistent sectioning in a cryostat working temperature of 10°c below. specification: mol. formula = na2s2o4 mol. wt. = 1/4.11 assay ( iodometric ) = 85 87.5 iron ( fe ) = max. 0.002 % ( at the moment of batch analysis ) , leishman powder 25gm form = powder colour = dark green solubility solution in methanol turbidity 0.1 % clear solubility colour solution in methanol 0.1 % blue with green fluorescence loss on drying = max. 8 % absorbance ( a ) in 1 % solution in methanol in a 1cm cell at 650nm = min. 950 , leishman stain 500ml , leishman stain powder 100gm , leishman stain powder 250 gm , lens cleaner , leptospira igm elisa 1 x 96 (1 pack) , levofloxacin(antibiotic disc) 5mcg (250 disc) , liapase 100 ml , light green 2% 100 ml , light green for microscopy 25 gm absorption maximum ( ? max. water ) = 629 634 nm specific extinction ( e1% / 1cm ) ? max. = 0.0005 % water = 830 1130 loss on drying ( 110°c ) = 12% , light green powder 500 gm , light green sf yellow 25 gm , lignocaine hydrochloride 10 ml injection ip = 2% lignocaine hydrochloride ip 2% w/v sodium chloride = 0.45% w/v methyl paraben = 0.2% w/v water for injection ip q.s , lignocaine hydrochloride 20 ml , lincomycin 15 mcg (250 disc) , lincomycin 2 mcg (250 disc) , linezolid(antibiotic disc)30mcg (250 disc) , linezolid 10 mcg (antibiotic disc) (250 disc) , lipase, amylase, protease, cellulase, biodegradability 3.785 liter , lipid controls 5 ml , lipoporotein (a) – 5 ml , lipoprotein 100 ml , liquid paraffin (heavy) 500 ml , liquid paraffin light 500 ml guarantee analysis weight per ml at 20°c = 0.84 0.89gm refractive index at 20°c = 1.480 identification ( by ir ) = passes test , liquor ammonia 500 ml , listeria enrichment broth (base) , listeria innocua , listeria monocytogenes , lithium carbonate 100 ml , liver broth , l lysine hydrochloride 10 gm , l mould brass – specimen holder used for holding the wax block for taking sections on the microtome.( size – 7.5 × 3 × 1.9 cm pair) , l mould brass – specimen holder used for holding the wax block for taking sections on the microtome. (size – 4.5 x 2.5 x 0.5 cm pair) , lomefloxacin 10 mcg , loop (1 mm) each pack , loop (10mm) each pack , loop (2mm) each pack , loop (4mm) each pack , l ornithine hydrochloride 10 gm , lpa 100 ml , l threonine , l tyrosine , lugols iodine 100 ml , lugols iodine 250 ml , lugols iodine 500 ml , l valine , lysozyme , m.p. test kit (pv, pf) –100 tests , m.p. test kit (pv, pf) –50 tests , m.p. test kit (pv, pf) – 25 tests , mac cartney bottle with screw cork , mac conkey agar 500 gm , macconkey broth , macconkey sorbitol agar500 gm , magnefying glass 3 each , magnesium chloride (mgcl2) 100 gm , magnesium chloride (mgcl2) 500 ml , magnesium chloride hexahydrate , magnesium powder 500 gm , magnesium sulphate 500 gm , magnesium sulphate heptahydrate , malachite green 100 gm , malaria elisa 96 w , malt extract , maltose 500 gm , mangenese chloride , mannitol egg yolk polymyxin (myp) agar , mannitol salt agar , manual cell counter with 9 keys for dlc – differential blood cell counter 9 windows total of keys8 or 9 keys total of windows 2 (totalaizer) each window figure range:0 999 number of buttons 8 number of windows 9 dimensions (mm)w320xd80xh50 , masson trichrome stain reagent , mathicilin : 5x50 t , mayer’s hemalum solution 1 ltrs specification: density = 1.05/cm3 ( 20°c ) ph = 1.8 2.2 ( 20°c ) ci752904.4gm/l al2(so4)3 18h20 = 28gm/l c6h8o7h2o = 0.5 gm/l , mayer’s hemetoxylene solution 1 gm , mc cal a ( mastercurve calibrator a ) 100 ml , mc grunewald stain 500 ml , mdm 2 1 ml , measles igm (ab) elisa 1 x 96 , measuring jar 500 ml , measuring scoop each , mecillinam 10 mcg (250 disc) , melan a 1 ml , m endo agar , mercuric chloride 500 gm , mercuric oxide red 100gm inorganic chemical assay = 99 % appearance ( form ) = solid colour = red purity = 99 % mol. wt. = 216.59 grade ar/gr melting point = 500°c , mercuric oxide red 500gm , mercuric sulphate 500 gm , meropenem (antibiotic disc)10mcg (250 disc) , metanil yellow 500 gm , methanamine 3% 500 ml , methanamine silver 100 ml , methanol – 500 ml , methanol ( methyl alcohol ) 2.5 ltrs minimum assay 99.8 % maximum limit of impurities • colour = 10 hu • water = 0.1 % • acidity ( hcooh ) = 0.001 % • alkalinity ( nh3 ) = 0.0002 % • non volatile matter = 0.001 % • aldehydes and ketones = 0.005 % • ethanol = 0.1 % • copper = 0.00005 % • lead = 0.00005 % • iron = 0.0001 % • permanganate = 0.00025 % , methyl alcohol 5 ml , methyl blue 25 gm , methyl green 250 gm , methyl red indicator – 250 ml , methyl violet/ crystal violet powder 250 gm , methyl violet/ crystal violet powder 500 gm , methyl violet/ crystal violet solution 100 ml , methyl violet/ crystal violet solution 250 ml , methyl violet/ crystal violet solution 500 ml , methylene blue (aqueous) 100 ml , methylene blue 100 gm , methylene blue 250 gm , methylene blue 500gm , methylene blue new 100 ml , methylene chloride 250 ml , methylene green 100 gm , metronidazole 5 mcg (250 disc) , metronidazole 80 mcg (250 disc) , mezlocillin 30 mcg (250 disc) , mezlocillin 75 mcg (250 disc) , m fc agar , mg powder 500 g , micafungin (mic e test strip) , micafungin powder (solubilized powder, g irradiated ) 1 mg , michel’s transport media , micro albumin control level 1 100 ml (compactible with dirui cst240) , micro albumin csf/urine 100 ml , micro albumin with calibrator 100 ml (compactible with dirui cst240) , micro clean 1 ltr. , micro protein control level 1 100 ml (compactible with dirui cst240) , micro protein kit , micro protein with calibrator 100 ml (compactible with dirui cst240) , milk agar , minocycline(antibiotic disc)30mcg (250 disc) , modified charcoal cefoperazone deoxycholate agar (mccd) , modified dixon agar 250 gm , modified dixon agar 500 gm , modified mha500 gm , molecular grade h2o – 500 ml , molecular ladder 100bp , mollecular ladder 1kb , molybdic acid 500 ml , motility test media , moxalactum(antibiotic disc)30mcg (250 disc) , moxifloxacin 5 mcg (antibiotic disc) (250 disc) , mpo staining reagent – benzidin power 250 gm , mr reagent 100 ml , msa (mannitol salt agar) media 250 gm , msa (mannitol salt agar) media 500 gm , mtt tetrazolium , mueller hinton agar 500 gm , mueller kauffman tetrathionate novobiocin broth base (mkttn) , multi calibrator antibiotic tdm 100 ml , multi enzyme cleaner with neutral ph containing5 15% non ionic surfactants, enzymes (amylase, lipase & protease), fragrancessolubilisers, corrosion inhibitors, colouring agents. declared conformity as medical device according to mdd93/42/eec.alcohol, c13 c15 branched and linear, butoxylated ethoxy, ethanol, alkyl polyethylenglycol polybutylenglycolether, sodium cumenesulfonate, pack size: 2 litre bottle , multidet kit 1000ml , multienzymatic cleaner, jar manufacturer / marketing company should be certifying according to din en iso 9001, 14100 & 13485 certificate , multipurpose labelling tape , mumps igm (ab) elisa 1 x 96 , mupirocin 200 mcg (250 disc) , mupirocin 5 mcg (250 disc) , myo d1 1 ml , myogenin 1 ml , myoglobin 1 ml , myoglobin 100 ml , myoglobin calibrator 100 ml , n acetyl l cystine (nalc) 10 gm , n,n dimethyl form amide (sigma d 4551) – 500 ml , n,n,n,n tetramethylethylenediamine (temed) , n,n’ methylene bis acrylamide , n.a. agar , n 1 nepthyl ethylenediamine dihydrochloride (100g) (acs reagent, >98.0%) , na + k standard solution 100 ml , na+ & k+ standard solution 500ml , nadp 100mg (purity (hplc) > 95 %/spectrophotometric purity > 95 %) , nadph 100mg (powder, =97% (dry weight), mol wt.833.4) , nafcillin 1 mcg (antibiotic disc) (250 disc) , nalc 10 gm , nalidixic acid (antibiotic disc) 30mcg (250 disc) , naphthol a s phosphate (sigma n 5625) – 500 ml , natidixic acid (antibiotic disc) p. size 5x 250 , n butanol 500 ml , n butyl alcohol 500ml , negative calibrator dau 100 ml , neomycin 30 mcg (antibiotic disc) (250 disc) , neomycin 5 mcg (antibiotic disc) (250 disc) , netilmicin(antibiotic disc)30mcg (250 disc) , neubauers counting cover slip each , neuron specify enalase , neutral red (0.62% aquor solution) – 500 ml , neutrophil alkaline phosphate reagent , nh3 control 1 100 ml (compactible with dirui cst240) , nh3 control 2 100ml (compactible with dirui cst240) , nh3 reagent 100 ml (compactible with dirui cst240) , nigrosin powder–250 gm , nigrosin powder– 100 gm , ninhydrin 10 gm , nitric acid 500 ml , nitric acid (conc) 500 ml , nitrofurantoin (antibiotic disc)300mcg (250 disc) , nitrofurantoin 100 mcg (antibiotic disc) (250 disc) , nitrofurantoin 200 mcg (antibiotic disc) (250 disc) , nitrofurantoin 50 mcg (antibiotic disc) (250 disc) , nlgrosln stain – 25 gm , no foam reagent 100 ml , norfloxacin 2 mcg (antibiotic disc) (250 disc) , norfloxcin (antibiotic disc)10mcg (250 disc) , normal saline 500 ml , norovirus, stool, antigen, ridascreen; r. biopharma , novacastralhc detection kit 1250 x 1 , novobiocin disc (antibiotic disc)10mcg (250 disc) , novoline polymer 1kit , nse 1 ml , nuclear fast red 100ml , nuclease free water or diethylpyrocarbonate (depc) 5 ml , nutrient agar 500 gm , nutrient agar 1000 gm , nutrient broth , nutrient gelatin , o. toluidine – 200 gm , o.g.6 powder 25 gm , occult blood test kit immunochromatography 25tests , octenidine based wash lotion with neutral ph, tested as per european norms containing octenidine hcl, aqua, cocamidopropylamine oxide, peg 7 glyceryl cocoate, glycerin, hydroxyethyl cellulose, lactic acid, contains allantoin, for full body wash head to toe, pack size: 500 ml bottle , octenidine based wash mitts with pratical hand dimension, tested as per european norms containing octenidine hcl,aqua, glycerine, cocamidopropylamine oxide, sodium lactate, allantoin,ethylhexyl glycerine, pack size: 100 pcs per packet , ofloxacin (antibiotic disc) 10mcg (250 disc) , ofloxacin 5 mcg (antibiotic disc) (250 disc) , oilminth peperment , oleandomycin 10mcg (antibiotic disc) (250 disc) , oleandomycin 15 mcg (antibiotic disc) (250 disc) , oleic acid (5g) ()purity (gc) > 99 % _cell culture test pass , onpg disc100 disc (250 disc) , ophyde 5 ltrs , optochin disc (antibiotic disc) 5mcg (250 disc) , orange g 100gm , orange g 25gm appearance = orange coloured powder form solubility ( turbidity )0.1% aqueous clear solution loss on drying = max. 10 % absorbance of 1 % aqueous solution in a 1cm cell vs h20 @478nm = 380 500 , orange serum agar , orcein 200 ml , ornithine dec arbovylace test reagent , ortho phosphoric acid , orthotoluidine 20 ml , oxacillin(antibiotic disc)1mcg (250 disc) , oxacillin 5 mcg (antibiotic disc) (250 disc) , oxalate powder 250gm , oxalic acid 500 gm , oxalic acid 2% 500 ml , oxford listeria selective agar , oxford listeria selective supplement , oxidase reagents disc 1 pack (pack of 100 discs) , oxidase reagents powder 250 gm , oxidative/fermentative medium with “ferric chloride” reagent 250 ml , oxolinic acid 2 mcg (250 disc) , oxytetracycline 30 mcg (250 disc) , p 120 1 ml , p 53 1 ml , p 63 1 ml , p.h. liquid handicator , p.p.d. 10 tu 5ml , p.p.d. 2 tu 5ml , p.p.d. 5 tu 5ml , p.t kit prothrombin kit (isi value = 1.1 liquid stable) 5ml , palcam listeria selective agar , palcam listeria selective supplement , pals solution 100 ml , pan cytokeratin 1 ml , panta 15 ml , pap staining kit , paper auto clave print paper sheets , paper butter paper each , paper cellulose acetate paper for electrophoresis each , paper eto thermal printing paper sheets , paper filter paper – 25 pcs. , paper litmus paper blue – each , paper litmus paper red – each , paper ph indicator paper pack of 100 , paper r.a. printing paper each , paper sample appicafor for cellulose acetate paper electrophoresis each , paper thermal paper 4.2” 50 mtrs , paper tissue paper – the tissue paper is hygienic, soft to touch, and highly absorbent. disposable 100 pcs/ pack , paper water filter papers 100 leaves , paper whatman filter paper no2 , paraffin liquid 500ml , paraffin sealing strip/tapeeach pack , paraffin wax (granules) – 500 gm. , paraffin wax = 2 kg 58 t0 60°c specification: alkaline/acid reacting substance passes test solidification point = 58 60°c ulphated ash =0.05% suitability for histopathology passes test. , parafilm dispenser with cutter each , paraformaldehyde , parvo b 19 igm (ab) elisa 1 x 96 , pas and diastase enzyme 100 ml , pasture pipette with rubber , pax 5 1 ml , pbs buffer 1x 500 ml each , pbs buffer 1x 6ml , pcr – primer for thalassaemia & sickle cell anamia – 500 ml , pcr buffer 2x 25ml each , pcr buffer 2x 500 ml each , pcr buffer 5x 500 ml each , pcr buffer 5x 25ml each , pcr grade water 100 ml , pcr microplate with septa 48 well (polypropylene pcr microplate compatible with standard pcr machine, non skirted, clear, should be supplied with compatible plastic septas) , pcr microplate with septa 96 well (polypropylene pcr microplate compatible with standard pcr machine, non skirted, clear, should be supplied with compatible plastic septas) , pcr plate 0.1 ul , pcr plate 0.2 ul , pcr plate 96 well , pcr plate clear sealing films 96 well (100 per pack) (functional temperature range 40 to +104 °c) , pcr plate cover 0.1ul , pcr plate cover film 0.2 ul , pcr plate flexi – 96 well , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with fam (fam dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with hex (hex dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with rox (rox dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with tamara (tamara dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) unlabelled (unlabelled customized oligonucleotidess for pcr reaction) , pd 1 50ul(40ug) , pda agar , peflox(imported) 5mcg (250 disc) , pefloxacin (antibiotic disc) 5 mcg (250 disc) , penicilin g(antibiotic disc)10 units (250 disc) , pepsin 1 gm , peptone 500gm , peptone water media 500gm , perchloric acid schiff(pas) kit , perfumed liquid based softening agent with anti static property and biodegradable having ph of 6.5 7.5 ltr. , periodic acid: 25gm specification: ph 1.2 ( 100gm/l, h2o,20 degree celsius bulk density – 1400kg/m3, assay( iodometric) >98.0%melting point (lower value) >124 degree celsius melting point (upper value) >129 degree celsius , periodic acid 0.5% 100 ml , periodic acid 1% 100 ml , peripheral blood karyotyping readymade culture media rpm1 16501 , peripheral blood karyotyping readymade culture media rpmi 1640 , perl’s staining reagent – potassium feno 250 ml , perls iron stain1 & 2 ( twin pack)specification a. perls 1 potassium ferrocyanide 250ml b. persl2 hydrochloric acid 250ml , petri disc 4” glass – each , petri disc 4” pvc – each , petri plate 100mm each , petroleum ether 250 ml , ph meter each , phenobarbital 100 ml , phenol red indicator 100ml , phenotoin 100 ml , phenyl hydrogen hydrochloride 95 % , phenyl phosphatedisodium salt , phenylalanine agar , phosphate buffer saline 120 ml , phosphate buffer saline 500 ml , phosphomolybdic acid 25 gm , phosphoric acid 500 ml , phosphorus 100 ml , phosphorus kit 50 t , phosphotungstic acid 100 gm , phosphotungstic acid 500gm specification: physical state at 20°c = solid appearance = white to yellowish powder or crystal odourless melting point / freezing point = 95°c solubility in water ( % weight ) = 200gm/100gm water substance insoluble in water = max. 0.01 % chloride = 0.01 % sulphate = max. 0.01 % total nitrogen = 0.005 % loss on ignition at ( >50°c ) = max.17 % , picric acid (lyctophenol )250 ml , picric acid 500 gm , picric acid(saturated) 100 ml , pilocarpine 2% & 4% , pipemidic acid 20 mcg (antibiotic disc) (250 disc) , piperacillin (antibiotic disc)100mcg (250 disc) , piperacillin + tazobactum (antibiotic disc)100 (250disc) , piperacillin 100 mcg + tazobactam 10 mcg (antibiotic disc) (250 disc) , piperacillin 30 mcg (antibiotic disc) (250 disc) , piperacillin 30 mcg + tazobactam 6 mcg (antibiotic disc) (250 disc) , piperacillin 50 mcg (antibiotic disc) (250 disc) , piperacillin 75 mcg (antibiotic disc) (250 disc) , piperacillin 75 mcg + tazobactam10 mcg (antibiotic disc) (250 disc) , piperazine n,n’ bis(2 ethanesulfonic acid) , pipette –westerngren esr , pipette – autopipette 0.1 10 ul , pipette – autopipette 1 200 ul , pipette bulb each , pipette – disposable pipette single , pipette – graduated pipettes 10 ml , pipette – graduated pipettes 1ml , pipette – graduated pipettes 2 ml , pipette – graduated pipettes 5 ml , pipette – hemoglobin pipette each , pipette – pasteur pipettes with rubber blubs each , pipette – pipette stand(it should be madeup of polymethyl methacrylate, atleast 5 places for pipettes) , pipette – r.b.c. pipette (german) pcs , pipette sterilized pasture pipette each , pipette – sterilized pasture pipette with rubber each , pipette variable pipette: micropipette, adjustable volume, fully autoclavable eight channel : 05 50 ul, 30 300ul & 100 1000ul , pipette variable pipette: micropipette, adjustable volume, fully autoclavable single channel : 01 10ul, 02 20ul, 05 50ul, 10 100ul, 20 200ul, 100 1000ul spring loaded tip cone for connecting tips very tightly, adjustment opening for adjusting pipettes to a specific liquid and volume. control button with very low operating force, color indication for pipette volume. tip ejector with very low operating force, positioned for perfect ergonomics. volume display: 4 digits with magnifier. to provide thermal, mechanical and chemical stability piston should manufactured from fortro material very easy removable lower part for cleaning pipette no discoloration upon uv irradiation. confirmation to specification must , pipette w.b.c. pipette (german) pcs , plastic cassettes for automatic tissue processer – 500 ml , plate elisa plate 96 well , plate microtitre plate with lid 96 well flat bottom , plate microtitre plate with lid 96 well round bottom , plate count agar , platelet count fluid 2.5 ltrs , platelet count fluid 500 ml , platelet diluting fluid 125ml/bottle , poatato dextrose (pda)agar , poivceu red staining solution 500 ml , pollyf (cement) , polyclonal rabbit anti human c1q complement/fitc one kit(2ml concentrated) (the reagent should be used for demonstration of human c1q in tissues, and may also be used for other immunofluorescence techniques. the anti human c1q complement conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order.) , polyclonal rabbit anti human c3 complement/fitc one kit(2ml concentrated) (the reagent should be used for demonstration of complement c3 in tissues, and may also be used for other immunofluorescence techniques. the complement c3 conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum conjugated with fluorescein isothiocyanate isomer 1. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. the antibody should react with human c3 c part of c3 and c3b. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity.) , polyclonal rabbit anti human fibrinogen/fitc one kit (2ml concentrated) (the reagent is intended for demonstration of human fibrinogen in tissues, and may also be used for other immunofluorescence techniques. the fibrinogen conjugate should be prepared from a purified protein fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order.) , polyclonal rabbit anti human iga/fitc one kit(2ml concentrated) (the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human iga conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order.) , polyclonal rabbit anti human igg/fitc one kit(2ml concentrated) (the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human igg conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order) , polyclonal rabbit anti human igm/fitc – one kit(2ml concentrated) (the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human igm conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order. , polyethylene glycol 6000 , poly l lysine 100mlsolution. 0.1% (w/v) in h20 p8920 , polymerase , polymeric biguanide hydrochloride inhouse greated then 10% alkyle dimethyle benzyle ammonium chloride and didecyle dimethyle ammonium chloride in house greater then 10% quantative nonporous surface test for the evolution of bactericidal and or fungicial antvity of chemicals , polymeric bigunide hydrocholide 10 % alkyl dimethyle benzyl ammonium chloride and dodecyl dimethyle ammonium , polymixin b 50 mcg (antibiotic disc) (250 disc) , polymixinb (antibiotic disc)300mcg (250 disc) , posaconazole (mic e test strip) , posaconazole powder (solubilized powder, g irradiated ) , pot urinary urine collector – material plastic colour blue/ white closure type screw pattern solid capacity 50 milliliters product dimensions 8w x 5h centimeters shape round , pot urine pot sterile, graduated, screw capped , potassium acetate 500 gm , potassium almunium sulphate 500 gm , potassium aluminium sulphate 100 gm , potassium carbonate (khco3) 500 gm , potassium chloride (kcl)500 gm (reagentplus®, =99.0%) , potassium citrate , potassium dichromate (powder) , potassium dihydrogen diphosphate 5 kg [ potassium po4 mono basic ) assay ( after drying ) = 99.0 101.0 % ph ( 5 % aqueous ) = 4.1 4.5 maximum limits of impurities • chloride = 0.01 % • sulphate = 0.05 % • iron = 0.002 % • heavy metals ( pb ) = 0.002 % • sodium ( na ) = 0.2 % , potassium dihydrogen orthophosphate , potassium dihydrogen phosphate gr (kh2po4) 500 gm , potassium ferrocyanide 2% 500 ml , potassium ferrocyanide 99% 500 gm , potassium hydroxide (koh) 250gm , potassium hydroxide (koh) 500gm , potassium iodide 500 gm , potassium iodide crystal 100 gm , potassium iodide crystal 200 gm , potassium nitrate – 500 gm , potassium oxalate 500 g , potassium periodate , potassium permanganate (acidified) 100 ml , potassium permanganate 500 gm , potassium peroxomono sulphate 5 kg (in house) (50% w/w) with 3rd party test report from reliable lab, or indian or european norm certificates , potassium phosphate di basic (k2hpo4) (250g)(bioultra, for molecular biology, =99.0%) , potassium phosphate monobasic(kh2po4) (500g) (acs reagent, =98%) , potassium thiocyanate 99% 500 gm , potassium thionate 100 gm , potato dextrose agar 500 gm , potato dextrose agar with chloramphenicol , povidone iodine ip (7.5 % w/v) 100 ml i.e. available iodine (0.75 % w/v , povidone iodine solution ip 5% w/v 250 ml available iodine 0.5 % w/v purified water ip q.s , povidone iodine ip 10 % w/v , (1.0 % w/v available iodine) u.s.p equivalent to 1% available iodine, <10% nonylphenol, <10% ethoxylated, <10% polyethylene glycol 400, <10% citric acid, <10% sodiumphosphate, 30 70% water, pack size: 500 ml bottle , povidone iodine ip 7.5 % w/v, (equivalent to 0.75 % w/v available iodine), 0 10% ammonium nonoxynol sulfate, 0 10% glycerol, 0 10% , sodium lauryl sulfate, 0 10% sodium phosphate dibasic, 0 10% hydroxyethylcellulose, 0 10% potassium iodide, >20% , water with emollient & moisturiser, pack size: 500 ml bottle , ppd 10 tu 10 ml , pre albumin 100 ml , pre albumin calibrator 100 ml , progestone receptor 3 ml , protease inhibitor , protein kit per kit , protein mw marker , protein, rust, coffee and ink spotting kit kit , proteinase k (powder) 100mg (100mg powder, to be used in dna isolation, molecular biology use only, source from pichia pastoris or tritirachium album activity unit per mg =30 ) , proteolytic enzymatic cleaner , proteolytic enzyme (proteas ) , instrument compatibility 1 ltrs , proteus mirabilis , prulifloxacin (antibiotic disc) 10mcg (250 disc) , prussian blue 500 ml , psa 1 ml , psa stain 100 ml , pseudomonas aeruginosa , pseudomonas agar base , pseudomonas cfc selective supplement , pseudomonas cn selective supplement , pseudomonas selective agar (cfc agar) , p toluidine , pt pcr zika rt pcr kit , pumic stone 500 gm , purified mercury 100 gm , qc for clinical chemistry 100 ml , quality control for clinical chemistry high , quality control for clinical chemistry normal , quinpristine dalfopristine(antibiotic disc)15mcg (250disc) , r.a. factor test(r.a. latex 100 t) 100 test , r.b.c diluting fluid 500ml appearance = clear colourless solution , r.b.c lysis solution 200 ml , r.c.m. media 250 gm , rack 96 well rack for mct tubes (for 2ml tube) (it should be made up of polycarbonate, must contain 96 places (8x12) for 1.5ml tube. ) , rack pcr rack with cover , rack pcr tube rack 96 set , rack pipette rack 6 pcs capacity , rack sample racks for sample tube each , rack sample racks for sample tube each , rack somersault rack universal each , rack staining rack staining jarincluding lids – 8 numbers slide rack 1 body type – stainless steel size – 47.5 x12.0x12.0 cm , rack steelrack – formicroscope slides slide staining rack is made of aluminium and stainless steel staining rack comes with movable handle. stainless steel slide rack is resistant to staining solutions. hinged rack handle allows easy insertion and removal of the microscope slides. slide staining rack holds up to 25 microscope slides. , rack steel rack – to hold 50 slides , rack test tube rack 24 tube , rack test tube rack (36 holes) alumunium , rack universal combi rack , rack test tube rack 36t , raffinose pentahydrate , rapid kit for c.difficile , rapid kit for h pylori 100 tests , rapid test kit for clostridium difficile pack of 50 test , rapid test kit for salmonella species pack of 50 test , rappaport vassiliadis soya peptone broth , rat repallent each , ravuconazolepowder (solubilized powder, g irradiated ) 1 mg , ready plate chromogenic coliform agar , reagent reservoir 200ml , reagent reservoir/ troughs autoclavable (polypropylene, 75ml, ) , reaty to use for drug assay methotrexate assay – 3.0 ml , reaty to use for drug assay phenobarbital assay 28ml with calibrator , reaty to use for drug assay phenobarbital assay 14 ml with calibrator , reaty to use for drug assay phenytoin assay 14 ml with calibrator , reaty to use for drug assay phenytoin assay 28ml with calibrator , reaty to use for drug assay valporic acid assay 14 ml with calibrator , reaty to use for drug assay valporic acid assay 28ml with calibrator , reaty to use for drug assay carbamazepine assay 14 ml with calibrator , reaty to use for drug assay carbamazepine assay 28ml with calibrator , rectangular staining jar – 10 in no. , red mercuric oxide 100 , red nucleic acid gel stain liquid (non mutagenic, non hazardous for disposal,highly stable and environmentally safe fluorescent nucleic acid dye for agarose gel electrophoresis) , reels auto clave tape reels , reels sterilization packaging reels 200 mtr 40 cmsreels , reels sterilization packaging reels200 mtrs 10 cmsreels , reels sterilization packaging reels200 mtrs 20 cmsreels , reinforced clostridial agar , resorcinol 50 g , ret search ii 1 ltr , reticulin stain kit 500 ml , reticulocyte counting fluid 250 ml blue coloured fluid solubility = miscible with water solubility test = passes test , rf 100 ml , rf latex calibrator 100ml , rhamnose disc , rhodamine b , riboflavin , rifampicin(antibiotic disc)5mcg (250 disc) , rifampicin 2 mcg (antibiotic disc) (250 disc) , rifampicin 25 mcg (antibiotic disc) (250 disc) , rifampicine 30 mcg (antibiotic disc) (250 disc) , rna extraction kit100 test , rna extraction kit50 test , rna extraction kit 250 test , rna zap pcr dna degradation solutions500 ml , rna later , rnase free water , rnase inhibitor 30 ml , rnase zap (250ml), cleaning agent for removing rnase , robo levels , rod glass rod each , roll bc robo 888 (thermal paper) 50 mm x 30 mm (robo roll) , roll tissue paper roll 15 mtrs , roll tissue paper rolls ( laboratory grade, 2 ply, 50 meter) , roll tsc priater carbon roll 5 (1/2) , roll tyvek roll – 10 ” rolls , roll tyvek roll – 15.5”rolls , roll tyvek roll – 6” rolls , rota virusfecal ag elisa 1 x 96 , rotary sealer nos. , rpmi 1640 for fungal testing 500 ml , rpr test kit – 100 test , rt pcr covid 19 rt pcr kit , rt pcr dengue serotyping rt pcr kit each , rt pcr h1n1 rt pcr 1 x 96 (1 pack) , rt pcr h3n2 amplification rt pcr 1 x 96 (1 pack) , rt pcr hpv rt pcr kit 1 x 96 t , rt pcr respiratory syncytial virus rt pcr 96 test , rt pcr rt pcr hbv dna viral load100 test , rt pcr rt pcr hcv rna viral load100 test , rt pcr superscript iii one step rt pcr kit – 100 r each , rt pcr zika rt pcr kit , rt pcr hbv dna viral load100 test , rt pcr hcv rna viral load100 test , rubber cork each , rubber for burette 3/8” , rubber teat round and large each , rubber teat each , rubber tubing 5/8” – each , rubella igg elisa 1 x 96 , rubella igm elisa 1 x 96 , ruler metallic scale inch and cm marking exactly on the ends measurement can begin at zero and scale at end for rule, stainless steel and round safety edge grinding and polishing and thicker side great value as 1 set of 3 length 6 inch to 24 inch material?stainless steel colour ?silver graduation range ?0 60 centimeters product dimensions ?61l x 2.5w centimeters , s 100 1 ml , sabroud dextrose agar 500 gm , sabroud dextrose agar with cap , saccharomyces cerevisiae , saccharose , safety goggle each , saffranin( prepared solution) 500 ml , saffranine 250 gm , safranine staining , salicylic acid 500 ml , salmonella poly o antiserum , salt1 kg. , sample cup 100 pc , sample processing cup each , sanidex opa withtest strip & deactivator, biodegradibility ,instrument compatibility report 5 ltr , saponin extra pure 100gm specification: mol. formula = na mol. wt. = na insoluble matter in water max. 0.1 % loss on drying ( 150°c ) = max. 10 % sulphated ash = max. 10 % microbial limits = passes test , saturated tartragine 500 ml , scaald mucosa sampler each , schiff reagent: 500ml specification : appearance clear colorless to slight pink colored physical state at 20 degree celsius liquid, ph<2density 1g/cm3,solubility in water(% weight) completely soluble , scrub typhus igm elisa 1 x 96 (1 pack) , sda 500 gm , sda 1000 gm , sda with cycloheximide 500 gm , selective enrichment secondary supplement for listeria , selective enrichment supplement for listeria , selective supplement for chromogenic listeria agar , selenite cysteine broth , selenite cystine broth base , serum copper kit 25ml , serum protein caibrator 100 ml , shelf life of 5 years 500 ml bottle , shikata orcein 100 ml , shoes cover 100 pc , sickle test kit 100 tests , sickle test kit 50 tests , silica gel for column chromatography 500 gm grade 60 120 mesh size, grade 100 200 mesh size, grade 230 400 mesh size, , silver allow 100 gm , silver nitrate 10% 100 ml , silver nitrate 5% 500 ml , sim media 250 gm , sim media 500 gm , slanetz and bartley medium , slide cavity slide for vdrl (24 wells) , slide concavity slide (one cavity) each , slide concavity slide (two cavity) each , slide double frosted slide 50pcs pkt , slide glass monocavity slide 25 mm x 75 mm x 1.3 mm each pack , slide glass slide – ground edges, refractive index isi 50 slides , slide microscope slides –(plain) 50 pcs clear glass ground edges 26x76 + 0/ 1 mm thickness – 1.35+ 0.1 mm 50 pcs/ pack , slide microscope slides –for i.h.c. each positively charge slides & positively charge slides hydrophilic treating with reagents such as aminosilane,poly l lysine or others , slide warming table , sma 1ml , sms wraps sheets 120 x 120cms sheets , sms wraps sheets 75 x 75cms sheets , soda lime 5 kg , sodium acetate 100 ml , sodium alphanaphthy phosphate 250 ml , sodium azide (nan3) 100 gm , sodium bicarbonate 500 gm • magnesium phosphate • deionized water • tungsto phosphoric acid hydrate • pas stain • pearl’s stain • mpo stain , sodium bicarbonate (nahco3) 150 gm , sodium carbonate (na2co3) 500gm(powder, =99.5%, acs reagent) , sodium chloride [ nacl ] 5 kg assay nlt = 99.9 % ph ( 5 % aqueous solution ) = 5.0 8.0 maximum limits of impurities • water insoluble matter = 0.003 % • bromide & iodide = 0.005 % • ferrocyanide = 0.0001 % • phosphate = 0.0005 % • sulphate = 0.002 % • total nitrogen = 0.001 % • arsenic = 0.00004 % • barium = 0.001 % • calcium = 0.002 % • iron = 0.0002 % • lead = 0.0002 % • potassium = 0.01 % • magnesium = 0.002 % • loss on drying = 0.5 % , sodium chloride 500 gm , sodium citrate500 gm , sodium citrate 3.2 % 500 ml , sodium citrate agar 500 gm , sodium deoxycholate 100 gm , sodium dichloroisocynanurate 500mg. excipeent q.s available chlorine 300mg, pack size: 50 tablets per bottle , sodium dichromate dihydrate , sodium dihydrogen phosphate 500gm , sodium dithionate 85 % extra pure 1 kg specification: mol. formula = na2s2o4 mol. wt. = 1/4.11 assay ( iodometric ) = 85 87.5 iron ( fe ) = max. 0.002 % ( at the moment of batch analysis ) , sodium dodecyl sulphate (sds) , sodium fauro cholate 500 ml , sodium fluoride powder 500 gm , sodium hydrogen sulphite , sodium hydroride 500 gm , sodium hydrosulphite(dithionite) 100 gm , sodium hydroxide (naoh) 500 ml , sodium hydroxide (naoh) 500 gm , sodium hydroxide based liquid alkali booster concentrate. ltr. , sodium hydroxide maximum 5% based bleaching agent 5 ltr. , sodium hydroxide pellets purified 500 gm , sodium hydroxide pellets purified 250 gm , sodium hydroxide(naoh) 500 ml , sodium hypochlorite solution 5 ltrs , sodium hypodiphosphate , sodium lauryl sulphate solution fo 94.haemoglobin estimation , sodium meta bi sulphate 500gm [ na2s2o5 , mol. wt. = 190.13] minimum assay ( iodometric ) = 95.0 % maximum limits of impurities • chloride = 0.1 % • iron ( fe ) = 0.01 % , sodium meta bi sulphate 65% based rinsing aid kg. , sodium nitrite 500gm(acs reagent, =97.0%) , sodium nitrite 500gmpowder or crystals (acs reagent, >96.99.0%) , sodium nitroprusside 100 gm , sodium nitroprusside 500 gm , sodium nitroprusside dihydrate for analysis 500 gmm = 297.95 g/mol specification: assay = 99.0 102.0 % substances soluble in water = 0.01 % chloride ( cl ) = 0.02 % sulphate ( so4 ) = conforms hexacyanoferrate ( iii ) = 0.02 % , sodium parborate monohydrate 50% w/w saniscop, 1 en 14561 bactericidal 2 ) en14562 pesticidal 3 ) en 13704 sporicidal 4 ) instrument compatibility report 5 ) en 14348 microbectericidal , sodium perborate monohydrate 50% w/w saniscop, 1) en 14561 bactericidal 2) en 14562 yeasticidal 3) en 13704 sporicidal 4) instrument compatibility report 5) en 14348 micobactericidal810 gm , sodium perchlorate (500gm) (acs reagent, >98.0%, in powder or chunk form) , sodium perchlorate monohydrate 500 gm , sodium phosphate dibasic (na2hpo4) (acs reagent, =99.0%) 500 gm , sodium phosphate dibasic dihydrate (na2hpo4) (250 gm) (acs reagent, =99.5%) , sodium phosphate monobasic dihydrate[ nah2po4 h2o ] assay nlt = 98.5 % ph ( 5 % aqueous solution ) = 4.2 4.6 maximum limits of impurities • chloride = 0.01 % • sulphate = 0.02 % • arsenic = 0.0001 % • iron = 0.002 % • heavy metals ( as pb ) = 0.0005 % • loss on drying ( 130°c ) = 21.0 24.0 % , sodium pyruvate , sodium taurocholate 500gm , sodium thiocyanate , sodium thioglycollate salt , sodium thiosulphate250 ml , sodium thiosulphate500 gm , sodium thiosulphate 2% 100 ml , sodium thiosulphate 5% 100 ml , sodium tungstate 250 gm , sodium tungstate dihydrate , solica get for thin layer chromatography 500 gm , soyabean casein digest agar (scda) , sparfloxacin(antibiotic disc)5mcg (250 disc) , spatula ayre”s spatula for cervical pap smear – sterile ayre spatula wood / plastic lenght: 18 cm / 18.8 cm individually packed in sterile pouch, in box of 100 , spatula sazaly – spatula with cyto brush (ratable 360deg) , spatula spatula chattaway 5” , spatula spatula one end flat , one endspour 12” , spatula spatula one end flat, one endspour 6” , spatula spatula both side 8” , spectinomycin(antibiotic disc) 100mcg (250 disc) , spiramycin 100 mcg (antibiotic disc) (250 disc) , spirit (burning ) 1 ltr , spirit (rectified) 500 ml , spirit alcohol5 ltrs , spirit lamp each , spirit lamp ss each , spirit(methylated) 500 ml , ssc 20 x buffer , stabilized formulation of hydrogen peroxide 10% v/v,silver 0.01% w/v for critical area fumigation and surface disinfection, non toxic, non irritating, eco friendly, pack size: 1 litre bottle , stabilized hydrogen peroxide (11 % w/v) diluted silver nitrate solution (0.01 % w/v) , staining reagent red panceaus stainer each , staining solution 500 ml , staining trough glass trough with cover, approx. 9 x 7 x 6.5 cm glass cover staining tray made of stainless steel staining tray made of stainless steel with extended handle staining trough , staining trough glass trough without cover glass cover staining tray made of stainless steel staining tray made of stainless steel with extended handle staining trough , staining trough( for bulk staining ) , staining trough plastictrough with cover, approx. 9 x 7 x 6.5 cm plastic cover staining tray made of stainless steel staining tray made of stainless steel with extended handle staining trough , stand e.s.r. stand 10 tube , stand loop stand each , stand pcr tube stand 48 pc , stand pipette stand 6 pcs capacity , stand test tube stand 12 tubes , stand test tube stand 24 tubes , stand tripod stand each , stand universal test tube stand 6 pcs capacity , staphylococcus aureus , starch 500 gm , starch sluble (acs grade) , steri pette xl , sterile connector for connnecting device each , sterilized yellow – 1000 pcs. , sticker 1500 sticker pack , stop watch – square design, plastic construction and lcd display show hour, minute, second, am / pm indicator, month, data, and day of the week select 12 or 24 hour user with chronograph stopwatches 1/100 second chronograph up to 23hours, 59 minutes, 59 seconds timer stopwatches alarm with 4 minutes snooze powered by one ag13 button cell (included) hourly chime function and alarm function are included nylon fabric neck strap for easy carrying split / reset, mode and start / stop buttons for convenient operation dial window material type: plastic dial display: digital , straight wire each pack , strains 250 ml , streptomycin (antibiotic disc)10mcg (250 disc) , streptomycin 300 mcg (antibiotic disc) (250 disc) , streptomycin 50 mcg (antibiotic disc) (250 disc) , strip tube retainer (should be certified dnase and rnase free, must hold 0.2ml 96 tubes or 12 strip tubes at a time ) , stromato lyser fba 5 ltrs , stromato lyser ffs 42 ml , stromatolyser fourth dl(4dl) 5 l , stroptozotocinz 500 gm , substrate for alp conjugated 2 ab tmb (3,3,5,5 tetramethylbenzidine) dab (3,3 diaminobenzine)tetrahydrochlor 5 gm , substrate for alp conjugated 2* ab nitro blue tetrazolium chloride (nbt) 1 gm , sucrose 500 gm , sucrose powder 250 gm , sucrose powder 500 gm , sudan black 500ml , sudan black b powder 250 gm , sudan black: 10gm specification: colour dark brown black, appearance (form) powder molar extinction coefficient @ 596nm ,min20,000 loss on drying max 5% , sudan black: 100gm , sudan black: 25 gm , sugar disc cellotrise 4% , sugar disc dulcitol 4% , sugar disc fructose 4% , sugar disc glucose 4% , sugar disc inositol 4% , sugar disc lactose 4% , sugar disc maltose 4% , sugar disc melibiose 4% , sugar disc ruffinose 4% , sugar disc sucrose 4% , sugar disc trehalose 4% , sugar disc xylose 4% , sulfadiazine 0.25 mcg (antibiotic disc) (250 disc) , sulfamethoxazole 23.75mcg (antibiotic disc) (250 disc) , sulfamethoxazole 23.75 mcg + trimethoprim 1.25 mcg (antibiotic disc) (250 disc) , sulfathiazole 0.25 mcg (antibiotic disc) (250 disc) , sulfisoxazole 0.25 mcg (antibiotic disc) (250 disc) , sulfolyser 5l , sulphosalic acid 500 gm , sulphosalicylic acid 500 gm , sulphur powder 500 gm , sulphuric acid (h2so4) 20 % 500 ml , sulphuric acid (h2so4) conc 500ml , sultax (cefoaximen + sulbactam) (antibiotic disc) p. size 5 x 250 , super mix 25ml each , supersensitive wash buffer 500 ml specification: concentrated wash buffer dilute 1 part with 19 parts deionised water. , swab stick – for pap smear 100 pcs , swab stick sterile swab stick with cover 100 pcs , syaptophysin 1 ml , syber safe(gel stain , dna) , sybr green pcr mix (500 reactions) , synaptophysin 1 ml , syphillis card , syphillis elisa 96 w , syringe filter (0 2) ul , system calibrator 100 ml , tank serological pipette tank , taq dna polymerase 500u (to be used in pcr reaction (500u minimum)) , taq polymerase each , tartaric acid 500 ml , t butyl alcohol 500ml , tcbs media 250 gm , tcbs media 500 gm , teicoplanin(antibiotic disc)30mcg (250 disc) , telithromycin 15 mcg (antibiotic disc) (250 disc) , tellurite cefixime supplement , temocillin 30 mcg (antibiotic disc) (250 disc) , temperature thermometer , ten parameter multistix for urinalysis 10 pack (100 strips/pack) specification 1. the pack size should be of 100 reagents strips per pack. 2. each reagents strips should be measure ph, specific gravity, protein, sugar, blood (both hemolyzed and non hemolysed), bilirubin, ketone, urrobilinogen, leukocytes, nitrite with or without ascorbic acid. 3.the reaction priniciple for each test should be accouding to the latest and validated testing method and as per recent advancement like peroxidase test for glucose, ehrlich test for urobiligone, fauchet test for bilirubin etc.4. each strips should be of long expiry.5. maximum analysis time for each reagent strips must be less than 2 minutes.6. the color production for every reaction will be bright enough so that analyzed adequately.7. the readings for every test must be provided in both semi quantitative and standad units.8. the color comparator provided with the pack should of standard quality with color shades exactly matching with what appears on the strips so that no discrepency between color of reagent strip and comparator will occur. , tetra methyl phenylene 250 ml , tetracycline (antibiotic disc) 30mcg (250 disc) , tetracycline 10 mcg (antibiotic disc) (250 disc) , tetracycline 5 mcg (antibiotic disc) (250 disc) , tetrathionate broth 500 gm , tetrazolium salt , thc 100 ml , thermofisher automated rna extraction kit , thiamin hydrochloride , thio urea 500gm , thioacetamide , thiosemicarbaxide 0.5 % 100 ml , thiosulfate citrate bile sucrose (tcbs) agar , thymol 1 kit , thymol blue 500 gm , tibc 150ml , ticarcilin (antibiotic disc)75mcg (250 disc) , ticarcilin –clavulanic acid (antibiotic disc)10mcg (250 disc) , ticarcilin –clavulanic acid (antibiotic disc)75mcg(250 disc) , tigecyclin (antibiotic disc)15mcg (250 disc) , tincture benzoin , tincture iodine , tips blue tips 500 pcs , tips filter tips 10 ul 100 ul , tips filter tips 10?l 96 tipes , tips filter tips 100 ul 1000 ul , tips filter tips 2 ul 10 ul , tips filter tips 20 ul 200 ul , tips filter tips 1000?l 96 tipes , tips filter tips 20?l 96 tipes , tips filter tips 200?l 96 tipes , tips filteredtips200 1000ul 96 t , tips sterilefiltered tips 01 10ul , tips sterilefiltered tips 02 20ul , tips sterilefiltered tips 100 1000ul , tips sterilefiltered tips 10 100ul , tips sterilefiltered tips 20 200ul , tips sterile filtered tips 1 50ul 96pc , tips sterile microtips (0.5 10ul) (clear pre sterile, nonfilter microtips) , tips sterile microtips (1000ul) (clear pre sterile, non filter microtips) , tips sterile microtips (20 200ul) (polypropylene, pre sterile, non filter, yellow microtips without tip box) , tips yellow tips – 1000 pc pack , tissue capsule /embedding cassette (large) , tissue capsule /embedding cassette (small) , tissue cassate leica 1000 pc , tissue embedding cassette – (large ) made from acetyl polymer resistant to histological solvents non cytotoxic, non metallic colors storage temp. room temp eachmeasures: 3x2.5x0.4 cm. , tissue embedding cassette – (small)made from acetyl polymer resistant to histological solvents non cytotoxic, non metallic colors storage temp. room temp each slot measures: 1 x 5 mm, total 128 slots per cassette , tissue freezing media 200 ml , titriplex , tobidine blue 250 gm , tobramycin (antibiotic disc)10mcg (250 disc) , toluene 250 ml , toluidine blue 100ml , torniquate 1 meter , total iron kit 150ml , total protein kit3 x 150ml , total protien csf / urine 100 ml , total rna isolation from blood(50 reactions) , tough spots assorted colours , toxo igg elisa 1 x 96 (1 pack) , toxo rapid igg/ igm 50 tests , transferin 1 kit , tray draining tray it should be madeup of polycarbonate, autoclavable, dimention should be (mm) 400x300x100 (lbh) , tray ice tray each , tray slide tray , tray tray 3000ml , tray utility tray each , tri sodium citrate dihydrate purified 250 gm , tri sodium citrate dihydrated purified 500 gm , tributyrin agar , trichlorgacetic acid 500 ml , trichloro acetic acid (250g) (acs reagent, =99.0%) , trichrome stain( masson kit): specification : aniline blue solution 250mlbiebrich scarlet acid fuschin solution 250ml phosphomolybdic acid solution 250ml phosphotunngstic acid solution 250ml , trifluoroacetic acid , triglyceride kit 2x150ml , triglycerides 100 ml , trimephoprim(antibiotic disc)5mcg 250 disc , trimolol 0.25% , trimolol 5% , triphicasepepten 250 gm , triple sugar iron agar 500 gm , tripple enzymatic cleaner , tris base 500 gm , tris buffer 500 g , tris buffer (0.2 mol/l)plt 9.0 – 500 ml , tris hydrochloride 100 gm , tris hydrochloride 250 gm , tris powder (500gm) (acs grade, for molecular biology use) , tris chloride 500gm , tris saturated phenol , triton x 100 , trizol (500ml) (to be used for isolation of rna, dna, and protein ) , troporine i stripe 10 t , trypsin powder 250 gm , tryptic soya broth , tryptone broth , tryptone soya yeast extract agar , tsi 1000 gm , tsi 250 gm , tsi 500 gm , tube 15 ml falcon tubes(sterile, conical bottom, autoclavable,medical grade pp/hdpe confirming to usp class vi) , tube 50 ml falcon tubes (sterile, conical bottom, autoclavable,medical grade pp/hdpe confirming to usp class vi) , tube acd buffer tubes (9ml yellow capped tube filled with acd buffer (anticoagulant) to be used for blood collection) , tube blood rna tube (blood transport tubes for rna stability, containig 50 tubes per pack) , tube capillary tube 100pcs pack , tube centrifuge tube 10 ml , tube centrifuge tube 15 ml , tube conical falcon graduated 15 ml each , tube conical falcon graduated 50 ml each , tube culture tube 10 x 100 mm – each , tube cylindrical glass tubes for column chromatography each , tube dreyers tube 500pcs , tube durhams tube 1inch size 1000 pcs , tube felix tube 500 pcs , tube hemoglobin round tube each , tube hemoglobin square tube – each , tube hemoglobin tube (german) pcs , tube id sample tube 96w , tube kahn test tube 100 pcs pack , tube mcfarland tube with autoclavable cork , tube microcentrifuge tube 0.5ml (sterile, clear, should have frosted cap surfaces for labeling) , tube microcentrifuge tube 1.5ml (sterile, clear, should have frosted cap surfaces for labeling) , tube microcentrifuge tube 2.0ml (sterile, clear, should have frosted cap surfaces for labeling) , tube microcentrifuge tube amber microcentrifuge tubes 1.5ml (sterile, brown color mct tubes) , tube pcr 0.2 ml strip tubes with cap (8 tube strip)(it should be madeup of polypropylene, each strip should contain 8 tubes, must supplied with separate domed cap strip ) , tube pcr strips tubes (200 ul) with flat caps [500 strips]( packs)(polypropylene pcr tube, 0.2ml, 8 tubes/strip, dome caps should be supplied separately (not attached to the tubes)) , tube pcr tube with cap 0.1ml– 100 pc , tube pcr tube with cap 0.2ml – 100 pc , tube pcr tube with caps 0.1ul strip , tube pcr tube with caps 0.2ul strip , tube robo tube each , tube test tube size – 12 x 75 mm 100 pc pack size , tube test tube size – 12x 100 mm 100 pc pack size , tube test tube size – 13 x100 mm 100 pc pack size , tube test tube size – 15 x125 mm 100 pc pack size , tube test tube size – 16 x150 mm 100 pc pack size , tube test tube size – 18 x150 mm 100 pc pack size , tube test tube size – 20 x150 mm 100 pc pack size , tube test tube size – 25 x150 mm 100 pc pack size , tube tissue carrier rna tube , tube treated tubes , tube tube with transparent label 1000 each , tube wintrobetube , tube leveler , tween 20 100ml , tween 80 100 ml , typhidot igm test kit 50 tests , typhidot test (rapid test kit) for typhoid fever 50 test , udp glucose (250mg) (% purity (hplc) > 98) , uibc 100 ml , uracil dna glycosylase(1 vial of 1 unit/ ul 200 ul) , urea 100 ml , urea 250 gm , urea 500 gm , urea kit 2x150ml , urea solution 40 %5ml , uric acid 100 ml , uric acid kit 2x150ml , urinalysis control 5 ml , urine calibrator 100 ml , urine chemistry control 5 ml , urinometer each , uristrix 100 t , uv safety goggles 96w , valproic acid 100 ml , vancomycin(antibiotic disc)35mcg (250 disc) , vancomycin powder 50gm , varicella zoster igm (ab) elisa 1 x 96 , vial bomin vial 10 ml each , vial cryo vial 1.0 ml 1000 pcs 1pkt , vial cryo vial 1.8ml (each pack 500 vials) , vial cryo vial 5ml 500 pc , vial disposable vial – 100 pcs. , vial edta vial (vaccum) 100 pcs. , vial edta vial(non vaccum) 100 pcs , vial fluid vial 100 pcs , vial lithium heparin vacutainer (green) 100 pcs , vial plain (red non vaccum) 100 pcs , vial plain vial 100 pcs pack , vial plain vial 5 ml glass 100 pcs , vial plain vial(white) 5 ml 100 pcs pack , vial proteinase k 20 mg ( vial) , vial ria vial each , vial s.s.t tubes (yellow/ gold) 100 vials , vial sodium citrate 3.8% vial (e.s.r non vaccum) 100 pcs (black) , vial sodium citrate 3.8% vial (e.s.r vaccum) 100 pcs (black) , vial vacutainer with transparent level(yellow): gel 100 pcs , vial vacutainer with transparent level: oxo – flo/glucose (grey) 100 pcs , vial vacutainer with transparent level: plain (red) (clot activator) 100 pcs , vial sodium citrate 3.2 % vial (ptinr) 100 pc (sky blue) , victoria blue 1.5 % 500 ml , vimentin 1 ml , violet red bile glucose agar , von kossa stain 100 gm , voriconazole powder (solubilized powder, g irradiated ) , vortex , vp reagent 100 ml , vtm / utm 96 w , w.b.c diluting fluid 500ml appearance = bluish violet coloured physical state @ 20°c = liquid odourless ph = 2.5 3.5 absorption max. 588 594 nm absorption ( ? max. diluted 1.25, 1cm ) = 0.450 0.600 , wash concentrate 100 ml , wash solution 5 ltr , weigerts iron hematoxylin 25 gm , west nile igm elisa 1 x 96 , white petroleum jelly (white vaseline) 100 gm , white petroleum jelly (white vaseline) 250 gm , whole blood extraction kit 250 test (1 pack) , widal antigen( for tube method ) 4x100ml , widal antigen (for slide test) 4x100ml , wipes 0.5% ahp based high level surface disinfectant tuberculocidal wipes wipes , wipes kim wipes each , wipes tissue wipes ( big towels packs) (size 37cm x 42cm. should be made from 100% virgin fiber,low lint and low extractable. for sensitive instrument/lens cleaning.) , wipes tissue wipes ( small towels packs) (size 21cm x 11cm. should be made from 100% virgin fiber,low lint and low extractable. for sensitive instrument/lens cleaning.) , x ray developer 1 kg , x ray fixer 1 kg , xld media 500gm , xtum (ceftriaxone + sulbactam) (antibiotic disc) p. size 5 x 250 , xylene 2.5 ltrs (specification: boiling range (95%) = 137°c 142°c weight per ml at 20°c = 0.850 0.865 nvm = 0.01% max. solution in alcohol = clear) , xylene 250 ml , xylene 500 mlc6h4(ch3)(specification: boiling range (95%) = 137°c 142°c weight per ml at 20°c = 0.850 0.865 nvm = 0.01% max. solution in alcohol = clear) , xylene cyanol 10 gm , xylocaine 2% 25 ml , yeast nitrogen base 500 gm , zinc chloride , zinc oxide 500gm , zinc powder 500gm , zinc sulphate 500gm , zn stain fast kit 250 ml , zymokeen ltr. , list of reagents (dedicated system pack for erba em 360) fully automatic biochemistry analyzer (instruction : all parameters should be quotedby bidder) , glucose 100 ml , urea 100 ml , creatinine (enzymatic) 100 ml , uric acid 100 ml , total bilirubin 100 ml , direct bilirubin 100 ml , sgpt 100 ml , sgot 100 ml , lipase 100 ml , amylase 100 ml , alkaline phosphatase 100 ml , total protein 100 ml , albumin 100 ml , calcium 100 ml , phosphorus 100 ml , total cholesterol 100 ml , hdl cholesterol 100 ml , triglyceride 100 ml , direct ldl cholesterol 100 ml , iron 100 ml , ferritin with calibrator 100 ml , ferritin control level 1 100 ml , ferritin control level 2 100 ml , uibc/tibc 100 ml , ck nac 100 ml , crp quantitative with calibrator 100 ml , rf quantitative with calibrator 100 ml , ldh 100 ml , gamma gt 100 ml , micro albumin with calibrator 100 ml , micro protein with calibrator 100 ml , quality controll1 100 ml , quality controll2 100 ml , system multi calibrator 100 ml , crp/rf c(quality control , crp, rf) 100 ml , list of reagents dedicated system pack for dirui cst240 fully automatic biochemistry analyzer(instruction : all parameters should be quotedby bidder) , glucose 100 ml , urea 100 ml , creatinine (enzymatic) 100 ml , uric acid 100 ml , total bilirubin 100 ml , direct bilirubin 100 ml , sgpt 100 ml , sgot 100 ml , lipase 100 ml , amylase 100 ml , alkaline phosphatase 100 ml , total protein 100 ml , albumin 100 ml , calcium 100 ml , phosphorus 100 ml , total cholesterol 100 ml , hdl cholesterol 100 ml , triglyceride 100 ml , microalbumin with calibrator 100 ml , microprotein with calibrator 100 ml , quality controll1 100 ml , quality controll2 100 ml , system multi calibrator 100 ml...

Health Department - Jharkhand

39447878 purchase of items for hwcs purchase items for hwcs , functional refrigerator 195 ltr. , boiler or autoclave small size , dressing drum with lid , mattress , kellys pads , torch / torch box type pre focused ( 4 cell ) , examination lamp , wall clock with all hands , iv stand , sunction machine electric / foot operated suction apparatus , oxygen cylinder with troly , oxygen set ( mask with tubing ) , bp apparatus , adult stethoscope , fetoscope / doppler , basin 825 ml ss , hub cutter , needle destroyer , digital thermometer , gauze cutting scissor stratight , weighing machine ( infant ) , weighing machine ( adult ) , thermometer rectal , dental probe , nebulizer , measuring tape , tallquist hb scale , snellen vision chart , near vision chart , stadiometer ( height measurement ) , sims retractor / depressor , kellys heamostat forceps straight 140 mms , vulsellum uterine forceps curved 25.5 cm , cusco’s / graves speculum vaginal bi valve small, , cusco’s / graves speculum vaginal bi valve medium , cusco’s / graves speculum vaginal bi valve large , plain forceps , tongue depressor , mouth gag , dental probe , mouth mirror , cheatle forceps , dressing tray with lid , suturing tray with lid ss small , suring needle curved , suturing thread , round slit ( hole ) towel , ambu bag , mask neonatal size ( 0 ) , mask neonatal size ( 1 ) , baby weighing scale , new born thermometer , oxygen hood ( neonatal ) , designated new born tray ss with lid , ss tray with cover , scissors , artery forceps , sims speculum veginal double ended iss mediam , cord cutting scissor / surgical blade for cutting cord , bowl for antiseptic solution , kidney tray ( small ) , kidney tray ( big ) , episiotomy scissor , allis forceps , toothed forceps , thumb non toothed forceps , needle holder , suture needle straight 10 , suture needle curved , cuscoss / graves speculum vaginal ( large ) , cuscoss / graves speculum vaginal ( medium ) , cuscoss / graves speculum vaginal ( small ) , sponge holding forceps / cheatle forceps , ppiucd insertion forceps , uterine sound ( for iucd ) , airway , labour table , rack / table for keeping trays, fluids , delivery troly , foot step , stool , screen seperator with stand , almira , rack for keeping sleepers / shoe covers outside labour room , cot , pillow , pillow cover , side locker , bed sheets , blankets , office table , chair , examination table , mattress for examination table , bucket big , bucket small , mugs , chairs for waiting area ( three in one set ) , led tv for iec , white wrighting board , syringes ( 20 cc , syringes 10cc , syringes 5cc , syringes 2cc , ad syringes ( 0.5ml , ad syringes ( 0.1 ml ) , disposable masks , sterile surgical gloves , gown / apron , shoe cover , caps , mucous extractor , disposable cord clamp , heavy duty gloves , foleys catheter , disposable sterile urethral catheter ( rubber plain 12 fr ) , disposable lancet ( pricking needles ) , routine immunization monitoring chart , blank immunization cards / joint mch card ( one per pregnant mother ) and tally sheets ( one per immunization session ) , interdental cleaning aids , chlorine tablets , sanitary napkins , 200 watt bulb ( 2 ) , salt – iodine test kit , wooden spatula , dry cell / battery , partograph in case sheets , iv cannula 16 , iv cannula18 , iv cannula 20 , iv cannula 22 , iv set , sanitary napkins , mackintosh sheet 5 meter , disposable delivery kit for delivering hiv patients ( emergency ) , disposable delivery kit for normal delivery , 5 l plastic tub for keeping chlorine solution , bucket for keeping 1% chlorine solution ( for spillage ) , colour coded bins yellow , colour coded bins red , colour coded bins black , colour coded bins blue , colour coded plastic bags ( yellow, red, blue and black ) , insecticide treated nets , mopping stick , micropore tape , urine bags , sheets for drying and wrapping baby , feeding tube , cleaning material and detergents , insectiside treated net , window screens , chlorine tablets , inter dental cleaning aid , 200 watt bulb , online ups 1 kva with 60 minute backup , fire extinguisher , hand towels , soap , towel , gauze piece ( roll ) , cotton swab ( roll ) , tuning fork , ice pack box , vaccine carrier , floor mopping stick , dari with room size. , mats for yoga , curtains , micropore tapes* , urine bags* , slide drying rack , specimen collection bottle , spirit lamp , test tube holding clamp , test tube rack , test tubes , wooden spatula , glass rods , glass slides , kit for testing residual chlorine in drinking water , rapid pregnancy testing kit , rapid test kit for dengue , rapid test kit for malaria , n / 10 hydrochloric acid , reagents such as hydrochloric acid, acetic acid, benedict’s solution, bleaching powder, hypochlorite solution, methylated spirit etc. , acetic acid solution , micropippette , yellow tips for micropipette , dipsticks for urine test for protein and sugar ( 1 container of 25 strips ) , whole blood finger prick hiv rapid test and sti screening test each , h2s strips test bottles for water testing , salt iodine tesitng kit , talquish hb scale....

Zilla Parishad - Jharkhand

39383441 installation of digital class room and steem lab at kasturba gandhi balika vidyalay palojori, g.p. kunjora, block palojori under district deoghar , digital class room, innovation & tinkering lab (itl) for class 6 to 12 + learning tools (teachers training manuals and aligned software installation) + 1 steam library , it equipment (5 laptops + 1 mobiles + internet) , smart classroom (1 interactive touch panel 65) , class room infrastructure installation (workstation, 40 stools, 1 almirah, laptop table top) , teachers development program (tdp) (4 quarterly teachers training) , monitoring & evaluation (m & e) (4 quarterly m&e) , add 18% g.s.t. , add 1% labour cess , add for interete service & other misslanious work during installation of steem lab (payment will be made as per actual expenditure)...

Zilla Parishad - Jharkhand

39382279 installation of digital class room and steem lab at kasturba gandhi balika vidyalay madhupur, village, g.p. gariya, block madhupur under district deoghar , digital class room, innovation & tinkering lab (itl) for class 6 to 12 + learning tools (teachers training manuals and aligned software installation) + 1 steam library , it equipment (5 laptops + 1 mobiles + internet) , smart classroom (1 interactive touch panel 65) , class room infrastructure installation (workstation, 40 stools, 1 almirah, laptop table top) , teachers development program (tdp) (4 quarterly teachers training) , monitoring & evaluation (m & e) (4 quarterly m&e) , add 18% g.s.t. , add 1% labour cess , add for interete service & other misslanious work during installation of steem lab (payment will be made as per actual expenditure)...

Zilla Parishad - Jharkhand

39382276 installation of digital class room and steem lab at kasturba gandhi balika vidyalay sarwan, village, g.p. kusmaha, block sarwan under district deoghar , digital class room, innovation & tinkering lab (itl) for class 6 to 12 + learning tools (teachers training manuals and aligned software installation) + 1 steam library , it equipment (5 laptops + 1 mobiles + internet) , smart classroom (1 interactive touch panel 65) , class room infrastructure installation (workstation, 40 stools, 1 almirah, laptop table top) , teachers development program (tdp) (4 quarterly teachers training) , monitoring & evaluation (m & e) (4 quarterly m&e) , add 18% g.s.t. , add 1% labour cess , add for interete service & other misslanious work during installation of steem lab (payment will be made as per actual expenditure)...

Ranchi University - Jharkhand

39356766 bids are invited for gumla principal room table table , headclerk table table , accountant table , staff table table , staff table conference table , principal room back storages , sofa , visitor table with glass top , visitors chair , revolving chair , curtain complete set , computer table , chair for computer , almirah_locker , clc counter made of prelaminated board with stores capacity , office table made of mdf board , stainless steel visitors chair , four seater bench desk with back support , wooden podium , notice board , face to face_wall facing computer table with tbpt and cpu trolley , teachers table with 3 drawer pedestal , student fixed revolving chair , teachers revolving chair , proper supply and fixing of wooden flooring complete , cup board with locker , bed , doctors tool , saline stand , small almirah , green board , wooden podium , wardrobe , island_wall facing workbench , stores rack with display and lock , wooden stools sunmica top and paint , master chair , ceramic board scratch proof , first aid kid , office table made of mdf.board , library cum reading room table top , students fixed chair , steel glass door almirah , library reception table with extended top and under , 8 seater library reading table. , printer table with extended top and under storage , periodical display rack , fire extinguisher , fire extinguisher 5 ltr supply and installation of furniture for mahila college total quantity : 1634...

Rural Works Department - Jharkhand

39278153 bids are invited for patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold beedsheet screen , bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , iv stand , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , scessior medium , a 4 paper white , pen , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register or book , pillow , pillow cover , floor wiper rubber , floor wiper jut , door mat , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , garbage poly bag black 10 kg , garbage poly bag red 10 kg , hand wash liquid , hand wash soap , water bottle 1 ltr. , tiolet cleaning brush , bed sheet , plastic chair , led tube light , led bulb t shape , desktop computer , webcame , speaker total quantity : 776...

Rural Works Department - Jharkhand

39272407 bids are invited for patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold beedsheet screen , bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , iv stand , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , scessior medium , a 4 paper white , pen , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register or book , pillow , pillow cover , floor wiper rubber , floor wiper jut , door mat , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , garbage poly bagblack 10 kg , garbage poly bag red 10 kg , hand wash liquid , hand wash soap , water bottle 1 ltr. , tiolet cleaning brush , bed sheet , plastic chair , led tube light , led bulb t shape , desktop computer , webcame , speaker total quantity : 776...

Welfare Department - Jharkhand

39132329 request for quotation for partner empanelment for supply of nicu nursing infrastructure 1. infant baby warmer with stand (supply, installation and demonstration) micro controller based electronics controls: servo skin/manual mode pre warm: use the equipment with 30% heater output in manual mode. no need of calibration required for temperature probe. high intensity quartz/calrod heating element for effective radiation halogen observation lamp parabolic reflector design to send uniform heat to the bed surface. memory backup to restore set temperature and previous mode, in case of power failure. optimum bed dimensions ensure optimum work space for the nursing staff. comprehensive alarms and safety cut offs. instant warming and uniform heating & short wave heater ensures instant warming automatic safety heater cut off at 39 c in any mode controller electronics: high speed micro controlled mode of operation: servo skin, manual skin mode control range: 30.0 38.0°c. manual mode timer: 1 min 15 min (selectable) percentage of heater output: 10% 100% in 10% increments memory back up: equipment restores the previous settings programmable mute time: the user can select the mute time safety heater cut off: if the skin sensor is removed from the babys skin over temperature heater cut off: if the skin temperature is>39°c in any skin/manual mode temperature sensor (probe): thermistor sensor accuracy of skin sensor: ±0.1°c accuracy of skin probe interchangeability: ±0.2°c power rating : ~230v, 50 hz max. heater wattage: 600 watts max. power requirement : 700 watts examination lights : 12v, 50w halogen lamp 2 castor 4 nos (2 with brake & 2 without brake) monitor shelf : 1 no should have provision to keep undersurface phototherapy light. height adjustable operating noise level : <50dba alarms skin sensor is removed from the babys skin skin temp high : >1.0°c.from the set temperature, skin temp low : < 1.0°c.from the set temperature, skin temp probe fail: if the skin probe is short or fail over temperature: if the skin temp. is >39°c, heater fail system fail: electronic component defect environment operating temp: 15.0°c to 35.0°c, storage temp : 20.0°cto 60.0°c, operating humidity: 5% to 90% rh, non condensing storage humidity : 0% to 99% rh, non condensing altitude: sea level to 1.9 miles quality: iso 13485:2016 electrical & product safety : : iec 60601 1 & iec 60601 1 2 , iec 60601 2 21 , iec 60601 2 50 should have complied with european ce 93/42 eec standards certification from a notified body. preferred make: make: dre/neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care/ibis/kenmark/david/trimpeks/frontline/fanem. 2.baby incubator for nicu(supply, installation and demonstration) thermal performance: consistent air temperature. bi directional air flow. internal noise level: low operating sound levels assure a developmentally supportive environment for infants. double wall hood: double wall hood is designed to decrease radiant heat transfer between the baby and the incubator wall. the inner wall can be easily removed for cleaning without the use of tools. air screen: the air screen creates a barrier of warm air when the access panel is open. electrical electrical connection : ac 230 v, 50 hz, max power rating : 370va max incubator with fixed/variable height heater power rating: 300w, electronics : micro controller with sell test function mute time: 2 min 20 min programable, incubator control modes : servo air and servo skin co2 level with in the hood : less than 0.8% when mixture of co2 in air is delivered at 750ml/min at a point 10cm above the center of mattress temperature accuracy skin /air mode : accuracy ± 0.2 c max temperature : 39°c warm up time : 25 35 min per 10°c (at 23°c ambient temperature) initial temp overshoot : <1.0°c.temperature uniformity : <0.8°c sensor : thermistor probe interchangeability : accuracy ± 0.2°c (calibration not required) noise level inside incubator : <60 db) air velocity over the bed : <10 cm/sec (at 10cm above the center matress) relative humidity : >80% at 10 cm over bed center air filter capacity : 99% (0.5) air intake volume with filter: 25 l/min μ & without filter 250l/min bed tilting (tilting by c clamp) :± 8°up/down set temperature range air mode : 20°c to 37°c, 37.1°c to 39°c temperature override mode skin mode : 30°c to 37°c, 37.1°c to 38°c temperature override mode oxygen concentration oxygen input 5 lpm : 25% to 45% 0₂ oxygen input 15 ipm : 45% to 70% 0₂ humidification : low/high <80% skin temperature low/ high air temperature high / low alarms failure of air, air flow, heater, skin probe, air probe, system, power temperature 39 in any mode safety heater is electronically cut off if air/skin temperature inside the incubator exceeds 39.0°c iec 60601 1 specification type of protection against electric shock: class 1 mode of operation: continuous electrical safety: iec 60601 1 & iec 60601 1 2 , iec 60601 2 19, weight : min 50 kg height of bed from floor : 900 mm dimensions of bed : 700 mm x 400 mm castors : 4 diameter antistatic (2 locking and 2 non locking) iv maximum load : 1.5 kgs maximum monitor load : 3.0 kgs maximum baby weight to be: 5.0 kgs should have complied with ce> preffred make: neotech/zeal/v care/ibis/kenmark/frontline/sst/electromeg/comen/bistos/fanem/vng/phoenix/ziraffe/bpl/dragor 3. baby bassinet / baby cradle for nicu (supply, installation), to be used with phototherapy light. the system should be detachable fire retardant enclosure for light source adjustabble height should have provision to undersurface phototherapy can be used with standing phototherapy the unit can also be usable as observation trolly. bed size approximate: 50x75 cm height : adjustable from 400 to 600 cm the units should have anti static 2” castor 4 nos, 2 with brakes. 4. phototherapy unit(standing with stand) , moveble with 2 4 wheels the leds of each unit should be therapeutic high wattage blue & white leds, min 12 nos the wavelength should be between 455 to 465nm the high irradiance at skin level should be > 45μw/cm2/nm at a distance of 30 cm should have an uniformity ratio of > 0.40 the led lamps used should be rated to last up to 20,000 hrs should have dual digital cumulative hour timer for led usage and patient exposure the light source system should have overheat protection with power cutoff for temperature uniform light distribution led unit tilt up to 90 degree and allowing use with warmer iec 60601 1 specification type of protection against electric shock : class 1. 5. undersurface phototherapy light the leds of each unit should be therapeutic high wattage blue & white leds, min: 12 nos the wavelength should be between 455 to 465nm the high irradiance at skin level should be > 45μw/cm2/nm at a distance of 30 cm should have an uniformity ratio of > 0.40 the led lamps used should be rated to last up to 20,000 hrs treatment timer ensures auto cut off when elapsing the set time no infrared rays ensures minimize the water loss should have dual digital cumulative hour timer for led usage and patient exposure the light source system should have overheat protection with power cutoff for temperature uniform light distribution led unit can be usesable with warmer iec 60601 1 specification type of protection against electric shock : class 1. 6 neo ventilator (hfo) (supply, installation and demonstration) 1. invasive, non invasive , o2 theraphy(hfnc) 2. min 13 large color touch display 3. basic modes: vc ac, vc simv, pc ac, pc simv, cpap psav + advance mode ( prvc, aprv, bipahasic , mmv) 4. ncpap, nippv modes for neanates 5. inbuilt nebuliser 6. 3 wave forms/ 3 loos/trends 7. 32 patient parameter 8. inspiratory hold/expiratory hold/po.1 /intrinsic peep, lung recruitment maneuver (p v tool), proportional pressure support cerification: ce certified, iso and iec certified prefferred make: acutronics/bpl/hamilton/schiller/maquet servo/ge/comen/philips/drager/siemens/medisys/vyaire/tecme/metran/fanem/getinge/briovent/advin/narang/skanray/lifeline/billicare/magnamed/sle/medi/ honmed/ medtronic/resmed/smith/becton/mindray/trivitron/medtronic/resmed/newport/ 7 bubble cpap (supply, installation and demonstration) should have latest technology and capable of giving bubble cpap therapy to neonates for preterm and term babies weighing from 400 gms , also capable of giving hfnc therapy to neonates and pediatric cases. machine should have options to be used as bubble cpap, hfnc, nasal cpap and t piece resuscitator should have lcd touch screen 4” & above graphical display should have digital real time airway pressure monitoring and displayed on screen should have digital real time fio2 monitoring and displayed on screen should have built in compressed air source & no external air compressor should be required or mounted on trolly or taken from central air source should work with low flow oxygen input with maximum input flow of 15lpm and 1 bar input pressure should have inbuilt blending mechanism for fio2. should have good quality calibrated blender for mixing of air and oxygen with selectable fio2 (21% to 100%). the machine should have loss less blending mechanism & fio2 monitoring. equipment should also work without oxygen input should have builtin saftey valve with preset mode specific safety cutoff should have universal connections for circuit and attachements should have inbuilt battery back up upto 2 hours should have settable audio & visual alarm for low pressure, high pressure & safety pressure cutoff limit should be able to be mounted on the mobile stand for easy moving, and the stand should be equipped with bubble generator holding clamps with easy fixation. should be able to set output flow of 1 10 lpm can set fio2 from 21 100 % accuracy of flowmeters should be +/ 4%accuracy of pressure measurement should be +/ 1 cmh2o accuracy of fio2 should be +/ 3% should be able to set cpap pressure in bubble cpap mode from 3 10 cmh2o should be able to set cpap pressure in nasal cpap mode from 0 15 cmh2o setable pressure in auto t piece mode should be peep: 0 15 cmh2o & pip: 10 40 cmh2o should have settable as well as inbuilt safety over pressure valve up to 40cm h2o should be supplied by manufacturing company having iso 13485 certifications & ce for medical devices manufacturer should be an indian company with product made in india should be provided with single use nasal prongs (small, medium, large) single use nasal masks (small, medium, large), single use head bonnet (small, medium, large, xl) single use rams cannula (small, medium), single use neonatal patient circuit with single heater wire and humidifier chamber with autofeed should have audio visual alarm should be provided with us fda certified servo humidifier temperature sensor probe and heater wire adaptor humidifier specification mode – should have auto mode servo controlled for invasive, noninvasive ventilation & high flow default setting – should be 37 °c (invasive), 31 °c (noninvasive) should have an automatic temperature setting in invasive & non invasive mode temperature display should have the following alarms: temperature sensor, limb failure, chamber & patient end temperature alarm silence facility electrical specs. – input voltage 220 240 v / 110 127 v / 100v; 50/60hz standards – iec 60601 1, iec 60601 1 2, en iso 8185, ce certified, usfda preferred make: fisher & paykel/drager/biomed/hamilton/electrogenics/fanem. 8 pulse oxymeter (supply, installation and demonstration) hand held pulse oximeter with enhanced spo2 accuracy during motion artifacts and waveform and numeric value display 2.4 oled color display 96 hours data memory suitable for adult, pediatric and neonatal application mains as well as battery operation visual alarm indicator hand held unit with standard accessories: spo2 sensor with extension cable adapter for mains connection adaptor for mounting hand held unit operating manual manufacturer should be iso 13485 certified 9 multipara monitor (supply, installation and demonstration) should have facility to display ecg, rr, hr, pr, spo2, nibp, single temperature as standard parameters with in built rechargeable battery back up of at least 6 hrs of operation. display: touchscreen color tft lcd display of size 8” or more. should display at least 4 waveforms or more of dual trace ecg (cascaded ecg), spo2 and respiration simultaneously. should have st analysis & arrythmia analysis should have digital technology to sense the spo2 in hypotensive, shivering & motion condition. should have facility for displaying different screen configurations. should have audio visual alarms for all parameters & should be user selectable should have audio alarm silence selectable for 60 sec / 120 sec should have volume adjustable for audio alarms should have different color visual alarms as per set priority should have audio for qrs beep and volume should be adjustable should be able to store & display at least 72 hrs of graphical trends of all parameters. should be suitable for monitoring adult & pediatric patients. should be able to give visual & audible alarms with three levels of volume adjustment on violation of any monitored parameter. the monitor should be european ce approved. should be iso 13485 certified. power input to be 220 240vac, 50hz fitted with indian plug warranty: should have minimum 1yrs. of manufacturer warranty. make: niscomed/philips/ge healthcare/medtronic/mindray/cms/siemens/choicemmed/nidek/bpl/biotronic/honeywell/nihon/spacelabs/schiller 10 syringe pumps ((supply, installation and demonstration) display should be 3.5 inch backlit color lcd or touch 1. should have multiple infusion modes ( rate mode, weight mode ,time mode, sequence mode) 2. should have 9 occlusion levels 3. should be support syringes of all standard brands 4. should have auto detection of syringe size 5. should compatible with 5, 10, 20, 30 and 50(60)ml syringe 6. built in drug library (100 drugs) 7. should have infusion rate:0.1 2000ml/h,0.01ml/h (0.01ml/h increment till 100 ml/hr , 0.1ml/h increment from 100 1000ml/h and 1ml/h increment from 1000 2000ml/h) 8. should have bolus rate:0.1 2000ml/h 9. should have kvo 0.1 5ml/h 10. backup power for minimum 6 hours (optional 12 hours) 11. quoted item should be usfda/ european ce with 4 digit notified body. 12. bis approved or manufacturer should be iso 13485 certified preferred make: mindray/biocare/dre/byond/ge healthcare/akas/skanray/bpl/dre/braun/fresenius/contec 11 infusion pumps (supply, installation and demonstration) volumetric infusion pump technical specification: flow rate range: 1 to 1000 ml/hr. in normal mode, 1 ml / hr. increment, micro infusion mode: 0.1 to 100ml/hr. with 0.1 ml/hr increment. flow rate accuracy: accuracy of ±2% or better. infusion time: adjustable from 1 minute to 96 hours, 1 minutes increments. setting mode: flow rate, flow rate + volume, volume/time, flow rate +time, ramp up / ramp down, sequential, bolus, induction / loading dose, microinfusion. kvo rate: 3 ml / hr. adjustable pressure limit: 750 mmhg, adjustable from 100 to 900 mmhg (50 mmhg increment) history data log: up to 500 last data events. configuration: infusion mode, key board lock, kvo, pressure limit, display of drug name, time and hour setting, language, lcd contrast, alarm sound level, ward name, secret code, max. allowable flow rate, air bubble size, recall of last parameter on power on, display mode volume accumulating, end of infusion pre alarm setting. should have infusion line disconnection alarm should have infusion line pressure monitoring in mm of hg power supply: power input to be 220 – 240v ac, 50hz fitted with indian plug of appropriate rating battery backup: 3 6 hour quoted item should be usfda/ european ce with 4 digit notified body. bis approved or manufacturer should be iso 13485 certified. warranty: should have 1yrs. of manufacturer warranty. make: mindray/biocare/dre/byond/ge healthcare/niscomed/akas/skanray/bpl/dre/braun/fresenius/contec 12 cardiac table (supply, installation) cardiac table hospital adjustable table hospital table made with mild steel material laminated board top mounted on four 5 cm swivel castors manually adjustable height epoxy powder coated top size: 76(l)*40(w)cm height: 76/106c no 13 blanket phototherapy (supply, installation and demonstration) fibre optic based technology features: spectral irradiance: small pad 70 μw/cm /nm (+/ 25%) and 9 point check large pad 49 μwcm /nm (+/ 25%) and 6 point check wavelength: 460 470 nm fiberoptic lightpad, small : 12 x 30 cm (light emitting area) fiberoptic lightpad, large : 20 x 33 cm (light emitting area 15000 20000 hour led capability safety: no uv/ir/ emission length of fibre bundle: approx 170 cm sound level : <44 db at 1m power rating: 30w device automatically shuts off in the event of light engine over heating. should have complied with european ce 93/42 eec standard certification from a notified body iso 13485 certified preferred make:bilihu/biophoton/neotech/bpl/ibis/phoenix no 14 ambu bag for nicu for providing critical care during cardiopulmonary resuscitation, for patients undergoing endotracheal intubation or surgery under general anesthesia in nicu no 15 laryngoscope set for nicu no 16 diaper weighing machine no 17 baby weighing machine no 18 poc abg machine (supply, installation and demonstration) analyzer should be small lightweight (<1kg) handheld capable of measuring ph, pco2, po2, na+, k+, ca++, cl , glucose, lactate, creatinine/bun & hematocrit. calculated parameters: chb, ctco2, be, beecf, so2, hco3, egfr, a gap, a ado2. all the parameters should be performed simultaneously on a single use disposable test card. fast analysis time of less than 1 minute after sample introduction. analyzer should accept a small sample size of less than 100 μl. input: patient id, age, gender, height, temperature, fio2, sample type. sample types: arterial, venous cord & capillary whole blood. the analyzer should have the provision of storing at least 1000 patient and qc results. should display normal, outside reference range & critical patient results with color coded tiles. the test cartridges should be self contained with all the sensors & reagents and should not be separate. the test cartridges should be room temperature storable without the requirement of refrigeration. the analyzer should be provided with a dedicated wireless thermal printer. the analyzer should use amperometric, potentiometric, and conductometric measurement. the analyzer should have in built barcode readers for expiry control and patient data entry. analyzer should have dual power operation through ac adapter and/or rechargeable li ion battery. analyzer should have on board animation videos for user guidance. should have wireless connectivity facility for his/lis, remote updates etc. should be usfda and ce certified for all products and parameters. preferred make: abbott/siemens/radiometer/edan 19 jaundice meter a simple, effective, portable non invasive jaundice meter quick and easy to obtain bilirubin readings with minimal disturbance to the baby advanced optics and processing for highest accuracy suitable for screening infants from 35 weeks’ gestation power input: 3 vdc( 2aa batteries) measurement range: 0 32mg/dl measurement accuracy: ±1.5 mg/dl operating temperature: +10 to 50 c comliance: en 60601 1 20 vein viewer inbuilt rechargeable battary 3 intensity mode android charger 8 led total( 6 red+2 amber ) iso 9001:2015, iso 13845:2013, gmp, and ce certified 21 embrace warmer (supply, installation and demonstration) 1. the embrace warmer uses an effective phase change material to stabilise rapidly the temperature of an infant suffering from hypothermia. 2. the embrace warmer is light and portable. the baby can be held in the mother’s arms when the warmer is being used. 3. hygienic & durable: it can be reused several times. cleaning is easily done using soap and water. maintains temperature of ~37 degree c for at least 4 hours* (380mm x 220mm, 1.3kg) precision heating mechanism prevents overheating duration of at least 4 hours at ambient temperature greater than 25 c does not require constant power supply approx 15 watt of power consumption preferred make: phoenix/philips/neotech/ge healthcare 22 oxygen hood for nicu (infant use) transparent and curve shaped oxygen hood for neonatal oxygen therapy made with medical grade polycarbonate material. medical grade silicone flaps in the head opening area to adjust the neck size and make sure optimum oxygen concentration. small 21 cm ( diameter ) 16.5 cm ( height ) 12 cm ( neck opening ) medium 21 cm ( diameter ) 19 cm ( height ) 14cm ( neck opening ). accessories to be provided: tubings 01. shapes have enough space for baby head movement. its comes without any sharp corners and easy to clean and disinfect. the manufacturer should be iso 13485 certified. fully autoclavable. make: neotech/vng/david/ibis 23 crashcart crash cart ss frame 304 overall approx size 940mm l x 490 mm w x 1535 mm h stainless steel tubular frameprinciples for no six removable plastic bins & two polystrene lockable storage units with three drawers each four swivel castors, 150 mm dia (two with brakes) complete with corner buffers, oxygen cylinder holder, s s i v rod, s s top & shelves, cardiac massage board ss 304 24 bpc o2 flowmeter with jar usage nicu flow rate 15 l/min display analog tube cover material poly carbonate body material brass accuracy (flow rate) + 3% 25 portable suction machine technical specifications: minimum flow rate: 17 lpm minimum collection capacity: 600 ml make: philips/omron/drive devilbiss healthcare/resmed/niscomed/oxymed/lifeline/rossmax 26 cold light source (supply, installation and demonstration) use: cold light source is used for accessing tiny arteries and veins of the babies should have light intensity controlled with a smooth rotary potentiometer pressing button should have minimum dual control having 2 halogen/xenon/led lamps should have smps based design ensures smooth working of the light source within the voltage variation. dimensions/weight: length280mm, width 220mm, height from the floor:130mm weight up to 5kg heat dissipation heat is disbursed through an exhaust fan (if applicable). portability hand held device power requirements 230vac + 10%, 50 hz operating range: +15°c to 35°c environment storage range: 10°c to 60°c environment humidity: operating range: 15% to 90% rh non condensing storage range : 50% to 90% rh variable intensity : 0 to 100% continues. optical cable: 6mm diameter & 1m length on time: 5min & 10min selectable. display parameters :% of intensity, usage hours & timer alarm indication: fan fail, temperature sensor fail, light source over temperature. preferred make: neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care certifications: quality: iso 13485:2016, electrical safety: iec 60601 1, emc safety: iec 60601 1 2 should complied with european ce 93/42 eec standard certification from a notified body spares: illumination lamps: 2 nos. spares preferred make: neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care 27 dressing trolley with bowl & bucket for use in nicu s.s. frame work s.s. shelves with four side railing on castors size : 76 x 46 x 81 cm 28 instrument trolley ss with 4 wheels overall size 60 l x 45 w x 80 h cms ms tubular construction with ss top & shelf three side guard railing on upper shelf ss 304 29 revolving stool four legs s s tubular construction s s revolving top adjustable height with m s screw mechanism epoxy powder coated30 iv stands i.v. stand, 31 dia 2 hook iv stands wheel mounted on a plastic base with ms pipe , adjustable height from 55” to 95” 31 infant t piece resuscitator (supply, installation and demonstration) can deliver oxygen levels ranging from 21% through to 100%, from a flow meter or blender. the resuscitator has a pip control, as well as a maximum pressure relief valve that prevents the accidental delivery of excessively high pressures. resuscitator should features an accurate, easy to read, medical quality manometer, and can be mounted on a pole, rail, wall, infant warmer, or incubator. manometer range 20 to 80 cmh2o [mbar] manometer accuracy +/ 2.0% of full scale deflection maximum pressure relief @ 7lpm 1 to 66 cmh2o o [mbar](dependent on flow rate) storage range: 40% to 90% rh non condensing operating range: 15% to 90% rh non condensing recommended patient body weight 0 to 10 kg (22 lb) delivered oxygen concentration up to 100% depending on the gas supply operating time* (400 l cylinder) 50 minutes @ 8 l/min components: gas supply line; gas inlet adaptor; test lung; spare max pressure relief quality/test approval quality: iso 13485:2016 device standard: iso 10651 5 iso 10993 mdd product classification: class iib protection against increase of liquid : ipx4 european ce certified preferred make: zeal/fisher& paykel/neotech/ge healthcare/neotech/flexicare 32 oxygen panel and piping (supply, installation and demonstration) minimum 3 oxygen outlet. pipe should be of isi mark. approximate piping lenth: 10 ft pipe thickness must be of 12mm. mox regulator should be there to control the pressure. angle & t copper 33 oxygen cylinder (filled) (supply, installation and demonstration) jumbo type with regulator and trolley 34 syringe pump stand (supply & installation) no. of shelves: 1 shelve 2 saline hook framework material: ss mounted on moveble caster/wheel with electrical socket where 8 syringe pump can be plugged 35 observation trolley soft mattress for comfortable baby laying large working area mattress tilt ±30° on both side provision to take x ray without disturbing the baby 4 nos collapsible acrylic panels with plastic hinges 4” castor 4 nos (2 with brake and 2 without brake) storage tray option underneath the bed 36 hospital child bed 1650x780x630, height adjustable side rail, back rest lifting angle. epoxy powder coated 37 icu bed motorized electric operated five functions motorized hospital bed electrically operated with luxury castors central lockingsize: 2120x1000x460 720mm (lxwxh) • function at back rest, footrest, hi/lo adjustment, forward tilting, backward tilting with cable remote control. • epoxy powder coated bed frame, mounted on central locking luxury castors. • bed board link of soft, pp hiding side rails. quick release handle at back side pillow and mattress 4” thick made of pu foam with one side rexine & other side cotton cloth with food table and bed side locker make: hill rom/stryker/getinge/linet/invacare/paramount/arjo/joerns /drive devilbiss/skytron/steris or equivalent brands having bed production facility of us fda registered. bed to be european ce and facility to be iso 9001, 14001 and 13485 approved 38 icu bed, manual five functions motorized hospital bed manually operated with luxury castors central locking size: 2120x1000x460 720mm (lxwxh) • function at back rest, footrest, hi/lo adjustment, forward tilting, backward tilting with cable remote control. • epoxy powder coated bed frame, mounted on central locking luxury castors. • bed board link of soft, pp hiding side rails. quick release handle at back side pillow and mattress 4” thick made of pu foam with one side rexine & other side cotton cloth with food table and bed side locker make: paramount/arjo/joerns /drive devilbiss/medline /savion/khera/sng/narang/bpl/sigma/acme/prana or equivalent brands 39 glucometer technical specifications for glucometer: measurement range: 20 to 600 mg/dl (1.1 to 33.3 mmol/l) accuracy: ±10% deviation from laboratory reference values sample size: maximum 0.5 microliters of blood per test testing time: maximum 10 seconds memory and data management: minimum memory storage capacity of 500 test results, with data transfer capability to electronic medical record systems or computers display: clear and easy to read display, preferably with a backlit feature for enhanced visibility power source: long lasting battery life, support for disposable batteries and rechargeable options, with low battery status indication make/brands: accu chek (roche)onetouch (lifescan)/dr. morepen/johnson & johnson/omron/ bayer contour/ beurer/abbott /apollo/smart care 40 bp apparatus manual (mercury) iso / ce standard included components adult size cuff with velcro closure , owners manual , mercury fixed ready to use item weight 450.0 grams material type forged number of items 1 size regular special features high accurate readings specific uses for product clinic long lasting heavy duty silicone tubings ce certified , 4.2 mm capillary & hard metal body product should include all the necessory accesorries required for intented use. clear reading make: diamond/romson/dr trust/philips/ge/bpl/omron/rossmax/healthsense/beurer 41 digital bp apparatus manual iso / ce standard included components adult size cuff with velcro closure , owners manual type: upper arm, fully automated display: lcd measurement method: oscillometric method minimum pressure measurement range: 20 mmhg maximum pressure measurement range: 280 mmhg minimum pulse measurement range: 40 beats/min maximum pulse measurement range: 180 beats/min pulse measurement accuracy: +5 pressure measurement accuracy: +3 size regular special features high accurate readings specific uses for product: clinic, training nurses long lasting heavy duty silicone tubings product should include all the necessory accesorries required for intented use. make: dr trust/philips/ge/bpl/omron/rossmax/healthsense/beurer/romson/diamond 42 nibp (non invasive blood pressure) machine: 1. measurement range: 1.1. systolic pressure: 40 260 mmhg 1.2. diastolic pressure: 20 200 mmhg 1.3. mean arterial pressure (map): 30 240 mmhg 2. measurement method: 2.1. non invasive measurement using inflatable cuff 2.2. utilizes oscillometric or auscultatory method 3. accuracy: provides clinically acceptable blood pressure readings 4. cuff size: multiple sizes available for different arm circumferences 5. display: clear display of blood pressure measurements and additional information 6. memory and data management: stores and retrieves previous readings, data transfer capability 7. power source: battery or mains power, battery option for portability brands: omron / philips / ge healthcare / welch allyn / nihon kohden / dräger / mindray / schiller / bpl medical technologies / contec medical systems no 43 stethoscope dual non stick acoustic tubing provides insulation for superior sound included accessories: 2 extra sets comfort seal ear tips, spare adult and pediatric clear pvc diaphragms, pediatric diaphragm assembly, pediatric bell, infant bell and id tag intended use: adult, infant, pediatric approximate weight: 150 250 gm earpieces: earpieces should occlude your ear and block out most or all room noise. they should be comfortable yet snug and should follow the natural forward angle of the ear canals. tubing: the tubing should be sturdy and no longer than absolutely necessary. head: the head of the stethoscope should have a bell (a cup shaped side) and a diaphragm manufacturer is certified for iso 13485 medical devices. brands: littmann/rossmax/romson/healthsense/technocare/omron/mdf no 44 ultrasonic mesh nebulizer machine technical parameters: nebulization technology: ultrasonic mesh for fine aerosol production. medication compatibility: works with a range of medications. particle size: produces small particles for effective inhalation. no silent operation: quiet for patient comfort. battery life: long lasting for portable use. dosing control: precise medication delivery. easy maintenance: simple disassembly and cleaning. portability: compact and lightweight design. user interface: intuitive controls for easy operation. mask compatibility: suitable for various mask sizes. certification: complies with relevant industry standards. make: 1. philips/omron/dr. morepen/rossmax/agaro/healthsense/bpl/beurer/dr. trust 45 nebulizer for nicu particle size: fine aerosol particles for neonatal inhalation. medication compatibility: suitable for various nicu medications. silent operation: quiet operation for infant comfort. dosing accuracy: precise medication delivery control. continuous nebulization: capable of extended treatment. oxygen compatibility: accommodates oxygen therapy. user interface: intuitive controls for easy use. safety features: prevents overmedication risks. compact design: space efficient for nicu placement. easy maintenance: disassembles for cleaning. mask compatibility: fits neonatal masks. certification: iso compliant manufacturing. make: 1. philips/omron/dr. morepen/rossmax/agaro/healthsense/bpl/beurer/dr. trust 46 oxygen concentrator (supply, installation and demonstration): for use in nicu oxygen concentrator 5 lpm: flow rate: 5 liters per minute oxygen purity: typically around 93% (+/ 3%) power source: electric (ac) weight: standard range, usually between 14 to 18 kg dimensions: compact and portable design noise level: low decibel range for quiet operation filters: built in air intake filters for clean air supply oxygen delivery: continuous flow mode user interface: intuitive controls and lcd display alarms: visual and audible alarms for low oxygen concentration and power failure accessories: nasal cannula, humidifier bottle, filter replacements compliance: designed for medical use and regulatory compliance make: philips/devilbiss/nidek/inogen/oxymed/airsep 47 12 channel ecg machine with monitor and electrodes technical parameters: channels: 12 simultaneous channels for comprehensive cardiac monitoring. electrodes: high quality electrodes for accurate signal acquisition. display: clear display of 12 lead ecg data for real time analysis. printing:high resolution printing for detailed ecg reports. sampling rate: high sampling rate for precise waveform capture. interpretation: built in ecg interpretation algorithms for efficient analysis. filters: signal filters to eliminate interference and ensure accuracy. recording speed: adjustable recording speeds for various assessments. connectivity: usb or bluetooth connectivity for data transfer. battery backup: reliable battery backup for uninterrupted operation. make: ge healthcare/philips/schiller/bpl/nihon kohden/edan instruments/mindray/cardiac science/contec 48 steriliser make: goley / surya or equivalent 49 spring balance medical spring balance technical specifications: wide measurement range high accuracy durable construction clear display tare function overload protection portable design easy calibration no 50 intrauterine device (iud) thats inserted into the uterus for long term birth control (contraception). t shaped plastic frame has copper wire coiled around the stem and two copper sleeves along the arms that continuously release copper to bathe the lining of the uterus. it produces an inflammatory reaction in the uterus that is toxic to sperm, which helps prevent fertilization. no 51 pelvimeter pelvimeter technical specifications: material: high quality medical grade materials measurement range: suitable for various pelvic measurements accuracy: precise measurement graduations easy to read scale lightweight and portable design ergonomic handle for comfortable use durable and long lasting construction suitable for clinical and educational use no 52 delivery couch technical specifications: convertible design: easily converts into operating table for emergency caesarian section adjustable backrest for patient comfort removable headboard for versatility leg supports for secure positioning removable foot section for accessibility height adjustable: minimum 60 cm, maximum 90 cm smooth mobility: equipped with diagonally lockable 12 cm diameter castors corner bumpers for protection removable drain pan for easy cleaning no 53 foetal dopler ultrasound frequency: 3mhz ultrasound intensity: <10mw/cm2 power supply: alkalinity battery display: 45mm×25mm lcd fhr measuring range: 50~240bpm fhr resolution: 1bpm fhr accuracy: ±1bpm power consumption: <1w dimension :135mm ×95mm ×35mm weight:500g configuration: main body 3mhz probe feature table: functions: display b/w backlight:yes build in speaker : yes battery indicator:yes fhr display: yes auto power off: yes various work modes :yes alkalinity battery:yes make: life line / bpl/dipel/phillips/ sonoline/angelsounds/huntleigh/bistos/contec or equivalent no 54 automatic hematology analyzer: specifications: measurement parameters: complete blood count (cbc): hemoglobin, hematocrit, red blood cells (rbc), white blood cells (wbc), platelet count, mean corpuscular volume (mcv), mean corpuscular hemoglobin (mch), mean corpuscular hemoglobin concentration (mchc), red cell distribution width (rdw), and other relevant parameters. differential blood count: neutrophils, lymphocytes, monocytes, eosinophils, basophils, and other relevant subtypes. throughput: high throughput capacity capable of processing a large number of samples per hour, ideal for high volume laboratories and hospitals. sample types: accepts various sample types, including whole blood, serum, plasma, and diluted samples. sample volume: minimal sample volume required for analysis to minimize patient discomfort and conserve sample volume. automation: fully automated operation for sample handling, analysis, and result generation. automated sample identification and barcode scanning for sample tracking and data integrity. analysis method: utilizes advanced impedance or flow cytometry technology for accurate and reliable blood cell analysis. may noinclude laser based optical systems for specific measurements. user interface: intuitive and user friendly graphical interface for easy operation and navigation. touchscreen display with clear visualization of data and results. connectivity: built in connectivity options such as ethernet, usb, and lis (laboratory information system) integration for data transfer, result reporting, and remote access. quality control: integrated quality control features to ensure accuracy and precision of results. calibration options and automated quality control checks to maintain instrument performance. maintenance: self diagnostic capabilities for proactive maintenance and troubleshooting. automated cleaning and maintenance routines to ensure instrument reliability and longevity. size and weight: compact and space saving design suitable for laboratory environments. portable options available for on site or point of care testing. power requirements: operates on standard electrical power supply (e.g., 110 240v, 50 60hz). compliance: meets relevant regulatory standards and certifications (fda, ce, iso). make: sysmex corporation/beckman coulter inc./siemens healthineers/abbott laboratories/mindray medical international limited/roche diagnostics/horiba medical/nihon kohden corporation/boule diagnostics /erba/bio rad 55 laryngoscope sets, s.s. (with s.s. handle) satin / dull finish, with 4 s.s. blades size: 1,2,3 & 4 56 nasal cannula delivers:24 30% oxygen, flow rate :1 4l/min, manufactured from soft, non toxic medical grade material, made up of kink resistant pvc tube 57 high flow nasal cannula deliver:21 100% oxygen, flow rate: upto 60l/min, manufactured from soft, non toxic medical grade material, made up of kink resistant pvc tube 58 venturi mask delivers: 24 60% oxygen, flow rate: 2 15l/min, tube length 7 ft, manufactured from soft, non toxic medical grade material, 100% latex free 59 non rebreather mask delivers: 85 90% oxygen, flow rate: 10 15l/min, bag on mask with valves stopping almost all rebreathing of expired air, manufactured from non toxic medical grade material 60 face mask delivers: 40 60% oxygen, flow rate: 05 10l/min, manufactured from non toxic medical grade material 61 digital haemoglobinometer photometry based system for estimation of haemoglobin. 2 linearity range 2g/dl to 25 g/dl or beyond.. 3 open reagent system.. 4 led light source. 5 display of results in g/dl. 6 connectivity to pc and printer. 7 accessories to be supplied: along with equipment a micro pipette 2.5 ml : 1 no. b lancing device 1 unit c lancettes : 50 nos d cuvettes with rubber caps – 5 nos e capillaries – 50 nos make: labtronics/ekf/mission/accu/accon...

Department of Higher Education - Jharkhand

39035059 bids are invited for as per tender ( q3 ) wooden lab stools safety footwear as per is 15298 ( part 2 ) dental lab micromotor seed germinator equipment mobile food testing lab hot air oven lab multi sample mixer muffle furnace liquid lab wash detergent iv sets transfusion and infusion equipments total quantity : 1...

Urban Development And Housing Department - Jharkhand

38999094 bids are invited for chair for patient waiting area 3 seater , office chair movable , office chair , office table , steel almirah , steel rack , stool for attandent , refrigerator 180 ltr , weight adult 125kg , inverter with battery 220 mah , bio metric set , boul medium size , b p apparatus digital , b p apparatus manual , stethoscope , heamoblobin test kit , glucometer test with all accesary equipment , flash light tourch box type pre focuses , clinical thermometer oral , dressing drum with cover point945 liter s s , dressing drum , surgical scissors straight 140 mm total quantity : 39...

Urban Development Department - Jharkhand

38982841 rate contract for supply of basic equipments, furniture, and various items for one year doctor chair standard + normal chairs doctor table size 64 staff nurse table 4 3 staff nurse chair ( medium ) plastic chair patient steel stool ( revolving ) table ( mpw ) size 3*2 chair for mpw ( medium ) four step reck for medicine three seater chair for waiting area patient bed foot step examination table almirah stethoscope bp instrument weight machine child+adult h.b meter h.b meter strip digital thermometer kidney tray dressing tray needle holder vision chart oxygen cylinder with trolly torch pencil battery remote battery iv stand glucometer glucometer strip medicine tray opd register thermometer nebulizer foetal doppler needle cutter r.s. scissors dressing drum 9x9 dressing tray 10x12 vaginal speculum inside cath 18 intra cath 22 intra cath 24 iv set saline rl saline dns saline ns saline d5% pillow cover pillow bed sheet medicine rack ( 8*6 ) register 8 no. register 10 no. pen scale stapler whitener punch machine scissors file a4 size paper gum big size paper weight dustbin blue dustbin black dustbin red broom mops duster doormat lock and key attendance register stapler pin bucket mug fire extinguisher hand towel bed sheet curtain lock and key link bucket plastic mug hand wash floor mop by matt dustpan harpic large towel hand towel curtain small curtain big green sheet colin phenyl 5 ltr. dusting cloth detergent powder soap toilet cleaning brush full jhadu nariyal jhadu plastic jhadu basin dhone wala ( scrubber ) room freshener hand sanitizer table cloth wall clock dust bin scale big admission register carbon stock register highlight pen sketch pen xerox paper a4 size air conditioner fridge water purifier inverter battery 150a battery 200a battery 220a battery 250a tv 21...

Ferro Scrap Nigam Limited - Jharkhand

38936957 tender for routing medical check up => limited c.b.c.; urine analysis; stool test; fast blood sugar & pp; se. cholesterol; blood urea; x ray ( chest, or as may be advised ) ; eye testing; ecg; total rate ( rs. ) of sl. no. ( 1 ) + ( 9 ) ; gst @ ___% extra on sl. no. ( 10 ) ; total rate with gst of sl. no. ( 10 ) + ( 11 ) ;...

Military Engineer Services - Jharkhand

38932164 provision of furniture for certain centres at ramgarh , schedule a ( steel furniture ) , charpoy ip hard top ( fd / map ii / 01 ) , locker bed side steel ( fd 1029 ) , stool steel ( fd 81m ) ...

Urban Development And Housing Department - Jharkhand

38762856 bids are invited for chair for patient waiting area 3 seater ( q3 ) , office chair ( movable ) ( q3 ) , office chair ( q3 ) , office table ( q3 ) , fire extinguisher ( q3 ) , steel almirah ( q3 ) , steel rack ( q3 ) , stool for attendants ( q3 ) , refrigerator ( 180 ltr ) ( q3 ) , wall clock ( q3 ) , bio metric machine ( q3 ) , weight scale ( adult ) 125kb280lbs ( q3 ) , weight scale ( infant ) 10kg ( q3 ) , weight scale baby hanging type 5 kg ( q3 ) , inverter with battery 220 mah ( q3 ) total quantity : 37...