Urban Development And Housing Department - Jharkhand

39880035 bids are invited for weighing machine lock register bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , iv stand , scessior medium , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register book , pillow , pillow cover , door mat , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , water bottle 1 ltr. , tiolet cleaning brush , led tube light , led bulb t shape , aebas fingerprint scanner device total quantity : 1140...

Health Medical Education And Family Welfare Department - Jharkhand

39739577 bids are invited for thermometer digital , weighing machine digital adult , baby weighing scale elect , hight measuring tape , hb meter digital , hb strip , lancet needle , cotton swab , digital glucometer , glucose strip , urostrip 2p , maleriya test kit , pregnancy test kit , puls oxymeter , muac tape , stethoscope , dial b p machine , tab calcium d3 , tab paracitamol 500 mg , syrup paracitamol , tab cetrizine 10 mg , syrup cetrizine , tab cefxime , syp cefxime , norfloxacine eye drop , metronindazole 400 tab , metronindazole syp , syrup anti spasmodic , tab pantaprazole , syp cough , capsule doxycyline , tab domperidon , syp domperidon , inj diclofanic , tab diclofanic , tab metformin , tab amlodepin , ors powder , ifa tab , ifa syp total quantity : 36640...

Department Of Health And Family Welfare - Jharkhand

39709262 bids are invited for nicu picu equipments bp cuffs infant , bp cuffs child , aneroid bp instrument , pediatric stethoscope , ambu bag or resuscitator bag adult , ambu bag child , laryngoscopr pediatric , weighing scle adult , manual defibrilator , crash trolley , nebulizer , digital thermometer total quantity : 141...

Urban Development Department - Jharkhand

39617738 bids are invited for weighing machine lock register bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , iv stand , scessior medium , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register book , pillow , pillow cover , door mat , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , water bottle 1 ltr. , tiolet cleaning brush , led tube light , led bulb t shape , aebas fingerprint scanner device total quantity : 1140...

Health Department - Jharkhand

39485354 supply for office stationery, equipments etc. , items names : , executive chair , revolving chair , study chair , office table , almirah ( for office use ) , glass almirah , journal rack , computer table , dinning table set ( 1 table + 6 chairs ) , dinning table , lab table , examination table , stool steel chair , bed side locker , single bed ( for hostel ) ( double decker ) , almirah , chair , table , needleholder : , 6 , 7 , 8 , suture cuttingscissors , sutureneedle : , straight , curved , mackintosh roll : , full bed length ( qtyin meters ) , draw mackintosh , extra for treatment and dressing , hot water bag , ice caps , ice collar , corrugated rubber sheet , gloves different sizes , catheters : , urinary catheters , foleys catheters , nasal catheters , plain catheters , rectal catheters , finger stalls different sizes ( set ) , air rings , mucus sucker , breast pump , nipple shield , gastric lavage tube , ryles tube , flatus tube , blakemore sange staken tube , rubber tubes with different diameter and size , rectale syringe with nozzle , ring pressories each size , douche nozzle different sizes , mortar and pestle , nelsons inhaler , spirit lamp , test tube stand , test tube holder ( in dozen ) , sterilizer small , portable autoclave , weighing scales , adult weighing scale , baby weighing scale , back rest , splints different sizes , i. v .stand , microscopes , sphygmomanometer ( mercury ) , a regular ( dial ) , b electronic ( digital ) , stethoscope , over bed table ( cardiac table ) , screens / bed side curtains , three way adapter , mattress: , adult , child , mattress cover: , adult , child , bed sheets , baby cot sheets , draw sheets , sandbags with covers , sponge cloth , hot water bag covers , ice cap covers , air ring / cushion covers , gowns masks , patient s clothes: , male ( set ) , female ( set ) , baby dresses of different sizes ( set ) , diapers different sizes ( set ) , trolley cover , dirty linen bag / box , leggings ( pair ) , perineal sheets , triangular bandages , many tailed bandages , eye shields , dusters , slings , t binder , screen curtains ( set ) , adult human articulated skekelton with hanging facility in a glass cupboard with locking facility. , full set of dis articulated human skeleton. , full size human body showing all muscles and articals , human torso : , male , female , skin cross section , heart and large blood vessels , heart with detachable parts on a stand , eye with different sections , ear with different sections , human brain with spinal cord , lungs and trachea , larynx , digestive system: , stomach , female reproductive system: , uterus on stand , male reproductive system , urinary system: , kidney: , joints and ligaments: , wrist , elbow , shoulder , ankle , knee , hip , teeth , skeleton system , muscular system: , showing different muscles of the body , joints and ligaments: , nervous system: , brain , cardio vascular system , respiratory system , lungs , trachea , larynx , digestive system , oral cavity , teeth , stomach pancreas and spleen , small intestine , large intestine , liver and gallbladder , kidney macroscopic structure , skin , eye , ear , female reproductive system , menstrual cycle , male reproductive system , endocrine glands , first aid for burns , cardiac pulmonary resuscitation: , adult , children , infant , first aid charts or emergencies such as fracture, drowning, wounds, poisoning, bites ( each ) , stages of development of embryo ( set ) , female bony pelvis , foetal skull , female dummy ( zoe model ) / obstetrical training with doll , placenta , full size fetus , new born baby , baby cradle , breast changes in pregnancy , uterine changes in pregnancy showing height of uterus at different terms of pregnancy , stages of labour , first stage , second stage , third stage , breech presentation , complete breech , incomplete breech , foot presentation , shoulder presentation , face presentation , brow presentation , twin pregnancy , placenta previa different stages , caput succedaneum, cephalhaematoma , congenital malformation of new born: , cleft lip palate , spina bifida , hydrocephalus , anencephalus , all in one computer set , laptop , xerox machine , color printer , air conditioner , lcd projecter , lcd screen , over head projecter , community health nursing for anm , community health nursing for anm ( hindi ) , health worker keliyepathyapustak , community health nursing ( samudayikswasthvigyan ) ( hindi ) , nursing manual of nutrition and therapeutic diet , essentials community health nursing in hindi , where there is no doctor a village health care handbook , where there is no doctor hindi , mecical surgical nursing , fundamentals of nursing , principal & practice of nursing , health promotion for anm , aaharavumposhan , text book of anatomy & physiology for nurses , anatomy & physiology anotomy and physiology for nurses ( sharirrachanavigyanevamsharirkriyavigyankewalnursonke live ) ( hindi ) , prathamiksahayataevamsankatkalindekhbbal ( hindi ) first aid and emergency care , manual of first aid ( prathamikupcharka manual ) ( hindi ) , health promotion , nurse keliyemanovigyanavumswasthya , psychiatric meantal health nursing , text book of microbiology for nurses , sukhamjivvigyankipathyapustak ( text book for microbiology for nurses ) ( hindi ) , primary health care nursing for anm , psychology and sociology for anm and bt students , nursing arts proceduces ( nursing kemoolsidhanth ) valume i ( hindi ) , fundamentals of nursing ( hindi ) , senior nursing procedure ( nursing kemoolsidhant volume ii ( hindi ) , sociology for nurses , pharmacology for nurses , medicine kipathyapustak , baal swasthya nursing for anm , child health nursing for anm ( hindi ) , quick look nursing pathophysiology , comprehensive manual of pediatric nursing procedures , pediatric nursing , english for nursing , textbook of computer in nursing , textbook of obstetrics , midwifery & gynecological nursing ( hindi ) , maternal & neonatal nursing care plans , midwifery for anm , midwifery and gynecological , nursing ( hindi ) , manual of midwifery procedures , pedicatric nursing care plans , cumulative record for general nursing midwifery course , health centre management , imnci module for basic health worker , chart booklet , simplified partograth ( big size ) , family planning , journal of midwifery, women health &gynaecological nursing. , journal of community & social health nursing , patient cots adult , child , bed side locker , revolving stools / chair , manikins for demonstrating nursing procedure: , adult male imported , adult female , child manikin , new born , cpr ( full body ) , trays different sizes: , 24x16 , 14x10 , 11x9 , 8x5 , trays with cover assorted sizes , bowls: , 16diameter , 10diameter , 4diameter , 2 3diameter , bowls with cover , 6diameter , 4diameter , enema can , 1 1t. capacity , 1 / 2 1t. capacity , kidney trays of assorted sizes ( big ) , measuring jugs , 1000 ml. , 500 ml. , 250 ml. , assorted size basins , catheter dish with cover , knife dish with cover , feeding cups , douche can , sputum mugs , bed pans , urinals male , funnel: , 4diameter , 2diameter , jars with covers: , 12x8 , 6x4 , dressing drums: , 8x4 , 12x9 , tub for sitz bath , saucepan with lid: , 1 1t. capacity , 2 1t. capacity , kettle: , 1 1t. capacity , 2 1t. capacity , trolleys with upper and lower shelves ( without steel top ) , pint measure , gallipots , mugs , bottle brush , cheatle forceps , sponge holding forceps , artery clamps: , straight 6 , curved6 , dissecting forceps: , toothed , non toothed , mosquito forceps , kocher’s , scissors: , surgical 8 , bandage , mayos cutting scissors , tissue forceps , sinus forceps , biopsy forceps , liver biopsy needle , alice forceps , probe , groove director with probe , mouth gag , tongue depressor , tongue holding forceps , nasal speculum , aural speculum , re tractors: , single hook , double hook , bladder sound , male urethral dilator ( set ) , packing forceps: , nasal , oral , ear irrigation syringe , ear speculum , shaving set , safety razor with blades , bard parker knife handle , surgical blades different sizes set ) , catheters , airway , laryngoscope: , paediatric , adult , proctoscope , infusion set , autoscope , ophthalmoscope , tracheostomy set with various size of tracheal tubes ( set ) , head mirror , tanning fork , oxygen cylinder with stand , oxygen mask , measuring cups: , 240ml. , 120 ml. , 30 ml. , undine , eyebath cup , pipettes & droppers , glass connection: different types e.g. y.t.l. ( each ) , wolfs bottle , conical flasks , ounce glass , dram glass , thermometers : , oral , rectal , bath , room , lotion , pulse meter , urinometer , lactometer , heamoglobinometer , specimen glasses , test tubes ( dozen ) , glass slides with cover ( box ) , bottels500 ml. capacity for lotion and mixtures , automizer , manometer , glucometer , head mirror , tuberculin syringe , insulin syringe with needle , needle all sizes ( one dozen each ) , lumbar puncture needle , trochar, cannula for abdominal paracentesis , i.v. cannula different type sand sizes , biopsy needle : , adult , children...

Health Department - Jharkhand

39468446 supply for materials supply for materials and medical equipments , equipments name: , hospital seat bed , semi flower bed with ms side rail , flower bed with ms side rail , hospital i.c.u bed , hospital bed matress , hospital pellow , hospital sline stend , hospital bed side locker , hospital 3 fold screen , hospital strecture on trolly , pediatric bed , pediatric flower bed , ecg machine computerized , ventilators ( adult ) , pulse oxymeter , a.c1.5 ton 5 star with fitting , a.c 2ton 5 star with fitting , stabilizer automatic for ac double phase 5 kva , stabilizer automatic for ac double phase 3 kva , b.p apparatus stand model (isi mark) , stehoscope (isi mark ) , thermometer ( isi mark) , ecg paper roll cardiart gen x 3 cardiart 6208 view , suction machine , foetal doppler ( pocket doppler ) , foetal doppler ( tabple top ) , r o water machine , autocalve double drum , kidney tray big , curve kocher clamp , iv set ( adult ) , uro bag , sanitary pads , focus light , plastic apron , shoe cover , disposable cap , rubber sheet , eb x49 xga projector brightness: 3600lm with hdmi port (optional wi fi) , dustbin with lid 30 ltr. , hub cutters ( mannual ) , hub cutters ( electric ) , water container ( steel 20 ltr) , stools for immunization room (steel ) , torch light 4 cell , air rotor , bed pan (ss) , coolers big (isi mark) , table cloth , double door 308 litres 5 star refrigerator , 205 l direct cool single door 5 star refrigerator , chromic catgut 1/0no , chromic catgut 2/0no , chromic catgut 3/0 no , shadoless cellar light led , mersilk 1/0 no , mersilk 2/0 no , surgical instrument set , foelys cather 14 no , foelys cather 8 no , foelys cather 10 no , foelys cather 16 no , foelys cather 18 no , disposable syringe 3 ml , disposable syringe 10ml , disposable syringe 5 ml , disposable syringe 20 ml , b.p blade ( 15 no. ) , b.p blade ( 20 no. ) , b.p blade ( 22 no. ) , spinal needle 25 no , skin hook single , skin hook double , foreign body remover , foreign body extractor , needle holder ( big) 9’’ , needle holder ( small ) 6’’ , tooth forceps , plainforceps , scissors mayo’s ( 7’’ & 9’’) , scissors ( suture cutting ( 7’’ & 9’’) ) , b.p handle no 3 , b.p handle no 4 , surgical spirit 500 ml , scissors 8’’ , pen elkos first , handi palast ( round ) , lifter , intrument sterliser ( electric ) small , intrument sterliser ( electric ) medium , intrument sterliser ( electric ) large , arteriforcep medium straight , arteriforcep medium curve , arteriforcep large , elices forceps , niddle holder 8’’ , abdominal retracter small , abdominal retracter medium , abdominal retracter large , doins retracter , bone lever small , bone lever large , bone holdinyforcep small , bone holder forcep large , periostium elevator , pop 50 kg drum , towel clip , k wire1 , k wire1.5 , k wire2 , ss – wire 20 , ss – wire 22 , ss – wire 24 , k – nail all size , v – nail , sq – nail , cotton roll 400gm nett. , cotton roll 100gm nett. , kit kath 16 no , kit kath 18 no , kit kath 20 no , kit kath 22 no , kit kath 24 no , bandage 6 inch , bandage 4 inch , gauze than , green cloth , cotton bed sheet , blanket ( 4x 6 )2.5 kg , blanket ( 4x 6 )3 kg , carpet ( dari )( 30/ 30) , bp instrument electronic chargeable , glucose meter (isi mark) , hemoglobin test machine , stethoscope (isi mark) , thermometer genral , x ray view box large size , pulse oximeter , blood bag ( singal ) hl , hiv rapid card aspen , hbsag papid card aspen , hcv rapid card aspen , para hit total (mp) , r.p.r test card aspen , r.p.r test strip aspen , blood group kit (abd) arkary , anti ab arkray , anti human globulin arkray , 22% bovine albumin arkray , hiv elisa kit , hbsag elisa kit , hcvelisa kit , hiv rapid card retroquik , hbsag rapid card hepaview , hcv rapid flaviscreen , refrigerator digital thermometer , blood bag collection monitor , glass slide blue star , distilled wateer , sodium hypochlorite solution. , khan/khans test tube borosil , copper sulphate crystal , lancetblood , dobule cap e.d.t.a tube , khan/khans test tube stand 60 hole plastic , colorimeter , digital weight machine baby , digital adult weight machine , b.p machine ( mercury ) , elisa processor transasia elan 30 s , pumping ball/smiley ball , electric insects killer , elisa reader , elisa washer , autoclave electric vertical( pressur & temp display) , blood bag tube sealer , drabkins reagent , measuring cylinder 50ml , hydrometer ( specific gravity ) , pippet stand , cuvette ( for colorimeter) , needle destroyer ( electric ) , blood bag storage refrigerator , blood bag storage refrigerator thermofisher 650 ltr. , hydrogen peroxide 500 ml , hydrogen peroxide 100 ml , ec( 500 ml ) , stirrup pump ( ddt spray machine ) , cotton roll 25 gm nett. , cotton rol l 50 gm nett. , cotton roll 200 gm nett. , cotton roll 400 gm nett. , crepe bandage 6’’ , crepe bandage 4’’ , office table t9with two drawer , examination table , office table t104( three drawer ) , office table t8both side drawer , patient stool revolvingtable , impres table 1800mm , premium visitor chair with full arm , chair ch7b , laseda high back chair , sedna high back chair , bandage 6 , bandage 4 , revolving chair with arm , barvo high back chair , computer table c3d , strowel plain (almira 20 gauge )7’’/3.5’’ , strowel plain (almira 20 gauge )4’’/3.5’’ , steel rack 6’’/3’’ ( 5 rack ) , mattrics 3 seeter chair with arm , mosquito net small , mosquito net medium , mosquito net large , xerox machine (mp 2014) , didital ups eb 1650 ah inverter with inva tubular battery 220 ah , computer i3/11 gen/ 8 gb ram / 512 gb ssd rom/ windows 11/20” display/web came , • printers • laser printer • m438nda laserjet a3 monochrome all in one printer with network, duplex & adf , scannerlide 120 , coolers big ( isi mark ) , pillows covers , pillows , wire cutter , digital x ray machine 100ma , pen drive 32gb(hp) , pen drive 16gb(hp) , floor duster with handle , plastic chiar , epson ecotank m3170 wi fi all in one monochrome ink tank printer ith adf & duplex , computer table , office table size 4ft x 2.5ft double drawers , office table size 3ft x 2ft single drawers , laptop core i5 12th gen. 8gb ram, 1tb/ssd hard disk/ 2gb graphics, windos 11 , 3.8% sodium citrate solution 500 ml , abo & rh(anti ab&d) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent gauze than 18 m x 90 cm special , adenosine , airway 0 no. , airway 1 no. , airway 2 no. , airway 3 no. , airway 4 no. , ambu bag adult , ambu bag pediatric , ambu bag neonatal , apron , aso latex (span) (20 pcs) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , baby cap , baby dress , baby socks , baby tag , barium chlorine 500 ml , bendicts solution 500 ml , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blood bag350 ml , blood bag 100 ml , botroclot 10ml , bovine albumin 22% (5 ml) , bt set , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 24 no , cannula 26 no , capillary tube , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , cleansole , color coded bins black 20 litre , color coded bins black 40 litre , color coded bins black 60 litre , color coded bins black 80 litre , color coded bins blue 20 litre , color coded bins blue 40 litre , color coded bins blue 60 litre , color coded bins blue 80 litre , color coded bins red 20 litre , color coded bins red 40 litre , color coded bins red 60 litre , color coded bins red 80 litre , color coded bins yellow 20 litre , color coded bins yellow 40 litre , color coded bins yellow 60 litre , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , lam/i gel 01234 , lancet (100 pcs) , leishmans stain (500 ml) , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malaria pf/pv antibody card rapid test (50 kits) , malaria pf/pv antigen card rapid test (30 kits) , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , memantine , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micropore 1 inch , micropore 1/2 , micropore 2 , mucus sucker , iron bed , mattress 3x6 , foot step , dustbin plan , hydraulic bed , bucket , bed side screen , test tube (khan tube) , test tube (khan tube) 2.5 3 ml , test tube (khan tube) 3 4ml , test tube holding clamp , test tube rack , thiopentone , thrombophob ointment , tissue paper roll , tourniquet , color coded bins yellow 80 litre , cord clamp , cotton roll 400gm nett , cotton thread , cover glass (100 pcs) , cpr (latex) (20 pcs) , creatinine(creast) (35 pcs) , crescent blade disposable , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1ltr , distilled water 5ltr , donepezil , duolin respules , ec (700 ml) (agrawal) , ecg jelly , edta vial , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , enoxaparin , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , g.v. paint lotion 400ml , glacial acetic acid (500 ml) , glass slide (100 pcs) , gloass rod , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer strip , glucometer (ozocheck) , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hbsag card rapid test kit (50 pcs) , hcv rapid (30 kits) , heavy duty gloves , hiv card rapid test (50 kits) , nasal prongs (neonats) (cannula) , needle straight , new born diaper , oxygen mask adult , oxygen mask child , paraffin mesh , pedia set , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial , pottasium permagnate (400gm) , povidone iodine lotion 500ml , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pyrethrum extract 2% , rhyles tube16 no. , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , saline set , shoe cover disposable , side port disposable , slide dying rack , sodium calcium hypochloride (5 litre) , spirit 100 ml , spirit 1000 ml , spirit (methylated) 1000ml , sprit lamp , stritching thread , suction catheter , suction tube6fr , suction tube 8 fr , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , uro bag , vdrl (strip) , vdrl (syphilis) card rapid test (100pcs) , vdrl rapid card , vdrl rapid latex , vicryl(1 0) , vicryl1no , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl (2 0) , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , yellow tips for micropipette , temophos 25 ltr , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , swab , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , towel (24x18) , plastic mug 1 ltr , plastic bucket 20 ltr , anteseptic soap 75 gm , plastic sputum container with sticker , lence paper , potasium per magnate , zipper pouch , falcun tube , oxygen regulator with flow meter , non chlorinated biohazard bags black size 80kg , non chlorinated biohazard bags blue size 80kg , non chlorinated biohazard bags red size 80kg , non chlorinated biohazard bags yellow size 80kg , non chlorinated biohazard bags black size 2litre , non chlorinated biohazard bags red size 2litre , non chlorinated biohazard bags black size 40kg , non chlorinated biohazard bags blue size 40kg , non chlorinated biohazard bags red size 40kg , non chlorinated biohazard bags yellow size 40kg , hemogllobin test kit , hemogllobin test strips , lancet , glucometer , glucometer strips rate per pc , urine strips , hiv and syphilis test kit , hiv test kit , syphilis test kit , sickle cell rapid test kit , iodine test kit , hbsag test kit , filariasis test kit , malaria test kit , sanitary pad , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , oxygen cylinder small , oxygen cylinder medium , oxygen cylinder large , tubular battery 220 ah , ambu bag , eletric automatic unicron demmart star dental chair , dental x ray machine , vatech rvg sensor , desktop & color printer , dentail air compresor , auto clave , ultrasonic scalerhand pic walldent , waldent digital glass bed sterlizer , gdc extraction forcep kit set of 12 , gdc root elevator set kit10 , local anesthesia with aderenaline , dental micro moter with straight contra hand pic , walldent pro dental set 15 , mask , waldent dental lead appron , dental patient drape , gdc surgical curettee 3 (186) , air rotor handpic 2 lead (nsk) dyna , type 1 glass ionomer restorative , type 2 glass iconomer restrative , waldent composite kit , ewaldent eco plus light curring unity 2 , waldent endomeeter hand pic esw 2 , super endogald hand portopear file ( pack og of ) , waldeent flexgald rotry file 21 mm 25 mm , waldeent h hand file gald rotry 21 mm 25 mm , waldent e dta gutta percha paint 6% , waldent seal pexrin baid roat camal sealing matrial , raund barrel , stat barrel , farama cresal , calsium hydroxide podear 10 , saliva ejector , un chamber with 12 tray , gownpreparatior kit , endo2 bur , flish box , dj 16 , k hhand file , k file 6 to 15 , k file 8 to 15 , micro tourch & gas , skin mirar , mouth mirror , dental probe , dental twerer , dental cement carrier , steel visitor chair , transmittance / absorbance photometry based digital haemoglobinometer with auto / self calibration (no manual code / chip insertion) and 0 25gm/dl , strips / cuvette compatible with above digital haemoglobinometer , fad gdh enzyme based glucometer strips (1 glucometer free on 1,000 strips) , boronate affinity chromatography method based hba1c glycated haemoglobin analyzer with inbuilt bluetooth for wireless data transfer, in built rechargeable battery and weight less than 100g , strips compatible with above hba1c glycated haemoglobin analyzer , reflectance photometry based lipid analyzer for measuring tc, hdl, tg, ldl & tc / hdl ratio and inbuilt bluetooth for wireless data transfer , strips compatible with above lipid analyzer , auto disable / safety lancet (28g) with ec declaration of conformity / usfda & iso 13485:2016 , nt probnp rapid card , vitamin d rapid card , troponin i rapid card , troponin t rapid card , point of care device for hemoglobinopathies (sickle cell &? thalassemia) testing , point of care rapid test kit for sickle cell anaemia and beta thalassemia screening compatible with above device , portable automated abrneonatal hearing screeningdevice : based onbrainstem evoked response audiometry (bera) method batteryoperated device high sensitivity and specificity (more than 97%) test time: less than 5 minutes usb port and wi fi enabled non invasive and easy to use easy interpretable report: pass, refer and redo as the result validated and recommended by icmr (indian council of medical research) & department of health research (dhr) ministry of health,government of india...

Health Department - Jharkhand

39447878 purchase of items for hwcs purchase items for hwcs , functional refrigerator 195 ltr. , boiler or autoclave small size , dressing drum with lid , mattress , kellys pads , torch / torch box type pre focused ( 4 cell ) , examination lamp , wall clock with all hands , iv stand , sunction machine electric / foot operated suction apparatus , oxygen cylinder with troly , oxygen set ( mask with tubing ) , bp apparatus , adult stethoscope , fetoscope / doppler , basin 825 ml ss , hub cutter , needle destroyer , digital thermometer , gauze cutting scissor stratight , weighing machine ( infant ) , weighing machine ( adult ) , thermometer rectal , dental probe , nebulizer , measuring tape , tallquist hb scale , snellen vision chart , near vision chart , stadiometer ( height measurement ) , sims retractor / depressor , kellys heamostat forceps straight 140 mms , vulsellum uterine forceps curved 25.5 cm , cusco’s / graves speculum vaginal bi valve small, , cusco’s / graves speculum vaginal bi valve medium , cusco’s / graves speculum vaginal bi valve large , plain forceps , tongue depressor , mouth gag , dental probe , mouth mirror , cheatle forceps , dressing tray with lid , suturing tray with lid ss small , suring needle curved , suturing thread , round slit ( hole ) towel , ambu bag , mask neonatal size ( 0 ) , mask neonatal size ( 1 ) , baby weighing scale , new born thermometer , oxygen hood ( neonatal ) , designated new born tray ss with lid , ss tray with cover , scissors , artery forceps , sims speculum veginal double ended iss mediam , cord cutting scissor / surgical blade for cutting cord , bowl for antiseptic solution , kidney tray ( small ) , kidney tray ( big ) , episiotomy scissor , allis forceps , toothed forceps , thumb non toothed forceps , needle holder , suture needle straight 10 , suture needle curved , cuscoss / graves speculum vaginal ( large ) , cuscoss / graves speculum vaginal ( medium ) , cuscoss / graves speculum vaginal ( small ) , sponge holding forceps / cheatle forceps , ppiucd insertion forceps , uterine sound ( for iucd ) , airway , labour table , rack / table for keeping trays, fluids , delivery troly , foot step , stool , screen seperator with stand , almira , rack for keeping sleepers / shoe covers outside labour room , cot , pillow , pillow cover , side locker , bed sheets , blankets , office table , chair , examination table , mattress for examination table , bucket big , bucket small , mugs , chairs for waiting area ( three in one set ) , led tv for iec , white wrighting board , syringes ( 20 cc , syringes 10cc , syringes 5cc , syringes 2cc , ad syringes ( 0.5ml , ad syringes ( 0.1 ml ) , disposable masks , sterile surgical gloves , gown / apron , shoe cover , caps , mucous extractor , disposable cord clamp , heavy duty gloves , foleys catheter , disposable sterile urethral catheter ( rubber plain 12 fr ) , disposable lancet ( pricking needles ) , routine immunization monitoring chart , blank immunization cards / joint mch card ( one per pregnant mother ) and tally sheets ( one per immunization session ) , interdental cleaning aids , chlorine tablets , sanitary napkins , 200 watt bulb ( 2 ) , salt – iodine test kit , wooden spatula , dry cell / battery , partograph in case sheets , iv cannula 16 , iv cannula18 , iv cannula 20 , iv cannula 22 , iv set , sanitary napkins , mackintosh sheet 5 meter , disposable delivery kit for delivering hiv patients ( emergency ) , disposable delivery kit for normal delivery , 5 l plastic tub for keeping chlorine solution , bucket for keeping 1% chlorine solution ( for spillage ) , colour coded bins yellow , colour coded bins red , colour coded bins black , colour coded bins blue , colour coded plastic bags ( yellow, red, blue and black ) , insecticide treated nets , mopping stick , micropore tape , urine bags , sheets for drying and wrapping baby , feeding tube , cleaning material and detergents , insectiside treated net , window screens , chlorine tablets , inter dental cleaning aid , 200 watt bulb , online ups 1 kva with 60 minute backup , fire extinguisher , hand towels , soap , towel , gauze piece ( roll ) , cotton swab ( roll ) , tuning fork , ice pack box , vaccine carrier , floor mopping stick , dari with room size. , mats for yoga , curtains , micropore tapes* , urine bags* , slide drying rack , specimen collection bottle , spirit lamp , test tube holding clamp , test tube rack , test tubes , wooden spatula , glass rods , glass slides , kit for testing residual chlorine in drinking water , rapid pregnancy testing kit , rapid test kit for dengue , rapid test kit for malaria , n / 10 hydrochloric acid , reagents such as hydrochloric acid, acetic acid, benedict’s solution, bleaching powder, hypochlorite solution, methylated spirit etc. , acetic acid solution , micropippette , yellow tips for micropipette , dipsticks for urine test for protein and sugar ( 1 container of 25 strips ) , whole blood finger prick hiv rapid test and sti screening test each , h2s strips test bottles for water testing , salt iodine tesitng kit , talquish hb scale....

Nagar Panchayat - Jharkhand

39349381 tender for supply of basic equipment and stationary: pulse oximeter gluco meter hemoglobin meter stethoscope bp machine digital weight machine digital height meter thermometer digital register large register medium bed side screen emergency drug tray nebulizer machine fire extinguisher ambu bag iv stand tongue depression mouth gag inverter with battery tobler dust bin color coded bin sharp container towel suction machine foot step nebulizer torch mop a4 paper pen bucket mug baby weight machine digital...

Rural Works Department - Jharkhand

39278153 bids are invited for patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold beedsheet screen , bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , iv stand , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , scessior medium , a 4 paper white , pen , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register or book , pillow , pillow cover , floor wiper rubber , floor wiper jut , door mat , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , garbage poly bag black 10 kg , garbage poly bag red 10 kg , hand wash liquid , hand wash soap , water bottle 1 ltr. , tiolet cleaning brush , bed sheet , plastic chair , led tube light , led bulb t shape , desktop computer , webcame , speaker total quantity : 776...

Rural Works Department - Jharkhand

39272407 bids are invited for patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold beedsheet screen , bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , iv stand , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , scessior medium , a 4 paper white , pen , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register or book , pillow , pillow cover , floor wiper rubber , floor wiper jut , door mat , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , garbage poly bagblack 10 kg , garbage poly bag red 10 kg , hand wash liquid , hand wash soap , water bottle 1 ltr. , tiolet cleaning brush , bed sheet , plastic chair , led tube light , led bulb t shape , desktop computer , webcame , speaker total quantity : 776...

Hindustan Petroleum Corporation Limited - Jharkhand

39238418 bids are invited for medical items for occupational health center for hpcl jamshedpur lpg plant sink tap , ss sink , strecher stand with 4 wheels , saline stand , blood pressure apparatus , medical oxygen unit , oxygen cylinder trolley , screen with three fold frame , iron manual hospital bed , side locker , a table with a smooth top , stethoscope total quantity : 12...

Welfare Department - Jharkhand

39132329 request for quotation for partner empanelment for supply of nicu nursing infrastructure 1. infant baby warmer with stand (supply, installation and demonstration) micro controller based electronics controls: servo skin/manual mode pre warm: use the equipment with 30% heater output in manual mode. no need of calibration required for temperature probe. high intensity quartz/calrod heating element for effective radiation halogen observation lamp parabolic reflector design to send uniform heat to the bed surface. memory backup to restore set temperature and previous mode, in case of power failure. optimum bed dimensions ensure optimum work space for the nursing staff. comprehensive alarms and safety cut offs. instant warming and uniform heating & short wave heater ensures instant warming automatic safety heater cut off at 39 c in any mode controller electronics: high speed micro controlled mode of operation: servo skin, manual skin mode control range: 30.0 38.0°c. manual mode timer: 1 min 15 min (selectable) percentage of heater output: 10% 100% in 10% increments memory back up: equipment restores the previous settings programmable mute time: the user can select the mute time safety heater cut off: if the skin sensor is removed from the babys skin over temperature heater cut off: if the skin temperature is>39°c in any skin/manual mode temperature sensor (probe): thermistor sensor accuracy of skin sensor: ±0.1°c accuracy of skin probe interchangeability: ±0.2°c power rating : ~230v, 50 hz max. heater wattage: 600 watts max. power requirement : 700 watts examination lights : 12v, 50w halogen lamp 2 castor 4 nos (2 with brake & 2 without brake) monitor shelf : 1 no should have provision to keep undersurface phototherapy light. height adjustable operating noise level : <50dba alarms skin sensor is removed from the babys skin skin temp high : >1.0°c.from the set temperature, skin temp low : < 1.0°c.from the set temperature, skin temp probe fail: if the skin probe is short or fail over temperature: if the skin temp. is >39°c, heater fail system fail: electronic component defect environment operating temp: 15.0°c to 35.0°c, storage temp : 20.0°cto 60.0°c, operating humidity: 5% to 90% rh, non condensing storage humidity : 0% to 99% rh, non condensing altitude: sea level to 1.9 miles quality: iso 13485:2016 electrical & product safety : : iec 60601 1 & iec 60601 1 2 , iec 60601 2 21 , iec 60601 2 50 should have complied with european ce 93/42 eec standards certification from a notified body. preferred make: make: dre/neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care/ibis/kenmark/david/trimpeks/frontline/fanem. 2.baby incubator for nicu(supply, installation and demonstration) thermal performance: consistent air temperature. bi directional air flow. internal noise level: low operating sound levels assure a developmentally supportive environment for infants. double wall hood: double wall hood is designed to decrease radiant heat transfer between the baby and the incubator wall. the inner wall can be easily removed for cleaning without the use of tools. air screen: the air screen creates a barrier of warm air when the access panel is open. electrical electrical connection : ac 230 v, 50 hz, max power rating : 370va max incubator with fixed/variable height heater power rating: 300w, electronics : micro controller with sell test function mute time: 2 min 20 min programable, incubator control modes : servo air and servo skin co2 level with in the hood : less than 0.8% when mixture of co2 in air is delivered at 750ml/min at a point 10cm above the center of mattress temperature accuracy skin /air mode : accuracy ± 0.2 c max temperature : 39°c warm up time : 25 35 min per 10°c (at 23°c ambient temperature) initial temp overshoot : <1.0°c.temperature uniformity : <0.8°c sensor : thermistor probe interchangeability : accuracy ± 0.2°c (calibration not required) noise level inside incubator : <60 db) air velocity over the bed : <10 cm/sec (at 10cm above the center matress) relative humidity : >80% at 10 cm over bed center air filter capacity : 99% (0.5) air intake volume with filter: 25 l/min μ & without filter 250l/min bed tilting (tilting by c clamp) :± 8°up/down set temperature range air mode : 20°c to 37°c, 37.1°c to 39°c temperature override mode skin mode : 30°c to 37°c, 37.1°c to 38°c temperature override mode oxygen concentration oxygen input 5 lpm : 25% to 45% 0₂ oxygen input 15 ipm : 45% to 70% 0₂ humidification : low/high <80% skin temperature low/ high air temperature high / low alarms failure of air, air flow, heater, skin probe, air probe, system, power temperature 39 in any mode safety heater is electronically cut off if air/skin temperature inside the incubator exceeds 39.0°c iec 60601 1 specification type of protection against electric shock: class 1 mode of operation: continuous electrical safety: iec 60601 1 & iec 60601 1 2 , iec 60601 2 19, weight : min 50 kg height of bed from floor : 900 mm dimensions of bed : 700 mm x 400 mm castors : 4 diameter antistatic (2 locking and 2 non locking) iv maximum load : 1.5 kgs maximum monitor load : 3.0 kgs maximum baby weight to be: 5.0 kgs should have complied with ce> preffred make: neotech/zeal/v care/ibis/kenmark/frontline/sst/electromeg/comen/bistos/fanem/vng/phoenix/ziraffe/bpl/dragor 3. baby bassinet / baby cradle for nicu (supply, installation), to be used with phototherapy light. the system should be detachable fire retardant enclosure for light source adjustabble height should have provision to undersurface phototherapy can be used with standing phototherapy the unit can also be usable as observation trolly. bed size approximate: 50x75 cm height : adjustable from 400 to 600 cm the units should have anti static 2” castor 4 nos, 2 with brakes. 4. phototherapy unit(standing with stand) , moveble with 2 4 wheels the leds of each unit should be therapeutic high wattage blue & white leds, min 12 nos the wavelength should be between 455 to 465nm the high irradiance at skin level should be > 45μw/cm2/nm at a distance of 30 cm should have an uniformity ratio of > 0.40 the led lamps used should be rated to last up to 20,000 hrs should have dual digital cumulative hour timer for led usage and patient exposure the light source system should have overheat protection with power cutoff for temperature uniform light distribution led unit tilt up to 90 degree and allowing use with warmer iec 60601 1 specification type of protection against electric shock : class 1. 5. undersurface phototherapy light the leds of each unit should be therapeutic high wattage blue & white leds, min: 12 nos the wavelength should be between 455 to 465nm the high irradiance at skin level should be > 45μw/cm2/nm at a distance of 30 cm should have an uniformity ratio of > 0.40 the led lamps used should be rated to last up to 20,000 hrs treatment timer ensures auto cut off when elapsing the set time no infrared rays ensures minimize the water loss should have dual digital cumulative hour timer for led usage and patient exposure the light source system should have overheat protection with power cutoff for temperature uniform light distribution led unit can be usesable with warmer iec 60601 1 specification type of protection against electric shock : class 1. 6 neo ventilator (hfo) (supply, installation and demonstration) 1. invasive, non invasive , o2 theraphy(hfnc) 2. min 13 large color touch display 3. basic modes: vc ac, vc simv, pc ac, pc simv, cpap psav + advance mode ( prvc, aprv, bipahasic , mmv) 4. ncpap, nippv modes for neanates 5. inbuilt nebuliser 6. 3 wave forms/ 3 loos/trends 7. 32 patient parameter 8. inspiratory hold/expiratory hold/po.1 /intrinsic peep, lung recruitment maneuver (p v tool), proportional pressure support cerification: ce certified, iso and iec certified prefferred make: acutronics/bpl/hamilton/schiller/maquet servo/ge/comen/philips/drager/siemens/medisys/vyaire/tecme/metran/fanem/getinge/briovent/advin/narang/skanray/lifeline/billicare/magnamed/sle/medi/ honmed/ medtronic/resmed/smith/becton/mindray/trivitron/medtronic/resmed/newport/ 7 bubble cpap (supply, installation and demonstration) should have latest technology and capable of giving bubble cpap therapy to neonates for preterm and term babies weighing from 400 gms , also capable of giving hfnc therapy to neonates and pediatric cases. machine should have options to be used as bubble cpap, hfnc, nasal cpap and t piece resuscitator should have lcd touch screen 4” & above graphical display should have digital real time airway pressure monitoring and displayed on screen should have digital real time fio2 monitoring and displayed on screen should have built in compressed air source & no external air compressor should be required or mounted on trolly or taken from central air source should work with low flow oxygen input with maximum input flow of 15lpm and 1 bar input pressure should have inbuilt blending mechanism for fio2. should have good quality calibrated blender for mixing of air and oxygen with selectable fio2 (21% to 100%). the machine should have loss less blending mechanism & fio2 monitoring. equipment should also work without oxygen input should have builtin saftey valve with preset mode specific safety cutoff should have universal connections for circuit and attachements should have inbuilt battery back up upto 2 hours should have settable audio & visual alarm for low pressure, high pressure & safety pressure cutoff limit should be able to be mounted on the mobile stand for easy moving, and the stand should be equipped with bubble generator holding clamps with easy fixation. should be able to set output flow of 1 10 lpm can set fio2 from 21 100 % accuracy of flowmeters should be +/ 4%accuracy of pressure measurement should be +/ 1 cmh2o accuracy of fio2 should be +/ 3% should be able to set cpap pressure in bubble cpap mode from 3 10 cmh2o should be able to set cpap pressure in nasal cpap mode from 0 15 cmh2o setable pressure in auto t piece mode should be peep: 0 15 cmh2o & pip: 10 40 cmh2o should have settable as well as inbuilt safety over pressure valve up to 40cm h2o should be supplied by manufacturing company having iso 13485 certifications & ce for medical devices manufacturer should be an indian company with product made in india should be provided with single use nasal prongs (small, medium, large) single use nasal masks (small, medium, large), single use head bonnet (small, medium, large, xl) single use rams cannula (small, medium), single use neonatal patient circuit with single heater wire and humidifier chamber with autofeed should have audio visual alarm should be provided with us fda certified servo humidifier temperature sensor probe and heater wire adaptor humidifier specification mode – should have auto mode servo controlled for invasive, noninvasive ventilation & high flow default setting – should be 37 °c (invasive), 31 °c (noninvasive) should have an automatic temperature setting in invasive & non invasive mode temperature display should have the following alarms: temperature sensor, limb failure, chamber & patient end temperature alarm silence facility electrical specs. – input voltage 220 240 v / 110 127 v / 100v; 50/60hz standards – iec 60601 1, iec 60601 1 2, en iso 8185, ce certified, usfda preferred make: fisher & paykel/drager/biomed/hamilton/electrogenics/fanem. 8 pulse oxymeter (supply, installation and demonstration) hand held pulse oximeter with enhanced spo2 accuracy during motion artifacts and waveform and numeric value display 2.4 oled color display 96 hours data memory suitable for adult, pediatric and neonatal application mains as well as battery operation visual alarm indicator hand held unit with standard accessories: spo2 sensor with extension cable adapter for mains connection adaptor for mounting hand held unit operating manual manufacturer should be iso 13485 certified 9 multipara monitor (supply, installation and demonstration) should have facility to display ecg, rr, hr, pr, spo2, nibp, single temperature as standard parameters with in built rechargeable battery back up of at least 6 hrs of operation. display: touchscreen color tft lcd display of size 8” or more. should display at least 4 waveforms or more of dual trace ecg (cascaded ecg), spo2 and respiration simultaneously. should have st analysis & arrythmia analysis should have digital technology to sense the spo2 in hypotensive, shivering & motion condition. should have facility for displaying different screen configurations. should have audio visual alarms for all parameters & should be user selectable should have audio alarm silence selectable for 60 sec / 120 sec should have volume adjustable for audio alarms should have different color visual alarms as per set priority should have audio for qrs beep and volume should be adjustable should be able to store & display at least 72 hrs of graphical trends of all parameters. should be suitable for monitoring adult & pediatric patients. should be able to give visual & audible alarms with three levels of volume adjustment on violation of any monitored parameter. the monitor should be european ce approved. should be iso 13485 certified. power input to be 220 240vac, 50hz fitted with indian plug warranty: should have minimum 1yrs. of manufacturer warranty. make: niscomed/philips/ge healthcare/medtronic/mindray/cms/siemens/choicemmed/nidek/bpl/biotronic/honeywell/nihon/spacelabs/schiller 10 syringe pumps ((supply, installation and demonstration) display should be 3.5 inch backlit color lcd or touch 1. should have multiple infusion modes ( rate mode, weight mode ,time mode, sequence mode) 2. should have 9 occlusion levels 3. should be support syringes of all standard brands 4. should have auto detection of syringe size 5. should compatible with 5, 10, 20, 30 and 50(60)ml syringe 6. built in drug library (100 drugs) 7. should have infusion rate:0.1 2000ml/h,0.01ml/h (0.01ml/h increment till 100 ml/hr , 0.1ml/h increment from 100 1000ml/h and 1ml/h increment from 1000 2000ml/h) 8. should have bolus rate:0.1 2000ml/h 9. should have kvo 0.1 5ml/h 10. backup power for minimum 6 hours (optional 12 hours) 11. quoted item should be usfda/ european ce with 4 digit notified body. 12. bis approved or manufacturer should be iso 13485 certified preferred make: mindray/biocare/dre/byond/ge healthcare/akas/skanray/bpl/dre/braun/fresenius/contec 11 infusion pumps (supply, installation and demonstration) volumetric infusion pump technical specification: flow rate range: 1 to 1000 ml/hr. in normal mode, 1 ml / hr. increment, micro infusion mode: 0.1 to 100ml/hr. with 0.1 ml/hr increment. flow rate accuracy: accuracy of ±2% or better. infusion time: adjustable from 1 minute to 96 hours, 1 minutes increments. setting mode: flow rate, flow rate + volume, volume/time, flow rate +time, ramp up / ramp down, sequential, bolus, induction / loading dose, microinfusion. kvo rate: 3 ml / hr. adjustable pressure limit: 750 mmhg, adjustable from 100 to 900 mmhg (50 mmhg increment) history data log: up to 500 last data events. configuration: infusion mode, key board lock, kvo, pressure limit, display of drug name, time and hour setting, language, lcd contrast, alarm sound level, ward name, secret code, max. allowable flow rate, air bubble size, recall of last parameter on power on, display mode volume accumulating, end of infusion pre alarm setting. should have infusion line disconnection alarm should have infusion line pressure monitoring in mm of hg power supply: power input to be 220 – 240v ac, 50hz fitted with indian plug of appropriate rating battery backup: 3 6 hour quoted item should be usfda/ european ce with 4 digit notified body. bis approved or manufacturer should be iso 13485 certified. warranty: should have 1yrs. of manufacturer warranty. make: mindray/biocare/dre/byond/ge healthcare/niscomed/akas/skanray/bpl/dre/braun/fresenius/contec 12 cardiac table (supply, installation) cardiac table hospital adjustable table hospital table made with mild steel material laminated board top mounted on four 5 cm swivel castors manually adjustable height epoxy powder coated top size: 76(l)*40(w)cm height: 76/106c no 13 blanket phototherapy (supply, installation and demonstration) fibre optic based technology features: spectral irradiance: small pad 70 μw/cm /nm (+/ 25%) and 9 point check large pad 49 μwcm /nm (+/ 25%) and 6 point check wavelength: 460 470 nm fiberoptic lightpad, small : 12 x 30 cm (light emitting area) fiberoptic lightpad, large : 20 x 33 cm (light emitting area 15000 20000 hour led capability safety: no uv/ir/ emission length of fibre bundle: approx 170 cm sound level : <44 db at 1m power rating: 30w device automatically shuts off in the event of light engine over heating. should have complied with european ce 93/42 eec standard certification from a notified body iso 13485 certified preferred make:bilihu/biophoton/neotech/bpl/ibis/phoenix no 14 ambu bag for nicu for providing critical care during cardiopulmonary resuscitation, for patients undergoing endotracheal intubation or surgery under general anesthesia in nicu no 15 laryngoscope set for nicu no 16 diaper weighing machine no 17 baby weighing machine no 18 poc abg machine (supply, installation and demonstration) analyzer should be small lightweight (<1kg) handheld capable of measuring ph, pco2, po2, na+, k+, ca++, cl , glucose, lactate, creatinine/bun & hematocrit. calculated parameters: chb, ctco2, be, beecf, so2, hco3, egfr, a gap, a ado2. all the parameters should be performed simultaneously on a single use disposable test card. fast analysis time of less than 1 minute after sample introduction. analyzer should accept a small sample size of less than 100 μl. input: patient id, age, gender, height, temperature, fio2, sample type. sample types: arterial, venous cord & capillary whole blood. the analyzer should have the provision of storing at least 1000 patient and qc results. should display normal, outside reference range & critical patient results with color coded tiles. the test cartridges should be self contained with all the sensors & reagents and should not be separate. the test cartridges should be room temperature storable without the requirement of refrigeration. the analyzer should be provided with a dedicated wireless thermal printer. the analyzer should use amperometric, potentiometric, and conductometric measurement. the analyzer should have in built barcode readers for expiry control and patient data entry. analyzer should have dual power operation through ac adapter and/or rechargeable li ion battery. analyzer should have on board animation videos for user guidance. should have wireless connectivity facility for his/lis, remote updates etc. should be usfda and ce certified for all products and parameters. preferred make: abbott/siemens/radiometer/edan 19 jaundice meter a simple, effective, portable non invasive jaundice meter quick and easy to obtain bilirubin readings with minimal disturbance to the baby advanced optics and processing for highest accuracy suitable for screening infants from 35 weeks’ gestation power input: 3 vdc( 2aa batteries) measurement range: 0 32mg/dl measurement accuracy: ±1.5 mg/dl operating temperature: +10 to 50 c comliance: en 60601 1 20 vein viewer inbuilt rechargeable battary 3 intensity mode android charger 8 led total( 6 red+2 amber ) iso 9001:2015, iso 13845:2013, gmp, and ce certified 21 embrace warmer (supply, installation and demonstration) 1. the embrace warmer uses an effective phase change material to stabilise rapidly the temperature of an infant suffering from hypothermia. 2. the embrace warmer is light and portable. the baby can be held in the mother’s arms when the warmer is being used. 3. hygienic & durable: it can be reused several times. cleaning is easily done using soap and water. maintains temperature of ~37 degree c for at least 4 hours* (380mm x 220mm, 1.3kg) precision heating mechanism prevents overheating duration of at least 4 hours at ambient temperature greater than 25 c does not require constant power supply approx 15 watt of power consumption preferred make: phoenix/philips/neotech/ge healthcare 22 oxygen hood for nicu (infant use) transparent and curve shaped oxygen hood for neonatal oxygen therapy made with medical grade polycarbonate material. medical grade silicone flaps in the head opening area to adjust the neck size and make sure optimum oxygen concentration. small 21 cm ( diameter ) 16.5 cm ( height ) 12 cm ( neck opening ) medium 21 cm ( diameter ) 19 cm ( height ) 14cm ( neck opening ). accessories to be provided: tubings 01. shapes have enough space for baby head movement. its comes without any sharp corners and easy to clean and disinfect. the manufacturer should be iso 13485 certified. fully autoclavable. make: neotech/vng/david/ibis 23 crashcart crash cart ss frame 304 overall approx size 940mm l x 490 mm w x 1535 mm h stainless steel tubular frameprinciples for no six removable plastic bins & two polystrene lockable storage units with three drawers each four swivel castors, 150 mm dia (two with brakes) complete with corner buffers, oxygen cylinder holder, s s i v rod, s s top & shelves, cardiac massage board ss 304 24 bpc o2 flowmeter with jar usage nicu flow rate 15 l/min display analog tube cover material poly carbonate body material brass accuracy (flow rate) + 3% 25 portable suction machine technical specifications: minimum flow rate: 17 lpm minimum collection capacity: 600 ml make: philips/omron/drive devilbiss healthcare/resmed/niscomed/oxymed/lifeline/rossmax 26 cold light source (supply, installation and demonstration) use: cold light source is used for accessing tiny arteries and veins of the babies should have light intensity controlled with a smooth rotary potentiometer pressing button should have minimum dual control having 2 halogen/xenon/led lamps should have smps based design ensures smooth working of the light source within the voltage variation. dimensions/weight: length280mm, width 220mm, height from the floor:130mm weight up to 5kg heat dissipation heat is disbursed through an exhaust fan (if applicable). portability hand held device power requirements 230vac + 10%, 50 hz operating range: +15°c to 35°c environment storage range: 10°c to 60°c environment humidity: operating range: 15% to 90% rh non condensing storage range : 50% to 90% rh variable intensity : 0 to 100% continues. optical cable: 6mm diameter & 1m length on time: 5min & 10min selectable. display parameters :% of intensity, usage hours & timer alarm indication: fan fail, temperature sensor fail, light source over temperature. preferred make: neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care certifications: quality: iso 13485:2016, electrical safety: iec 60601 1, emc safety: iec 60601 1 2 should complied with european ce 93/42 eec standard certification from a notified body spares: illumination lamps: 2 nos. spares preferred make: neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care 27 dressing trolley with bowl & bucket for use in nicu s.s. frame work s.s. shelves with four side railing on castors size : 76 x 46 x 81 cm 28 instrument trolley ss with 4 wheels overall size 60 l x 45 w x 80 h cms ms tubular construction with ss top & shelf three side guard railing on upper shelf ss 304 29 revolving stool four legs s s tubular construction s s revolving top adjustable height with m s screw mechanism epoxy powder coated30 iv stands i.v. stand, 31 dia 2 hook iv stands wheel mounted on a plastic base with ms pipe , adjustable height from 55” to 95” 31 infant t piece resuscitator (supply, installation and demonstration) can deliver oxygen levels ranging from 21% through to 100%, from a flow meter or blender. the resuscitator has a pip control, as well as a maximum pressure relief valve that prevents the accidental delivery of excessively high pressures. resuscitator should features an accurate, easy to read, medical quality manometer, and can be mounted on a pole, rail, wall, infant warmer, or incubator. manometer range 20 to 80 cmh2o [mbar] manometer accuracy +/ 2.0% of full scale deflection maximum pressure relief @ 7lpm 1 to 66 cmh2o o [mbar](dependent on flow rate) storage range: 40% to 90% rh non condensing operating range: 15% to 90% rh non condensing recommended patient body weight 0 to 10 kg (22 lb) delivered oxygen concentration up to 100% depending on the gas supply operating time* (400 l cylinder) 50 minutes @ 8 l/min components: gas supply line; gas inlet adaptor; test lung; spare max pressure relief quality/test approval quality: iso 13485:2016 device standard: iso 10651 5 iso 10993 mdd product classification: class iib protection against increase of liquid : ipx4 european ce certified preferred make: zeal/fisher& paykel/neotech/ge healthcare/neotech/flexicare 32 oxygen panel and piping (supply, installation and demonstration) minimum 3 oxygen outlet. pipe should be of isi mark. approximate piping lenth: 10 ft pipe thickness must be of 12mm. mox regulator should be there to control the pressure. angle & t copper 33 oxygen cylinder (filled) (supply, installation and demonstration) jumbo type with regulator and trolley 34 syringe pump stand (supply & installation) no. of shelves: 1 shelve 2 saline hook framework material: ss mounted on moveble caster/wheel with electrical socket where 8 syringe pump can be plugged 35 observation trolley soft mattress for comfortable baby laying large working area mattress tilt ±30° on both side provision to take x ray without disturbing the baby 4 nos collapsible acrylic panels with plastic hinges 4” castor 4 nos (2 with brake and 2 without brake) storage tray option underneath the bed 36 hospital child bed 1650x780x630, height adjustable side rail, back rest lifting angle. epoxy powder coated 37 icu bed motorized electric operated five functions motorized hospital bed electrically operated with luxury castors central lockingsize: 2120x1000x460 720mm (lxwxh) • function at back rest, footrest, hi/lo adjustment, forward tilting, backward tilting with cable remote control. • epoxy powder coated bed frame, mounted on central locking luxury castors. • bed board link of soft, pp hiding side rails. quick release handle at back side pillow and mattress 4” thick made of pu foam with one side rexine & other side cotton cloth with food table and bed side locker make: hill rom/stryker/getinge/linet/invacare/paramount/arjo/joerns /drive devilbiss/skytron/steris or equivalent brands having bed production facility of us fda registered. bed to be european ce and facility to be iso 9001, 14001 and 13485 approved 38 icu bed, manual five functions motorized hospital bed manually operated with luxury castors central locking size: 2120x1000x460 720mm (lxwxh) • function at back rest, footrest, hi/lo adjustment, forward tilting, backward tilting with cable remote control. • epoxy powder coated bed frame, mounted on central locking luxury castors. • bed board link of soft, pp hiding side rails. quick release handle at back side pillow and mattress 4” thick made of pu foam with one side rexine & other side cotton cloth with food table and bed side locker make: paramount/arjo/joerns /drive devilbiss/medline /savion/khera/sng/narang/bpl/sigma/acme/prana or equivalent brands 39 glucometer technical specifications for glucometer: measurement range: 20 to 600 mg/dl (1.1 to 33.3 mmol/l) accuracy: ±10% deviation from laboratory reference values sample size: maximum 0.5 microliters of blood per test testing time: maximum 10 seconds memory and data management: minimum memory storage capacity of 500 test results, with data transfer capability to electronic medical record systems or computers display: clear and easy to read display, preferably with a backlit feature for enhanced visibility power source: long lasting battery life, support for disposable batteries and rechargeable options, with low battery status indication make/brands: accu chek (roche)onetouch (lifescan)/dr. morepen/johnson & johnson/omron/ bayer contour/ beurer/abbott /apollo/smart care 40 bp apparatus manual (mercury) iso / ce standard included components adult size cuff with velcro closure , owners manual , mercury fixed ready to use item weight 450.0 grams material type forged number of items 1 size regular special features high accurate readings specific uses for product clinic long lasting heavy duty silicone tubings ce certified , 4.2 mm capillary & hard metal body product should include all the necessory accesorries required for intented use. clear reading make: diamond/romson/dr trust/philips/ge/bpl/omron/rossmax/healthsense/beurer 41 digital bp apparatus manual iso / ce standard included components adult size cuff with velcro closure , owners manual type: upper arm, fully automated display: lcd measurement method: oscillometric method minimum pressure measurement range: 20 mmhg maximum pressure measurement range: 280 mmhg minimum pulse measurement range: 40 beats/min maximum pulse measurement range: 180 beats/min pulse measurement accuracy: +5 pressure measurement accuracy: +3 size regular special features high accurate readings specific uses for product: clinic, training nurses long lasting heavy duty silicone tubings product should include all the necessory accesorries required for intented use. make: dr trust/philips/ge/bpl/omron/rossmax/healthsense/beurer/romson/diamond 42 nibp (non invasive blood pressure) machine: 1. measurement range: 1.1. systolic pressure: 40 260 mmhg 1.2. diastolic pressure: 20 200 mmhg 1.3. mean arterial pressure (map): 30 240 mmhg 2. measurement method: 2.1. non invasive measurement using inflatable cuff 2.2. utilizes oscillometric or auscultatory method 3. accuracy: provides clinically acceptable blood pressure readings 4. cuff size: multiple sizes available for different arm circumferences 5. display: clear display of blood pressure measurements and additional information 6. memory and data management: stores and retrieves previous readings, data transfer capability 7. power source: battery or mains power, battery option for portability brands: omron / philips / ge healthcare / welch allyn / nihon kohden / dräger / mindray / schiller / bpl medical technologies / contec medical systems no 43 stethoscope dual non stick acoustic tubing provides insulation for superior sound included accessories: 2 extra sets comfort seal ear tips, spare adult and pediatric clear pvc diaphragms, pediatric diaphragm assembly, pediatric bell, infant bell and id tag intended use: adult, infant, pediatric approximate weight: 150 250 gm earpieces: earpieces should occlude your ear and block out most or all room noise. they should be comfortable yet snug and should follow the natural forward angle of the ear canals. tubing: the tubing should be sturdy and no longer than absolutely necessary. head: the head of the stethoscope should have a bell (a cup shaped side) and a diaphragm manufacturer is certified for iso 13485 medical devices. brands: littmann/rossmax/romson/healthsense/technocare/omron/mdf no 44 ultrasonic mesh nebulizer machine technical parameters: nebulization technology: ultrasonic mesh for fine aerosol production. medication compatibility: works with a range of medications. particle size: produces small particles for effective inhalation. no silent operation: quiet for patient comfort. battery life: long lasting for portable use. dosing control: precise medication delivery. easy maintenance: simple disassembly and cleaning. portability: compact and lightweight design. user interface: intuitive controls for easy operation. mask compatibility: suitable for various mask sizes. certification: complies with relevant industry standards. make: 1. philips/omron/dr. morepen/rossmax/agaro/healthsense/bpl/beurer/dr. trust 45 nebulizer for nicu particle size: fine aerosol particles for neonatal inhalation. medication compatibility: suitable for various nicu medications. silent operation: quiet operation for infant comfort. dosing accuracy: precise medication delivery control. continuous nebulization: capable of extended treatment. oxygen compatibility: accommodates oxygen therapy. user interface: intuitive controls for easy use. safety features: prevents overmedication risks. compact design: space efficient for nicu placement. easy maintenance: disassembles for cleaning. mask compatibility: fits neonatal masks. certification: iso compliant manufacturing. make: 1. philips/omron/dr. morepen/rossmax/agaro/healthsense/bpl/beurer/dr. trust 46 oxygen concentrator (supply, installation and demonstration): for use in nicu oxygen concentrator 5 lpm: flow rate: 5 liters per minute oxygen purity: typically around 93% (+/ 3%) power source: electric (ac) weight: standard range, usually between 14 to 18 kg dimensions: compact and portable design noise level: low decibel range for quiet operation filters: built in air intake filters for clean air supply oxygen delivery: continuous flow mode user interface: intuitive controls and lcd display alarms: visual and audible alarms for low oxygen concentration and power failure accessories: nasal cannula, humidifier bottle, filter replacements compliance: designed for medical use and regulatory compliance make: philips/devilbiss/nidek/inogen/oxymed/airsep 47 12 channel ecg machine with monitor and electrodes technical parameters: channels: 12 simultaneous channels for comprehensive cardiac monitoring. electrodes: high quality electrodes for accurate signal acquisition. display: clear display of 12 lead ecg data for real time analysis. printing:high resolution printing for detailed ecg reports. sampling rate: high sampling rate for precise waveform capture. interpretation: built in ecg interpretation algorithms for efficient analysis. filters: signal filters to eliminate interference and ensure accuracy. recording speed: adjustable recording speeds for various assessments. connectivity: usb or bluetooth connectivity for data transfer. battery backup: reliable battery backup for uninterrupted operation. make: ge healthcare/philips/schiller/bpl/nihon kohden/edan instruments/mindray/cardiac science/contec 48 steriliser make: goley / surya or equivalent 49 spring balance medical spring balance technical specifications: wide measurement range high accuracy durable construction clear display tare function overload protection portable design easy calibration no 50 intrauterine device (iud) thats inserted into the uterus for long term birth control (contraception). t shaped plastic frame has copper wire coiled around the stem and two copper sleeves along the arms that continuously release copper to bathe the lining of the uterus. it produces an inflammatory reaction in the uterus that is toxic to sperm, which helps prevent fertilization. no 51 pelvimeter pelvimeter technical specifications: material: high quality medical grade materials measurement range: suitable for various pelvic measurements accuracy: precise measurement graduations easy to read scale lightweight and portable design ergonomic handle for comfortable use durable and long lasting construction suitable for clinical and educational use no 52 delivery couch technical specifications: convertible design: easily converts into operating table for emergency caesarian section adjustable backrest for patient comfort removable headboard for versatility leg supports for secure positioning removable foot section for accessibility height adjustable: minimum 60 cm, maximum 90 cm smooth mobility: equipped with diagonally lockable 12 cm diameter castors corner bumpers for protection removable drain pan for easy cleaning no 53 foetal dopler ultrasound frequency: 3mhz ultrasound intensity: <10mw/cm2 power supply: alkalinity battery display: 45mm×25mm lcd fhr measuring range: 50~240bpm fhr resolution: 1bpm fhr accuracy: ±1bpm power consumption: <1w dimension :135mm ×95mm ×35mm weight:500g configuration: main body 3mhz probe feature table: functions: display b/w backlight:yes build in speaker : yes battery indicator:yes fhr display: yes auto power off: yes various work modes :yes alkalinity battery:yes make: life line / bpl/dipel/phillips/ sonoline/angelsounds/huntleigh/bistos/contec or equivalent no 54 automatic hematology analyzer: specifications: measurement parameters: complete blood count (cbc): hemoglobin, hematocrit, red blood cells (rbc), white blood cells (wbc), platelet count, mean corpuscular volume (mcv), mean corpuscular hemoglobin (mch), mean corpuscular hemoglobin concentration (mchc), red cell distribution width (rdw), and other relevant parameters. differential blood count: neutrophils, lymphocytes, monocytes, eosinophils, basophils, and other relevant subtypes. throughput: high throughput capacity capable of processing a large number of samples per hour, ideal for high volume laboratories and hospitals. sample types: accepts various sample types, including whole blood, serum, plasma, and diluted samples. sample volume: minimal sample volume required for analysis to minimize patient discomfort and conserve sample volume. automation: fully automated operation for sample handling, analysis, and result generation. automated sample identification and barcode scanning for sample tracking and data integrity. analysis method: utilizes advanced impedance or flow cytometry technology for accurate and reliable blood cell analysis. may noinclude laser based optical systems for specific measurements. user interface: intuitive and user friendly graphical interface for easy operation and navigation. touchscreen display with clear visualization of data and results. connectivity: built in connectivity options such as ethernet, usb, and lis (laboratory information system) integration for data transfer, result reporting, and remote access. quality control: integrated quality control features to ensure accuracy and precision of results. calibration options and automated quality control checks to maintain instrument performance. maintenance: self diagnostic capabilities for proactive maintenance and troubleshooting. automated cleaning and maintenance routines to ensure instrument reliability and longevity. size and weight: compact and space saving design suitable for laboratory environments. portable options available for on site or point of care testing. power requirements: operates on standard electrical power supply (e.g., 110 240v, 50 60hz). compliance: meets relevant regulatory standards and certifications (fda, ce, iso). make: sysmex corporation/beckman coulter inc./siemens healthineers/abbott laboratories/mindray medical international limited/roche diagnostics/horiba medical/nihon kohden corporation/boule diagnostics /erba/bio rad 55 laryngoscope sets, s.s. (with s.s. handle) satin / dull finish, with 4 s.s. blades size: 1,2,3 & 4 56 nasal cannula delivers:24 30% oxygen, flow rate :1 4l/min, manufactured from soft, non toxic medical grade material, made up of kink resistant pvc tube 57 high flow nasal cannula deliver:21 100% oxygen, flow rate: upto 60l/min, manufactured from soft, non toxic medical grade material, made up of kink resistant pvc tube 58 venturi mask delivers: 24 60% oxygen, flow rate: 2 15l/min, tube length 7 ft, manufactured from soft, non toxic medical grade material, 100% latex free 59 non rebreather mask delivers: 85 90% oxygen, flow rate: 10 15l/min, bag on mask with valves stopping almost all rebreathing of expired air, manufactured from non toxic medical grade material 60 face mask delivers: 40 60% oxygen, flow rate: 05 10l/min, manufactured from non toxic medical grade material 61 digital haemoglobinometer photometry based system for estimation of haemoglobin. 2 linearity range 2g/dl to 25 g/dl or beyond.. 3 open reagent system.. 4 led light source. 5 display of results in g/dl. 6 connectivity to pc and printer. 7 accessories to be supplied: along with equipment a micro pipette 2.5 ml : 1 no. b lancing device 1 unit c lancettes : 50 nos d cuvettes with rubber caps – 5 nos e capillaries – 50 nos make: labtronics/ekf/mission/accu/accon...

Urban Development And Housing Department - Jharkhand

38999094 bids are invited for chair for patient waiting area 3 seater , office chair movable , office chair , office table , steel almirah , steel rack , stool for attandent , refrigerator 180 ltr , weight adult 125kg , inverter with battery 220 mah , bio metric set , boul medium size , b p apparatus digital , b p apparatus manual , stethoscope , heamoblobin test kit , glucometer test with all accesary equipment , flash light tourch box type pre focuses , clinical thermometer oral , dressing drum with cover point945 liter s s , dressing drum , surgical scissors straight 140 mm total quantity : 39...

Urban Development Department - Jharkhand

38982841 rate contract for supply of basic equipments, furniture, and various items for one year doctor chair standard + normal chairs doctor table size 64 staff nurse table 4 3 staff nurse chair ( medium ) plastic chair patient steel stool ( revolving ) table ( mpw ) size 3*2 chair for mpw ( medium ) four step reck for medicine three seater chair for waiting area patient bed foot step examination table almirah stethoscope bp instrument weight machine child+adult h.b meter h.b meter strip digital thermometer kidney tray dressing tray needle holder vision chart oxygen cylinder with trolly torch pencil battery remote battery iv stand glucometer glucometer strip medicine tray opd register thermometer nebulizer foetal doppler needle cutter r.s. scissors dressing drum 9x9 dressing tray 10x12 vaginal speculum inside cath 18 intra cath 22 intra cath 24 iv set saline rl saline dns saline ns saline d5% pillow cover pillow bed sheet medicine rack ( 8*6 ) register 8 no. register 10 no. pen scale stapler whitener punch machine scissors file a4 size paper gum big size paper weight dustbin blue dustbin black dustbin red broom mops duster doormat lock and key attendance register stapler pin bucket mug fire extinguisher hand towel bed sheet curtain lock and key link bucket plastic mug hand wash floor mop by matt dustpan harpic large towel hand towel curtain small curtain big green sheet colin phenyl 5 ltr. dusting cloth detergent powder soap toilet cleaning brush full jhadu nariyal jhadu plastic jhadu basin dhone wala ( scrubber ) room freshener hand sanitizer table cloth wall clock dust bin scale big admission register carbon stock register highlight pen sketch pen xerox paper a4 size air conditioner fridge water purifier inverter battery 150a battery 200a battery 220a battery 250a tv 21...

Rajendra Institute Of Medical Science - Jharkhand

38924336 supply of surgical consumables on rate contract basis at rims, ranchi , surgical consumable items , abdominal drainage kit ; size 16fg / 20fg / 24fg / 28fg / 32fg , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 20cm x 20cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 25cm x 25cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 30cm x 30cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 45cm x 45cm , abdominal / gauze sponge with x ray thread , 12 ply , size 20cm x 20cm , abdominal / gauze sponge with x ray thread , 12 ply , size 25cm x 25cm , abdominal / gauze sponge with x ray thread , 12 ply , size 30cm x 30cm , abdominal / gauze sponge with x ray thread , 12 ply , size 45cm x 45cm , absorbable gelatin powder (sterile) (such as gelfoam or similarproduct) , absorbable hemostat (oxidized regenerated cellulose) 4 in.x 8 in. (10cm x 20 cm ) , absorbable hemostat (oxidized regenerated cellulose) 2 in x 4 in(5.1cm x 10.2cm ) , absorbable hemostat (oxidized regenerated cellulose) 2 in. x 3in.(5.1cm x 7.6cm ) , absorbable hemostat (oxidized regenerated cellulose) 3 in x 4in. (7.6 cm x10.2 cm ) , absorbable hemostatic gelatin sponge (8cm x 5cm x 1cm) , absorbable hemostatic gelatin sponge (8cm x 3cm) anal , absorbent cotton roll net weight 400gm , accessoriesforprobesofmonitor(i)lncsdisposableprobes , accessoriesforprobesofmonitor(ii)ecgcable , accessoriesforprobesofmonitor(i)spo2extension , accessoriesforprobesofmonitor(i)etco2 sampleline , accessoriesforprobesofmonitor(i) eeg cup electrode , accessoriesforprobesofmonitor(i)temprature probe , accessoriesforprobesofmonitor(i)nibp hose , accessoriesforprobesofmonitor(i) nibp cuff , accessoriesforprobesofmonitor(i) battery , act cartridgesfor measurement of act , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 1 x 1 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 1 x 3 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 2 x 2 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 3 x 3 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 4 x 5 , adhesive felt pad 5x5cm, , adhesive felt pad 10x10cm , adhesive remover with silicone polymers for easy removal of the base plate, alcohol free, sting free 50 ml , adhesive tape cloth 3 x 10mtr. ( adhesive plaster ) , adhesive microporous paper tape 1 x 9.1 mtr , adhesive microporous paper tape 2 x 9.1 mtr , adhesive microporous paper tape 3 x 9.1 mtr , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 1 x 9.1mtr. , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 2 x 9.1mtr. , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 3 x 9.1mtr. , adhesive silicon gel tape size 1 x 1mtr , adhesive silicon gel tape size 1 x 5mtr , administration set for feeding bag for enteral nutrition feeding pump, dehp and latex free, length minimum 250 cm , aerosol oxygen mask adult / paed , air mattress/airbed/inflatable mattress (plain) (anti decubitus bubble)disposable electrically operated , alken trocar cannula , all type of topical haemostatic agents including thrombin based agents biological glue etc. , ambu bag adult 100% silicon material only , ambu bag paediatric 100% silicon material only , ambu bag neo natal 100% silicon material only , amplantz sheath all sizes , anaesthesia circuit a coxial modification of the basic t piece system, developed to facilitate scavenging of waste gases. the process includes patient inspiring fresh gas from the outer reservior tube and expiring into reservior tube. convenient, lightweight anaesthesia delivery system ; should be based on mapleson d system provided with a corrugated tube , expiratory valve and antistatic bag ; compact and inexpensive with low dead space , anaesthesia masks (disposable, latex free, inflatable cuff, transparent)size 0, 1, 2, 3, 4, 5 , anaesthesia masks (re usable silicone, transparent) size 0, 1, 2, 3, 4, 5 , angled tip arterial cannula sized 8 fr 24 fr, should be beveled thin wall tips attached to tapered cannula bodies.should have kink resistant wire wound bodies. size 8 fr., 10fr., 12fr., 14fr., 16fr., 18fr., 20fr., 22fr., 24fr , annuloplasty flexible ring tricuspid flexible design, suitable for mics,open sternotomy and robotics sizes : 25,27,29,31,33 , annuloplasty rigid ring sizes 24,26,28,30,32,34 saddle shape, mitral ahcwr, titanium core maintains the anatomical shape, efficient distribution of leaflet stress and chordal tension , annuloplasty semi rigid ring sizes 24,26,28,30,32,34 semirigid, mitral 3 dimensional, promotes annular remodelling , antegrade cardioplegia cannulae 12/14/16 fr. with vent and without vent. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 10fr. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 12fr. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 14fr. , anterior posterior nasal packing catheter (for epistaxis cases) , anterior vitrectomy pack infinity, for cataract surgery , anterior vitrectomy pack oertli for ophthalmic surgery , antiseptic skin cleaning wipes : key ingredients : alcohol free , ph balanced, chlorhexidine gluconate (chg) , vitamin e, aloe vera ; size 24cm x 30cm ; 10 wipes packed in resealable pouch per pack , antiseptic skin cleaning wipes for baby : key ingredients : alcohol free , ph balanced, neem extracts vitamin e, aloe vera ; size 15cm x 20cm ; 10 wipes packed in resealable pouch per pack , antiseptic skin cleaning wipes for neonatal : key ingredients : alcohol free , ph balanced, aqua fruit extracts, preservative ; size 15cm x 20cm ; 10 wipes packed in resealable pouch per pack , aortic punch blade should be able to float around the punch. punch should be available with tapered cutting blade to increase visibility.should be available in all functional sizes size 2.0mm ; 2.5mm ; 3.0mm ; 3.5mm ; 4.0mm ; 4.5mm , aortic root cannula should have radiopaque tips attached to clear pvc bodies.additional features: aortic root pressure monitoring and left heart venting.can be used to aspirate air emboli as well administer cardioplegia. sizes 4 fr ; 5fr ; 7fr ; 9fr ; 11fr , aortic root cannula with vent linesizes 5 fr 11 fr should have radiopaque tips attached to clear bodies with separate vent line. 5fr , 7fr , 9fr , 11fr , aortic root cannula pediatric neonatal sizes 4 fr should be able to aspirate air from aorta, should have radiopaque tip and standard 50.5 in length or a shortened 2.5 in. , arterial cannula for arch cannulation sizes 20fr. , 22fr , 24fr. should have elongated one piece wire wound body with radiopaque suture ring and dilator with depth markings. , arterial cannula angled with diffused flow tip sizes 18 fr 24fr, should be one piece wire wound body with integrated flutes for diffused flow. 18fr , 20fr, 22fr, 24fr , arterial perfusion cannulae pediatric sizes: 8fr, 10fr, 12fr,14fr and 16fr.non wire reinforced bevel tip.overall length 18cm with suture bump. , arterial cannula ; with on off switch to prevent backflow and exposure of blood to healthcare professional ; perforated wings to provide secure fixation, ventilation and to prevent skin maceration. size : 20g , arterial blood collection syringe ; reducing the burden on paramedical staff of manually preparing the abc syringes ; spray dried calcium balanced lithium heparin improves accuracy and consisstency ; tip cap on the syringe for safe transportation ; size : 3ml , artificial dural grafts all sizes , arteriotomy cannula should have polyurethane tube with a bulb shaped tip connected to winged female luer. sizes 2mm, 3mm, 4mm, 5mm, 6mm , arteriotomyshunts(intra coronary shunts) should be beveled tip. should have fully transparent body. sizes 1.0 mm. ; 1.25mm ; 1.5mm ; 1.75mm ; 2.0mm ; 2.5mm ; 2.75mm ; 3.0mm , av shunt (silicon) arm , av shunt adult , av shunt connector adult , axillary artery one piece cannula with central arterial pressure measurement should have elongated one piece wire wound body with radiopaque suture ring and dilator with depth markings.should have integrated pressure monitoring port at tipsize 18fr ; 20fr ; 22fr ; 24fr , baby drape : for all kind of surgeries n baby. translucent sof poly film size 1.2 x 1.2m ; incise area 25 x 20cm eto sterilisez. 5 yrs expiry self life. packing material 45gsm polypropylene one side and another side tyvek paper packing. , bain circuit with apl valve and bag (adult) , bain circuit with apl valve and bag (paed) , balloon inflation device/syringe , balloon maxillary sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , balloon frontal sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , balloon sphenoid sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , bandage than (100cm x 20 mtr) as per schedule f ii , biopsy gun used for obtaining histological core samples from soft tissue and organs. should be fully automatic. it should have echogenic and atraumatic needle tip , ergonomic and light weight , cannula with depth marking , easy and one hand operated with two stage arming , available with / without coaxial needle ; size 14g 10 & 16 cm / 16g 10 , 16 & 20cm / 18g 10, 16, 20, 25cm / 20g 10, 16, 20cm , biopsy gun used for obtaining histological core samples from soft tissue and organs. should be semi automatic. it should have echogenic and atraumatic needle tip , ergonomic and light weight , cannula with depth marking , easy and one hand operated with two stage arming , available with coaxial needle ; size 14g 10 & 16 cm / 16g 10 , 16 & 20cm / 18g 10, 16, 20, 25cm / 20g 10, 16, 20cm , biological glue 15 gm , biological indicators , bipolar and monopolar cautery leads for laparoscopic surgery , bipolar and monopolar cautery leads for turp procedure , bipolarcautery forecepsallshapes(bayonetandstraight)andsizesforuseinadultandpediatricuse.tobe compatible for use with valleylab, megadyne and erbe surgical electro cautery machines , bis monitor universal electrodes , bite block with strap adult and paed , bladder evacuator device all type & all sizes , bloodtransfusionset : dehpfreeand eo sterile. conforms to iso 1135 4 standard, sharp non vented spike suitable for blood bags and all type of standard blood containers, — provided with a cylindrical drip chamber with 200? filter to prevent the passage of any clot in the chamber, flash ball type injection port for extra medication, comes with smooth 150 cm long, kink resistant tube, efficient roller controller for accurate adjustment of transfusion rate. sterile, individually packed. , blood tubing for dialysis adult , blood tubing for dialysis paed , blower mister handle , blower mister should have specialized nozzle utilizing a micro orifice for fluid delivery and a separate orifice for gas delivery.should have the malleable shaft and on/off control on the hand piece. , blower mister without tubing , bone cement all type , bone marrow aspiration needles (one time use) – pediatric & adult. all types & sizes , bone marrow aspiration needles(reusable, autoclavable)– pediatric & adult. all types & sizes , bone marrow biopsy needle one time use (adult+pediatric) , bone marrow biopsy needles (reusable, autoclavable) – pediatric & adult. all types & sizes , bone wax , bottom sheet with adhesive 135 x 200 1 ( impermeable waterproof soft fabric ) , bovine pericardial patch size: 4cmx4cm, 6cmx6cm, 8cmx8cm , bp blade all size ( size 10 24 ) , bp cuff (manual): all adult and pediatric sizes , buffant cap non woven disposable female crimp cap : • should be of good quality. • made from non woven breathable fabric of 15 gsm • well fitted with double elastic or string. • air permeable. • properly ultrasonically sealed for uniformity. , bulldog vascular clamps (steel) all types and sizes. (straight and curved, all lengths) , c section kit sterile consist of 1 foil polyglactin 910 with triclosan coated no. 1 0 & no 1 & 1foil fast absorbing pg 910 3 0 , c – arm cover disposable , c arm cover (two part and three part) , cardiac sump sucker , cardio vascular patch eptfesizes: 5cm x 15cm x 0.6mm , cardio vascular patch eptfesizes: 3cmx 6cm x 0.4mm , cardio vascular patch eptfesizes: 10cm x 15cm x 0.6mm , cardioplegia cannula for ostial cannulation convex tip 10 fr 45° , cardioplegia cannula for ostial cannulation convex tip 10 fr 90° , cardioplegia cannula for ostial cannulation convex tip 12 fr 45° , cardioplegia cannula for ostial cannulation convex tip 12 fr 90° , cardioplegia cannula size infant: cardioplegia cannula should be made of soft 100% silicone & should be tapered conduit with distal open tip having adjacent lateral eyes, followed by a flange for secure positioning. it should have proximal luer lock & a ss needle with hub. size: infant. , cardioplegia needle neonatal, pediatric and adult sizes. 5fr and 8 fr should have stainless steel tip with plastic depth stop, needle should be attached to flexible pvc tubingwhich should include a drape clamp and female luer. size 5 fr. , cardioplegia needle neonatal, pediatric and adult sizes. 5fr and 8 fr should have stainless steel tip with plastic depth stop, needle should be attached to flexible pvc tubingwhich should include a drape clamp and female luer. size 8 fr. , cardiotomy venous reservoir adult , cardiotomy venous reservoir pead. , cardiotomy venous reservoir neonatal , care stream dr film size 10 x 12 , care stream dr film size 14 x 17 , care stream dr film size 8 x 10 , carpentier bi caval femoral venous cannula, sizes : 24/29 fr, should have wire wound kink resistant two stage design. , carpentier bi caval femoral venous cannula,sizes : 30/33fr should have wire wound kink resistant two stage design. , catheter mount (smooth bore flexible corrugated tubing) with double swivel patient connector with suction port , catheter mount (extendable) 22m/15f patient connector, 22f machine side connector , catheter mounts with double swivel patient connector with two openings for bronchoscopy and suction , cautery knife cleaner (sterile) , cautery knife cleaner (unsterile) , cautery lead for monopolar (disposable) , cautery pad adult (split type) , cautery pad paed. (split type) , cautery pencil, ptfe coated with adjustable length. , cauterytipswithptfecoated/nonstickdisposableblade/disposableneedle/disposableballptfeinsulation , centera cath arterial line all size , central venous catheter set – (3 4 fr ; length 10 15 cm ; should have polyurathane double lumen kit with flexible distal tip fully radio opaque should have flexible distal tip fully radio opaque graduation each centimeter from 5cm to the distal tip , should have distal & proximal lumen 18 g each for rapid infusion, 1 introducer needles , 1 guiding syringe 5 ml, 1 guide wire with j tip nitinol , 1 dilator with stopper, 1 scalpel, 1 fixation device) , central venous catheter set – (4.5 fr ; length 6 & 12.5 cm ; should have polyurathane double lumen kit with flexible distal tip fully radio opaque should have flexible distal tip fully radio opaque graduation each centimeter from 5cm to the distal tip , should have distal & proximal lumen 18 g each for rapid infusion, 1 introducer needles , 1 guiding syringe 5 ml, 1 guide wire with j tip nitinol , 1 dilator with stopper, 1 scalpel, 1 fixation device) , central venous catheter set – size : double lumen : 7 fr, 16 cm, 14/18 g, 18/18g. ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen : 4.5fr, 5 fr 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen : : 7 fr, 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen :8 fr, 8,5fr 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter, peripherally inserted 3 fr containing 1 splitting introducer needle and one radiopaque catheter single lumen 10 to 20cm length, 1 3ml syringe 1 syringe adapter, 1 removable connector with integral extension tube 10 cm with secondary fixation unit please quote for all types of central venous catheters made of polyurethane and silicone , chemo procedure gowns sms & polyethylene coating as per astm f1671 & tested against chemo drugs , chest drain bag with underwater seal,capacity 500ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chest drain bag with underwater seal,capacity 1000ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chest drain bag with underwater seal,capacity 2000ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chiba needle (all sizes and gauge) to be used for fine aspiration for cytological study , closed suction system ( 24hr / 72 hr ) minimises the risk of vap incidences in ventilated patients, kit should have 3 easily replaceble catheter minimising the need to replace entire suction system every 24 to 72 hrs. , catheter with lateral eyes, smooth tip and depth marking for maximum patient comfort, mdi port to provide an effective, quick and convienent way of drug delivery, ittigation port with one way valve allows lavage and irrigation of the suction catheter, on and off valve allow suction catheter tip to be isolated and create an enclosed cleaning chamber, transparent connectors and durable sleeve facilitates catheter manipulation and prevents infiltration of blood and sputum, 360 degree swivel elbow enables rotation for enhanced patient comfort and reduces torque ; size 6fr, 8fr, 10fr, 12 fr, 14fr, 16fr. , closed wound suction unit 06fr.to 08fr , closed wound suction unit 10fr, 12fr, 14fr, 16fr, 18fr, , colostomy bag , colostomy pouch with softflex skin barrier *without tape border *without starter hole *without integrated filter * odour barrier film *soft wire closure * barrier opening up to 15 mm & pouch length 11.5 cm. , combined spinal epidural kit , consumable for cardiac output monitor flotrac cardiac output sensor for cardiac output monitor of make edwards , consumable for cardiac output monitor ibp/ cvp transducer for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor large for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor medium for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor small for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor neonatal for cardiac output monitor of make edwards , consumable for cardiac output monitor acumen iq hpi sensor with ai for cardiac output monitor of make edwards , consumable for cardiac output monitor ibp cable for cardiac output monitor of make edwards , consumable for cardiac output monitor truclip or sensor holder for cardiac output monitor of make edwards , cord clamp, plastic individually packed , coreskintemperatureprobeswiththeprovisionoffreesupplyofinterfaceadaptors/cables(ifrequired)for comapatible with infant open care systems like dragger (an 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract , coreskintemperatureprobeswiththeprovisionoffreesupplyofinterfaceadaptors/cables(ifrequired)for comapatiblewith infantopen care systemslike fischerand paykel(presently installed inneonatalicu)(an 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract. , coronary artery retraction clips sizes 3mm and 5mm should be designed to improve exposure to a coronary anastomosis site.should be able to small prongs and gently hold tissues away from the vessel to improve vision. , corrugated drainage sheet , cpap infant nasal delivery circuit adaptor & sizing kit , cpap infant nasal prongs ;all sizes , cpap mask infant nasal interface all sizes , cr film 10 x 12 , cr film8 x 10 , craniotomy drape (50gm sms polypropylene fabric water repellent size: 1.6x3.2mm) ; adhesive area : 20cm dia. side channel & collecting funnel. olysheet lining 1.20 x 1.20m ; sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , crepe bandage 2 , crepe bandage 4 , crepe bandage 6 , ctg paper , cuff inflator/ pressure guage , cusa irrigation tubing suction compatible with soring machine for neuro surgery ot. , cvp manometer disposable : cvp measuring device suitable for continuous or intermittent monitoring of central venous pressure during infusion, particularly in icu, ccu, ots and casualty departments , manometer tube with graduation from 4 cm to +34 cm and attached to three way tap, provided with 120 cm long extension tube, fitted with female luer lock on one end and male luer lock on the other end for safe connection to the central venous catheter, latex free injection site is provided for extra medication, sliding indicator provided to record previous reading, moulded clamps with latex free rubber strings for easy fixation on the intravenous stand , sterile, individually packed in peelable pouch. , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 2” x 2”, inches , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 4 x4” inches , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 6x6 ‘ inches , delivery kit (sterile) consisting of the following: setup cover 100x195 cms; under buttock drape 75x125 cms; abdominal drape 100x150 cms; hand towel; cord cl baby blanket;vaginal sponge; maternity pad; placenta basin; abdominal sponge ( x ray opaque ) ; baby wipe ( 60 x 60 ) ; maternity mesh panty ; perineal sheet with legging ; underpad with collection bag ; waste bag ; id band ( paediatric ) ; id band ( adult ) , dialyser cellulose acetate – 0.5m2 , dialyser cellulose acetate – 1.0 m2 , dialyser cellulose acetate – 1.2 m2 , dialyser cellulose acetate – 1.5 m2 , dialysistenckhoffstraightcatheterkitscontaining16frpullapartsheath/dialator,18gaintroducerneedle,tunneling stylet, j/str, guidewire etc all sizes , dialyzers (multi use) polyphenylene membrane with polypropylene housing material. steam sterilized and bpa free all sizes , dialyzers (single use) polyphenylene membrane with polypropylene housing material. steam sterilized and bpa free all sizes , diapers (neonatal size (for babies weighing 1 to 3 kg) extra small size , diapers (neonatal size (for babies weighing 1 to 3 kg) small size , diapers adult (large) , diapers adult (medium) , diapers adult (small) , diapers adult (xtra) , diapers paed (large) , diapers paed (medium) , diapers paed (small) , digitalbp apparatus (formeasurementof blood pressure and pulse, should be able to detect systolic and diastolic bloodpressureandpulse,should bebased uponoscillometry principle,shouldgivedigitalresultsonlcddisplay. should have minimum 1 year warranty. , disposable connector all sizes; , disposable connector all sizes;y, without leur lock , disposable connector all sizes;y with leur lock , disposable connector all sizes;straight with leur lock , disposable connector all sizes;straight without leur lock , disposable enema nozzle , disposable eyepads (100%cottongauze,16 ply,ovalshaped, 75x95mm,pairpack),– individualunsterilepouch pack– individual sterile pouch pack , disposable e z clean 23/4 needle electrode , disposable fine tip marker pens for the identification and labeling drugs, radiology films, syringes, vials for individual patients (red, black, green) , disposable fine tip and bold tip skin marker pensforthe identification and labeling of individualpatients during surgery or other procedure (red, black, green) sterile water proof, indelible non toxic ink (with scale) , disposable full face cpap mask with standard 22m connection with 360° swivel connector, size 3, 4, 5, 6, and 7 , disposable hand control button switch cautery pencil with ez clean (ptfe coated) blade electrode , disposable hand control button switch pencil with ace blade electrode with holster , disposableindwellingbowelcathetersystemkitconsistingofonecatheter,two2000mlclosedodor barrier collection bags, two skin barriers, two lubricating jelly packets, one 1000 ml irrigation bag , disposable inner cannula for fenestrated tracheostomy tube size 7 & 8 mm , disposable kellys pad with automated measurement with collection pouch , disposable laryngoscope miller blades , disposable oxygen mask with silicon cuff & 2mtr star lumen tube (adult) , disposable oxygen mask with silicon cuff & 2mtr star lumen tube (paed / child ) , disposable pcnl drape sheet consisting of 1no. pcnl sheet, 4pcs drape sheet, 1pcs trolley cover(large), 1pcs trolley cover(small),1pcsmayotrolleycover,1pcsbedsheet,1pcsscreencoverwithadhesiveshouldbecustomised according to the requirement with additional components hydrohead 50cm, treated antistatic fabric static decay<1sec., weight 50gsm sms fabric, asorbent material near fenestration min 60gsm spun bond and polyethylene laminated and absorbency should be 4 times of its weight., manufactured in 100 000 class clean room , disposable single tubing all sizes (½,?,¼,3/16) , disposable single tubing sizes ? , disposable single tubing sizes ½ , disposable single tubing sizes 3/16 , disposable skin grafting blades , disposable sterile bed sheet – non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe, 160x260 cm (provide all details of gsm, type of fabric and method of sterilization) – white, green and blue – , disposablesterilefoley’scatheterinsertionkitconsistingof : 1. packed in csr overwrap (non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe )– 54x54 inch. 2. two pair gloves – size 7.0 and 6.5. 3. one waterproof underpad – size 3x4 feet. 4. one poly lined non woven fabric fenestrated drape – size 4x4 feet, fenestration size 15x15 cm. 5. outer plastic paper kidney/basin tray 1000 cc. 6. syringe 20 ml. 1 pc 7. syringe 5 ml. 1 pc 8. one povidine iodine ointment. 9.one lubricating jelly – 15 ml pouch/tube. 10. gauze sponges / pads (100% cotton woven, yarn:40s, mesh:, 26x18) 4x4 inch 08 ply with folded edges sterile peal open – four piece pack. , disposable sterile pillow cover non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe – 45x65 cm (provide all details of gsm, type of fabric and method of sterilization) – white, green, orange, yellow and blue , disposablesterilestretchersheetnonwovenfabric–singlepack(providealldetailsofgsm,typeoffabricand method of sterilization) –white, green and blue , disposable straps (head gear) for full face niv mask , disposable straps (head gear) for nasal niv mask , disposable tongue depressor wooden/plastic, individually packed (small/medium/large) , disposable, nasal prongs, neonatal , double lumen catheter to accommodate 2 guidewires , double lumen catheter to accommodate 2 guidewires 6.0/10.0 fr,50cm length , double lumen tube : robertshaw tube designed to fit patients anatomy for thoracic or pulmonary surgery and single lung long term ventilation. anatomically correct curvatures facilitate proper placement and intubation. high volume/low pressure tracheal cuff has a true barrel shape that minimizes pressure on the tracheal tissue and a uniquely shaped bronchial cuff helps prevent accidental upper lobe occlusion, tracheal cuff seperates the lung from the environment , bronchial cuff seperates the lungs from each other , colour coded pilot balloons with luer lock connector, marked with the name of the lumen (tracheal or bronchial) for easy identification , d shaped lumina provide maximum cross sectional area , minimising resistance to gas flows , provided with double swivel connections with double caps , sterile, individually packed. size 35/37/39/41fg (left) , double lumen tube : robertshaw tube designed to fit patients anatomy for thoracic or pulmonary surgery and single lung long term ventilation. anatomically correct curvatures facilitate proper placement and intubation. high volume/low pressure tracheal cuff has a true barrel shape that minimizes pressure on the tracheal tissue and a uniquely shaped bronchial cuff helps prevent accidental upper lobe occlusion, tracheal cuff seperates the lung from the environment , bronchial cuff seperates the lungs from each other , colour coded pilot balloons with luer lock connector, marked with the name of the lumen (tracheal or bronchial) for easy identification , d shaped lumina provide maximum cross sectional area , minimising resistance to gas flows , provided with double swivel connections with double caps , sterile, individually packed. size 37/39/41fg (right) , double lumen endotracheal tube (for olv) adult all sizes , double lumen endotracheal tube (for olv) paed all sizes , double lumen jugular catheter kit with laser cut side slots (all size) , double lumen jugular catheter with laser cut side slots (all sizes) , double lumen straight catheter kit with laser cut side slots (all sizes) , double lumen straight catheter with laser cut side slots (all size) , double prong needle for urethral sling , double stage venous cannula round and oval shape, should be two stage cannula with oval body in various sizes.should be two stage cannula with round body in various sizes.should have cannula body with thin walled with depth markings. different sizes 28/36fr. ; 32/40 fr ; 36/46fr;32/46fr ; 36/51fr , drape c.a.b.g. drape set : • made up of reinforced spun bond film composite material, blue laminate of polypropylene non woven fibers and polyethylene film. • highly absorbent yet impervious across entire drape. • low linting, non breathable, abrasion resistant, durable, strong tear resistant, conformable, with self adhesive containing hypoallergenic acrylate type adhesive with a silicone coated paper liner.• cabg pack:4 self adhesive cautery bags (30cmx35cm),3 op tapes(10cmx55cm),4 lint free hand towels (23.5cmx38cm),4 self adhesive towel drapes (91.5cmx100cm),1 self adhesive medium drape (183cmx183cm),1 self adhesive large drape(150cmx250cm),1 instrument table drape (150cmx200cm),1 large instrument table drape (183cmx240cm),1 self adhesive bilateral split drape (183cmx200cm),2 triangular drape (91.5cm x 91.5cm x 129cm). • sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , drape c arm drape 41 inch x 74inch , drape eye drapes (gsm polypropylene fabric 100x70cm with drainage pouch , drape universal extremity drape, sms fabric and dimension 90 x 131 in., fenestration one 2.5 in. conformable circular, fabric tube holders, control plus fabric reinforcement, ce certified, aami l 4 compliance , drape lamino spinal drapes all sizes , drape shunt drape , dressing paraffin gauze 10 x 10 cm in packs/ box of ten pieces , dressing paraffin gauze 15 cm x 2 m roll , dressing parafin gauze 10 x 30 , dressing silk protein & antimicrobial nanosilver based sterile soft, conformablesurgical pu foam dressing (non adhesive) 20 x 20cm , dressing silk protein & antimicrobial silver based bilaminated sterile surgical mesh wound dressing 20 x 25cm , dressing silk protein & antimicrobial silver based bilaminated sterile surgical mesh wound dressing 20 x 40cm , dressing silk protein & nanocrystalline silver based sterile, non adherent, antimicrobial gauze dressing 10x25cm , dressing silk protein based sterile non adherent gauze dressing to cover the wounds 10x25cm , dressing silk protein based sterile soft, conformable surgical pu foam dressing (non adhesive) 20x20cm , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 2in x 2in ( 5cm x 5cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 4in x 5in ( 10cm x 12.5cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 4in x 10in ( 10cm x 25cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 8in x 10in ( 20cm x 25cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 2in x 2in ( 5cm x 5cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 4in x 5in ( 10cm x 12.5cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 4in x 10in ( 10cm x 25cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 8in x 10in ( 20cm x 25cm ) , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes1x1 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes2x2 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes1x3 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes 3x3 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes4x5 , dviu knife , ecg cable compatible with bpl and schiller ecg machine , e c g electrode adult (button type) , e c g electrode neonatal (button type) , e c g electrode paed.(button type) , e c g jelly (250ml) , e c g jelly (5 kgs jar) , ecg paper roll compatible with schiller machine , ecg paper roll compatible with bpl machine , ecg paper roll for 12 channel ecg machine , model : cardiomin 12b , echo jelly (250ml) , eeg paste 250gms , elastic adhesive bandage size 10cm 4/6 mtr. (stretched length) , electric jet nebulizers. compresseor based jet nebulizer, light weight < 2 3 kgs, power 220v 50 hz ac, treatment time < 10 min, nebulization quantity: 10 ml, mmad: 80% < 5 micron, compressor pressure 40 50 psi, maximum flow rate: 8 10 lpm, operating flow rate: 6 8 lpm @ 10 psi lmp/psi, sound level, 50db, , electrical breast pump with one year warranty , embolectomy catheter 2fr to 9 fr , embolectomy catheter with perfusion channel all types and all sizes , endo mechanical circular stapler (cutter & stapler) (all types and all sizes) for open and laparoscopic surgery , endo mechanical contour stapler (all types and all sizes) , endomechanical disposabledissectingandgraspingforcepssize5mm,30 35cmlength,withoutrachet, insulated with connector pin for unipolar coagulation , endo mechanical haemolock clip applicator – for open surgery , endo mechanical haemolock/weck locking clip applicator 10mm (all size clips)– for laparoscopic surgery , endo mechanical hand piece / shears all types (open surgery and laparoscopic) and all sizes for use with bipolar vessel sealing device ligasure. , endo mechanical hemorrhoid surgery stapler all types & all sizes , endo mechanical hemostatic titanium vascular clips all types & all sizes (such as liga clips) , endo mechanical laparoscopic disposable cannula without trocar, with sealing valve/cap.all sizes and all types (pediatric, adult and bariatric) 15, 12, 10, 5, 3 mm with various lengths , endo mechanical laparoscopic disposable trocar and cannula set with sealing valve/cap. all sizes and all types. (pediatric, adult and bariatric) 15, 12, 10, 5, 3 mm with various lengths , endo mechanical laparoscopic endo bags for specimen retrieval disposable all sizes , endo mechanical laparoscopic equipment cleaning and maintenance devices , endomechanical laparoscopicneedleholder:5mmstriaghthandlewithdisengagableratchet,straightjaw,size 5mm, length 30 35cm, for use of 0/0 to 7/ sutures , endo mechanical linear cutter & stapler (all types and all sizes) open and laparoscopic surgery , endo mechanical linear staplers (cutter and stapler) for use in laparoscopic bariatric surgery (all types and all sizes) , endo mechanical ultrasonic energy consumables (probes, shears and hand pieces) all types and all sizes , endo mechanical ultrasonic shears (laparoscopic&open)all typesand allsizes(handpiece& hand probes,all types and all sizes) , endo mechanical haemostatic locking clips (like haemolock clips) all types and all sizes, along with provision of free applicators , endo mechanical screw shaped 5 mm polyglycolic lactic acid absorbable tacker laparoscopic mesh fixation devices, all lengths and capacity , endo mechical complete range of probes to be used in laparoscopic & open surgery cases using energy device compitable for ligasure (ls 10) vessel sealing system , endo mechnical anchor shaped 5 mm absorbable tacker laparoscopic mesh fixation device, all length and capacity , endo mechnical laparoscopic hand instruments reusable, indian make. 5mm. such as graspers and dissectors of variouskinds:maryland,fenestrated,atraumatic,toothed,etc.withrachetandwithoutrachet;scissorsofvarious kinds, needle holders, retractor, suction irrigation system. 30 35 cm length. , endo mechnical ligature clips in all sizes compatible with existing aesculap clip applicators. , endo mechnical linear stapler (all types and all sizes) open and laparoscopic surgery , endomechnical reloads(cartridges)fordisposablestaplers(foropenandlaparoscopicsurgery)(alltypes& sizes) , endo mechnical reloads (cartridges) for re usable (steel) linear staplers (all types & sizes) , endo mechnical reusable endo loop applicator (2300 mm length) , endo mechnical reusable linear cutter & stapler (all types & sizes) , endo mechnical titanium (liga) haemostatic clip applicators – for open surgery all sizes , endo mechnical titanium (liga) haemostatic clip applicators – for laparoscopic surgery all sizes 5mm and 10mm , endotracheal tube (north polar) – preformed et tube plain sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (north polar) – preformed et tube cuffed sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (south polar) – preformed et tube plain sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (south polar) – preformed et tube cuffed sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube plain, pvc , size 2.00mm 5.00mm ;manufactured from thermo sensitive material readily conforming to body contours at body temperature. kink resistant and transparent material to reduce any possiblity of occlusion in the tube bore, nasoral tip suitable for nasal/oral intubation, murphy eye with smooth edges and tip to reduce any trauma to the patient during procedure, provided with radio opaque line throughout the length for x ray detection and assistance in placement, proximal end is fitted with standard 15 mm connector which can snugly fit with other commonly used connectors, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed, pvc ,size 2.00mm 5.00mm : manufactured from thermo sensitive material readily conforming to body contours at body temperature. kink resistant and transparent material to reduce any possiblity of occlusion in the tube bore, nasoral tip suitable for nasal/oral intubation, murphy eye with smooth edges and tip to reduce any trauma to the patient during procedure, provided with radio opaque line throughout the length for x ray detection and assistance in placement, proximal end is fitted with standard 15 mm connector which can snugly fit with other commonly used connectors, sterile, individually packed in peelable blister pack. , endotracheal tube plain , size 5.00mm 10.00mm : thermo sensitive tube conforms to the tract anatomy , kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , size 5.00mm 10.00mm : thermo sensitive tube conforms to the tract anatomy , kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector, sterile, individually packed in peelable blister pack. , endotracheal tube plain, silicon and pvc blend , size 2.00 mm to 5.00 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , silicon and pvc blend : size 2.0 mm to 5.0 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , silicon and pvc blend : size 5.5 mm to 10.0 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , with subglottic suction line : thermo sensitive tube conforms to the tract anatomy, should have special suction port for removal of subglottic secreretions using syringe / suction minimize the risk of vap, kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector at proximal end ,sterile, individually packed in peelable blister pack. , endotracheal tube holder adult & paed , endotracheal tube t piece , endotracheal tube with cuff pressure monitoring all sizes , endotrachealtubewithsecondarylumenfortrachealirrigation(fordeliveryofsurfactant/orothermedications) pvc/silicone based, sizes internal diameter 1,2.0,2.5,3.0,3.5,4.0,4.5 mm , ent pediatric airway balloon catheter 5mm x 24mm / 7mm x 24mm / 9mm x 24mm , ent adult airway balloon catheter 10mm x 40mm / 12mm x 40mm / 14mm x 40mm / 16mm x 40mm , ent balloon inflation device , epidural catheter : soft tip epidural is specially designed for continuous anaesthesia and pain relief therapy ; catheter should be made from unique plasticizer free polymer with excellent bio compatibility ; flexible and atraumatic soft tip with three lateral eyes ; catheter should be printed to determine the depth of insertion and accurate placement in the epidural space ; luer lock twist commector ; crystal clear catheter with radio opaque line. , epiduralanaesthesiakitwithg18/16epiduraltouhyneedle,doublelayeredepiduralcatheterg20/g19. with crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter and lor syringe with parabolic graduation markings , epiduralanaesthesiakit latex freewithg18/16epiduraltouhyneedle,doublelayeredepiduralcatheterg20/g19 length 100cm.with crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter and lor syringe with parabolic graduation markings , epidural anaesthesia tray latex free withg20 epiduraltouhyneedle of length 5cm,doublelayeredepiduralcatheterg24 length 72 cmswith crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter attachable to pin pad present in kitand lor syringe with parabolic graduation markings , esmarch bandage 3 , esmarch bandage 4 , esmarch bandage 5 , extension line 100cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , extension line 150cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , extension line 200cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , external collecting urinary device , external defibrillating patches (all sizes) compatible for philips/ medtronic/mindray , face mask n 95 without respirator niosh certified , face mask with tie on : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm.tie string: 90 cm. , face mask with smooth elastic ear loops : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm. , face mask with eye shield (disposable) for full protection against any spurt/splash with tie on : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm.tie string: 90 cm. , facial oxygen tent mask adult / paed , femoral arterial cannulae; wire reinforced overall length should be 19.5.2 cm with ¼ vented connector sizes: 8fr ; 10fr ; 12fr ; 14fr. , femoral arterial cannulae; wire reinforced overall length should be approx. 24cm with 3/8 vented connector sizes: 16fr, 18fr and 20fr. , femoral catheter double lumen , femoral catheter single lumen paed , femoral catheter single lumen adult , femoral catheter straight 11.5f * 16 cm , femoral multistage venous cannulasizes: 29/29/29 fr should be one piece wire wound multiple side holes body with percutaneous kit. , femoral multistage venous cannula sizes: 29/46/37 fr should be one piece wire wound multiple side holes body with percutaneous kit. , femoral venous cannulae; wire reinforced overall length should be approx. 24cm with ¼ non vented connector.sizes 8fr, 10fr, 12fr and 14fr.. , femoral venous cannulae; wire reinforced overall lengthshould be 752 cm with 3/8 non vented connector sizes 18fr. ; 20fr ; 22fr ; 24fr ; 28fr , fibrin glue for ophthalmic surgery , fine suction tip for ent , fistula canula for hemodialysis with anti reflective valves and safety needle, length 30mm/38 mm (all sizes) , fistula needle , flexo metallic endotracheal tube plain : size : 3.00mm to 5.00mm flexo metallic endotracheal tube for airway management intended for use in surgeries demanding flexible head or neck position , specially designed suitable to laryngeo tracheal anatomy , tubes are fitted with a reinforced stainless steel spiral core to overcome any possiblity of the bore occlusion due to kinking or collapse of the tube , flexo metallic feature provides 100% kink resistance and anti crushing strength to the endotracheal tube , completely flexible tube with a thin,strong wall. high volume, low pressure cuff provides effective seal between tube and trachea and minimizes the risk of folds. radio opaque line with precise graduation marking guarantees proper placement of the tube , murphy eye ensures clear airway and no mucus blockage, sterile, individually packed. , flexo metallic endotracheal tube cuffed : size : 5.00mm to 10.00mm flexo metallic endotracheal tube for airway management intended for use in surgeries demanding flexible head or neck position , specially designed suitable to laryngeo tracheal anatomy , tubes are fitted with a reinforced stainless steel spiral core to overcome any possiblity of the bore occlusion due to kinking or collapse of the tube , flexo metallic feature provides 100% kink resistance and anti crushing strength to the endotracheal tube , completely flexible tube with a thin,strong wall. high volume, low pressure cuff provides effective seal between tube and trachea and minimizes the risk of folds. radio opaque line with precise graduation marking guarantees proper placement of the tube , murphy eye ensures clear airway and no mucus blockage, sterile, individually packed. , foley catheter 2way latex 6fr, 8fr, 10fr,silicon coated , foley catheter 2way latex 12fr,14fr, 16fr,18fr,20fr,22fr,24fr silicon coated , foley catheter 2way made of 100% silicon material 6fr, 8fr, 10fr , foley catheter 2way made of 100% silicon material 12fr,14fr, 16fr,18fr,20fr,22fr,24fr , foley catheter 3way latex 18f,20fr,22fr,24fr,26frsilicon coated , foley catheter 3way made of 100% medical grade silicon, the foley should have an inbuilt flow control stopper to regulate the urine flow, enable ease of mobility for patient and maintain bladder health,vballoon should be made of tear resistance silicon rubber size 18fr,20fr,22fr,24fr, 26fr , fourlumen centralvenouscatheter 8 f (cathertermaterial polyurethane certon with polyhexanide methacrylate withadditionalhydromercoating,fourlumen14/16/18g/18gwithlength15cm,catheterkitcontainingavalve needle 18 g, novlon material dilator, scalpel, guidewire made up of nitinol, an egg lead for and a safesite connetor , fuji dry laser film 10 x 12 , fuji dry laser film 8 x 10 , fuji dry laser film 14 x 17 , full gown material 50gsm(nw sms) front stichless,fluid barrier cuff (not knitted cuff) 1 nos.disposable bag 1 nos, plain sheet large(25 micron thick pe hygine fil of size 120x210 cm) 2 nos, water proof leggings (cover upto knee) 1 pair, cap 1 nos, mask 1 nos, paper hand towel 2nos, nitrite gloves (latex powder free double layer on finger tip) pair, googles (wearing on the any type of spectcle) 1nos, note: all the product should be in single sterilized pack.packet material 35gsm polypropylene one side and another side half part tyvek paper 35 gsm packing , gauge than(18mtr x 90cm) as per schedule f ii , gloves latex examination light powdered non sterile pack size 100/pk) , gloves latex non powdered for microsurgery all sizes , gloves sterile latex surgical gloves powder free(polymer coated) powder free gloves coated with unique blend of polymer to provide excellent donning capability, should conforms to is 13422:1992, astm d3577:2019, en 455 1:2020, en 455 2:2009+a2:2013, en 455 3:2006 & en 455 4:2009 standards specification, the physical properties, dimension & tensile strength of the material should be as per european ce/usfda standards, anatomically ahaped with micro rough surface in inner palm and in inner part of the finger area which provides good grip at wrist and in curved fingers. product should have shelf life of 5 years, sterilized by validated process cycle (iso 11135:2014), shouldpass viral penetration test as per astm f 1671, biologically compatible as per iso 10993 part 5, 7, 10 & 11 non toxic & non irritant.size 6 ; 6.5 ; 7.0 , 7.5 , 8.0 , 8.5 , 9.0 (in pair) , gloves sterile latex surgical gloves pre powdered, product should conforms to is 13422:1992, astm d 3577:2019, en 455 1:2000, en 455 2:2009+a2:2013, en 455 3:2006 & en 455 4:2009 standards specifications, lightly powdered with modified absorbable corn starch usp, sterilized by validated process cycle (iso 11135:2014), shouldpass viral penetration test as per astm f 1671, biologically compatible as per iso 10993 part 5, 7, 10 & 11 non toxic, non irritant & non pyrogenic. size in pair : 6 / 6.5 / 7.0 / 7.5 / 8.0 / 8.5 / 9.0 , gloves nitrile examination non sterile , gloves polyethylene (sterile) (in pair) , gloves polyethylene (non sterile) , glucometer test strip. each 1000 strip should be accompanied by a glucometer on free of cost basis. glucometer should not require code ( code free glucometer ) , should be able to use fresh capillary, venous, neonatal blood. accuracy should be as per international standard iso 15197 requirement for blood glucose monitoring system. should be capable of being stored continuously in ambient temperature of 0° to 50° celsius , should have capillary, venous, blood testing, all software update shall be provided free of cost . glucometer should be usfda approved or ce mark from notified body (eu) , goggles (disposable) for full protection against any spurt / splash , graft woven trifurcate 12mm x 6mm x 6mm, 40 50 cm in length, gelatin coated. , graft woven trifurcate 14 mm x 7mm x 7mm, 40 50 cm in length, gelatin coated. , graft woven trifurcate 16mm x 8mm x 8mm, 40 50 cm in length, gelatin coated. , graft : regular & small beadings (rings) ptfe graft all sizes and length. , graft dacron bifurcated woven grafts 12mmx6 mm with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 14mmx7mm, with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 16mmx8mm, with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 18mm x9mm with 40 50 cms length,collagen coated. , graft knitted dacron straight graft 6mm to 16 mm with 30 35 cm length,collagen coated. , graft knitted dacron straight graft 18mm to 24 mm with 30 35 cm length,collagen coated. , graft knitted dacron straight graft 6mm to 16 mm with 60 70 cm length,collagen coated. , graft knitted dacron straight graft 18mm to 24 mm with 60 70 cm length,collagen coated. , graft dacron knitted axillo bifemoral bifurcated graft with extended support, gelatin coated. , graft dacron knitted axillo bifemoral graft 90 degrees angle with 60 cm side branch 8mm and 0 mm, gelatin coated. , graft e ptfe stretchre in forced removable ringed thin wall pre configured axillo bi femoral vascular graft. size: 8mm diameter x 70cm/40cm length , graft e ptfe stretchre in forced removable ringed thin wall pre configured axillo bi femoral vascular graft. size: 8mm diameter x 90cm/40cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 6mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 7mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 8mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced removable ringed thin wall vascular graft.size: 6mm diameter x 50cm/70cm/80cm length. , graft e ptfe stretch re in forced removable ringed thin wall vascular graft.size: 8mm diameter x 50cm/70cm/80cm length. , graft ascendingaortic reconstruction graft : one piece design collagen coated valsalva graft for repair or reconstruction of the ascending aorta. one piece design collagen coated valsalva graft for repair or reconstruction of the ascending aorta.unique un crimped section that does not stretch should allow easy sewing of valve remnants or prosthetic valve should facilitate estimation of the length required for optimal placement of valve remnants or prosthetic valve to ensure optimal clinical outcomes. should have the ability to be precisely trimmed and shaped in case of remodeling technique procedures. at least 3 references line should act as a guide for prosthetic valve. coated polyester fabric cross linked type i bovine collagen water permeability < 5m * cm 2 min 1 @ 120mmhg , graft dacron straight woven grafts 6mm to 16 mm, 30 35 cm long, collagen coated. , graft dacron straight woven grafts 18mm to 28 mm, 30 35 cm long,collagen coated. , graft dacron straight woven grafts 30mm to 38 mm, 30 35 cm long,collagen coated. , graft dacron straight woven grafts 6mm to 16 mm, 60 70 cm long,collagen coated. , graft dacron straight woven grafts 18mm to 28 mm, 60 70 cm long,collagen coated. , graft dacron straight woven grafts 30mm to 38 mm, 60 cm 70 long,collagen coated. , graft dacron bifurcated knitted grafts 12mmx6 mm, with 40 50 cms length , graft dacron bifurcated knitted grafts 14mmx7mm with 40 50 cms length , graft dacron bifurcated knitted grafts 16mmx 8mm, with 40 50 cms length , graft dacron bifurcated knitted grafts 18mm x 9mm with 40 50 cms length , graft dacron woven 3 branch arch grafts 20mm to 34 mm,collagen coated. , graft dacron woven 4 branch arch grafts 20mm to 34 mm,collagen coated. , graft dacron woven thoraco abdominal grafts 20mm to 30mm, gelatin coated. , graft dacron woven graft 20 to 34mm with 8mm and 10 mm perfusion side branch, 40 50 cmlength, gelatin coated. , graft dacron woven extra length graft with offset branch graft 22 to 32 mm with 8mm perfusion side branch, gelatin coated. , graft dacron woven pre curved graft 22 mm to 32 mm with 8mm perfusion side branch, gelatin coated. , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 3mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 3.5mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 4mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 5mmdiameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 6mm diameter , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 2/6x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 14/7 x 40cm / 50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 16/8x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 18 / 9 x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 20 / 10 x 50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size :22/12 x40cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 24/12x40cm , graft e ptfestretch large diameter reinforced aortic vascular graft of all diameters and length , graft large diameters e ptfe grafts all sizes and length , graft : regular & thin wall e ptfe graft all sizes and length , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 6 mm diameter , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 7mm diameter , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 8mm diameter , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 6 mm diameter. , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 7mm diameter. , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 8 mm diameter. , guide wire 80 cm fixed core straight (for dialysis) , guide wire 80 cm j tip (for dialysis) , guide wire amplatz extra stiff wire guide 0.035” 300cm , guide wire amplatz ultra stiff wire guide 0.035” 180cm , guide wire amplatz ultra stiff wire guide 0.035” 260cm , guide wire hydrophilic in all dia sizes 150/180 cm (straight) , guide wire hydrophilic in all dia sizes 150/180 cm (j tip) , guide wire hydrophilic in all dia sizes 150/180 cm (straight) , guide wire hydrophilic in all dia sizes exchange length 260/300 cm (j tip) , guide wire hydrophilic in all dia sizes exchange length 260/300 cm (straight) , guide wire hydrophilic in all dia sizes exchange length stiff shaft 260/300 cm (straight) , guidewire 0.015 x 40 45 cm j and straight tip (neonatal) , guidewire 418 0.018x40 45 cm j and straight tip (neonatal) , guidewire hydrophilic ni ti alloy, kink resistance j tip 0.018, 0.032,0.035,0.038 inch x 150cm , guidewirehydrophilicni tialloy,kinkresistance,floppyandstraighttip(comparabletoterumo) 0.18, 0.032,0.035,0.038 inch x 150cm , guidewire hydrophilic stiff with floppy tip 0.032,0.035,0.038 inch x 150cm , guidewires0.018 straight tip an all length , half gown : material 25 micron thick made up of microporous hygiene breathable polyethylene films ; size 750 mm width x 1500mm length ; should be water proof , light weight , blood pathogen proof , latex free ; disposable , single use , eto sterile ; packing material : 45g polypropylene film one side and another side 25gsm tyvek paper with 5 years expiry life. , heart positioner for minimally invasive beating heart surgery should be a positioner with detachable shaft for mics via thoracotomy. , heart valve : aortic valved graftwith conduit hemashield technology with collagen impregnation provides uniform tissue ingrowth, biocompatability, low porosity no preclotting required wooven duble velour hemashield composite graft sizes : 19,21,23,25,27,29,31, , heart valve : bioprosthetic heart valve latest generation with racheting system, mitral, suitable for future viv, opens at 8 atm pressure, low profile height 9mm, less lvot obstruction, facilitates mics, innovative flexifit racheting system, improved radio opaque markers on the stent posts, c shaped steel wire wrapped for better flouroscopy visualisation, 1 cut release, porcine, double valour polyester, flexible copolymer, ptatented linx ac, sizes : 25,27,29,31,33 , heart valve : bioprosthetic heart valvelatest generation, aortic, suitable for future viv,opens at 8 atm pressure, improved radio opaque markers on the stent posts, c shaped steel wire wrapped aroundfor better flouroscopy visualisation, 1 cut release, porcine double valour polyester, flexible copolymer, linx ac, size ; 19,21,23,25,27 , hemodialyzers single use bpa free (all sizes) , high flow humidification system disposable , high flow infusion catheter2.5f,2.8f,3.0f , high flow nasal cannulae system (neonatal size),flexible,kink free tubing with adhesive pads to secure on skin, compatible with use with heated humdifier, sizes preterm neonate , term neonate, infant and paediatric applications , hiv universal protection kit full gown material 50gsm(nw sms) front stichless,fluid barrier cuff (not knitted cuff) 1 nos.disposable bag 1 nos, plain sheet large(25 micron thick pe hygine fil of size 120x210 cm) 2 nos, water proof leggings (cover upto knee) 1 pair, cap 1 nos, mask 1 nos, paper hand towel 2nos, nitrite gloves (latex powder free double layer on finger tip) pair, googles (wearing on the any type of spectcle) 1nos, note: all the product should be in single sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , hme filter , hot water bottle (made of good quality of rubber). , hub cutter ( manual ) , hub cutter ( with electricity ) , hydrocepahlus shunt high pressure , hydrocepahlus shunt low pressure , hydrocepahlus shunt medium pressure , hydrophillic guide wire .032 x 260 cm and .025x260 cm length , hypodermic disposable needles: smaller gauge (like 26g,24g,22g) 1.5 inch , iabp balloon (various sizes) compatible with data scope (macquet)iabp machine. , icd drainage bag , incentive spirometer ( breathing exerciser ) , infantcpapnasalprongs,3.0mmnarediameter/2.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,3.5mmnarediameter/2.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,4.5mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,4mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.0mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.5mmnarediameter/5.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.5mmnarediameter/6.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.0mmnarediameter/6.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.0mmnarediameter/7.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.5mmnarediameter/7.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infant feeding tubes with markings sizes 4fg / 5fg / 6fg / 7fg / 8fg / 9fg / 10fg , intra aortic balloon catheter 7.5fr. , intra aortic balloon catheter 8fr. , intra aortic balloon catheter 9.5fr. , introducer needle, 1fr, 18mm length , intubationstyletreusable(malleablealuminiumwithsmoothhighdensitypolyethyleneoutersleeve) size : 6fr , 10fr, 14fr , iodinate drape : small ; size 15 x 10 cm ; adhesive area : 10 x 10 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : medium ; size 50 x 25 cm ; adhesive area : 30 x 25 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : large ; size 50 x 35 cm ; adhesive area : 35 x 35 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : extra large ; size 90 x 45 cm ; adhesive area : 60 x 45 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , irrigation and suction tube 5mm size 5mm, length 43cm, suction and irrigation tubewith lateral holes with 2 way stopclock for single hand use , i gel laryngeal mask all size , iui cannula (curved) , ivadministrationsetfor photosensitive drugs (photosensitiveivset). should have uv resistant tubing, and priming filter. should be latex free and dehp free. , iv cannnula with wing without port 26g , iv cannnula with wing without port 28g , iv cannula with port with wing 14g , iv cannula with port with wing 16g , iv cannula with port with wing 18g , 20g , 22g , iv cannula with port with wing 24g , iv cannula with port with wing 26g , iv cannula with port with wing 28g , iv cannula with port with wing with safety from needle prick 14g , iv cannula with port with wing with safety from needle prick 16g , iv cannula with port with wing with safety from needle prick 18g , iv cannula with port with wing with safety from needle prick 20g , iv cannula with port with wing with safety from needle prick 22g , iv cannula with port with wing with safety from needle prick 24g , iv cannnula with port with wing with safety from needle prick 26g , iv cannula with wing without port 16g , iv cannula with wing without port 18g , iv cannula with wing without port 20g , iv cannula with wing without port 22g , iv cannula with wing without port 24g , i.v. cannula fixator crepe material , i.v. cannula fixator with semi premeable transparent film with pad , iv extension line 10cm with three way , iv extension line 100cm with three way , iv line filter with injection port , iv micro drip infusion set with drop size reduced to 60 drops per ml for paediatric and critical therapy, manufactured from non toxic , clear and transparent p.v.c material, sharp piercing spike for easy insertion in fluid container along with built in preventive bacterial air vent, infusion set has a cylindrical collapsible drip chamber for proper visulization od the drop rate, provided with disc type fluid filter to filter any particulate matter in the i.v fluid, long super smooth kink resistant tubing with efficient roller controller for accurate and unrestricted flow,y type injection port made up of silicone provided for extra medication, luer lock connector for secure fitment to all standard devices, sterile and individually ribbon packed. , iv microdrip set with burrette : measured volume set : 100ml ; 100% latex free provided with y type injection port made up of silicone for additional medication and luer slip connector, equipped with a micro drip with reduced drop size of 60 drops per ml, provided with a burette type chamber of 100 ml capacity with 10 ml overflow limit, burette chamber is made of bio compatible medical grade transparent styrene polymer, suitable for infusing all types of fluids, unique floating auto shut valve acts as a floating indicator and automatically shuts off the drain path to prevent the passage of air in the line, no kink device prevents kinking of tube during transportation and transfers, separate plugs for extra medication and change over, sterile, individually packed. , iv microdrip set with burrette : measured volume set : 150ml 100% latex free provided with y type injection port made up of silicone for additional medication and luer slip connector, equipped with a micro drip with reduced drop size of 60 drops per ml, provided with a burette type chamber of 150 ml capacity, burette chamber is made of bio compatible medical grade transparent styrene polymer, transparent , cylindrical & calibrated measured volume chamber with bold scale, bacteria retentive ait inlet on spike, microdrip with 60ml drops per ml, 15micron fluid filter in the drip chamber, tube length : 150cm, soft and kink resistant pvc tubing. , iv needle 16g/18g/20g in 1/2, 1 & 1.5 length , iv needle 21g/22g/23g/24g in 1/2, 1,1.5 length , iv needle 26g in 1/2, 1,1.5 length , iv set with airvent, dehp free, sharp and easy piercing air vented spike, bacteria retention air inlet with snap cap, approx 20 drops/ml, , iv set , safety infusion set, dehp free , vented spike fits tightly, ensuring easy insertion and removal, comes with unique air stop feature which is a hydrophilic filter membrane present at the bottom of the drip chamber which prevents the ingress of air in case of emptied fluid container, provided with an innovative prime stop, which is a hydrophobic membrane placed on the luer lock fitting that stops fluid leaking and dripping on the floor, longer drip chamber fits firmly in the users hand, ensuring abetter grip, specially designed y type injection port made up of silicone havin resealing property is provided for additional medication, soft, see through, clear 180 cm long dehp free pvc tubing, which is kink resistant for uninterrupted and smooth flow, advance, handy roller clamp for efficient control, sterile and individually blister packed. , ivseteo sterileanddehpfree(vented)20drops/ml,rollerclamp,0.2micronaireliminatingfilter,priming filter, should be latex free, pvc free. , precision infusion set : i.v set with dial flow controller specially designed for controlling the flow rates of fluid, eliminates the need of expensive electronic i.v pumps, provided with soft and kink resistant clear pvc tubing for uninterrupted flow, gentle gravity drive is self correcting, wide dial operates as thumb wheel like roller clamp, security door prevents the accidental change of flow rate, low cost disposable set provides maximum safety, traditional grip, reliable flow control, and ergonomic shape, provided with specialised y type injection port made up of silicone for additional medication, dehp free, sterile , individually packed. , kit for angiography ( radial) : kit should contain 1.) radial sheath (should be usfda approved) 1pc 2.) diagnostic catheter (should be usfda approved) 1 pc 3.) guidewire 0.035 x 150 1 pc 4.) pressure line m/f 1 pc 5.) manifold 2 port 1 pc 6.) luer lock syringe 10ml 1pc , kit for angiography ( femoral) : kit should contain 1.) femoral sheath ( should be usfda approved ) 1pc 2.) diagnostic catheter jl (should be usfda approved ) 1 pc 3.) diagnostic catheter jr ( should be usfda appoved) 1 pc 4.) guidewire 0.035 x 150 1 pc 5.) pressure line m/f 1 pc 6.) manifold 2 port 1 pc 7.) luer lock syringe 10ml 1pc , knee drape : material : 50 gsm sms polypropylene water repellent. overall size 240 x 340cm ; elastic aperture 5cm dia. polysheet lining. 120 x 120 funnel. polysheet lining 1.20 x 1.20m. sterlized pack. 5 years expory life. packing material 45gsm polypropylene one side and another side tyvek paper 25gsm , lamino spinal drape ; material : 50gsm sms polypropylene fabric water repellent ; sheet siz size: 1.5x3.0m ; incise sheet : 15 x 35cm : polysheet lining 1.20 x 1.20cm ; sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper m) ; , lancet device (pricker), hold the lancet for finger prick blood sugar , lancet needle 30 gauge / 31 gauge single use compatible with all type of pricker , lancet safety lancet single use safety device that cannot be used after activation, minimising the risk of needle stick injury and cross contamination between different people. , laryngeal mask airway pvc (disposable) size 1 to 5 , laryngeal mask airway silicon size 1 to 5 , laryngeal mask airway intubating (disposable) all sizes , laryngeal mask airway intubating (reusable) all sizes , laryngeal mask airway standard (disposable) all sizes , laryngeal mask airway standard (reusable) all sizes , laryngeal mask airway with port for naso gastric tube with preformed curve (disposable) all sizes , laryngeal mask airway with port for naso gastric tube with preformed curve (reusable) all sizes , laryngeal mask airway with port naso gastric tube, flexible and no curve (reusable) all sizes , laryngeal mask airway with preformed curve (disposable) all sizes , laryngeal mask airway with preformed curve (reusable) all sizes , leadercath arterial line all size , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 2 x 2 , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 4”x4’ , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 6”x6’ , makintosh sheet ( rubber sheet ) roll size : 90cm x 10mtrs , male cath (silicon) all sizes , male urinary incontinence device , malecot catheter 6f to 24f all sizes & length , malecot catheter soft : 6,8,10,12 f (usfda/ce approved) , masimo rd sedlline eeg sensor , masimo rd set , masimo o3 sensor rso2 , mayo trolley cover (75x90cms.) – 1 (exclusion coated heavy duty (imperable waterproff) , measuring jug for urine and other liquid material , metallic telescope dialators for pcnl indian & imported , mettalic tracheo bronchial stent straight all sizes , mettalic tracheo bronchial stent y shaped all sizes , micro suction tubes sizes 9 fr should have a vacuum control port, malleable shaft, should equipped with a length of tubing and clamp terminating with a ¼ in (0.64cm) connector. , mini tracheostomy non seldinger kit , mini tracheostomy seldinger kit , minimally invasive aortic root cannula with length more than 30 cm should have more than 30 cm long body to allow insertion during mics , minimally invasive retrograde cardioplegia cannula with deflecting tipsizes 13 and 15 fr should have tip deflecting models for sinus placement through thoracotomy should be able to allow minimum 10mm sweep.should be auto/ manual inflatable. , mucus extractor, sterile, disposable , multi lumen extension sets (v set) three lines , multi lumen extension sets (v set) two lines , multichannel cardioplegia cannula , multifunctionalmaskdesignedtoadministerhighoxygen&toreducetheriskofco2rebreathing.maskhasa provision of attaching nebulizing chamber to administer nebulization medication. double oxygen tubing available with mask allows for nebulization without interupting oxygen therapy. special opening on sides to accommodate ng and og tubes. accessforhydration,oral suction or oral medicine without interrupting oxygen therapy.fda approved. (mask, adapter, two 7 oxygen tubing & nebulizing chamber) , multiple use injection port for syringes , multiple stage venous cannula should have polyurethane wire wound body with radiopaque markers and multiple holes at distal end. sizes 23fr. , multiple stage venous cannula should have polyurethane wire wound body with radiopaque markers and multiple holes at distal end. sizes 29fr. , mva kit ( manual vaccum aspiration kit ) one pack of double valve kit must contain 1 pc double valve syringe , connectors, lubricating oil , and 1 pc cannula of each size 4,5,6,7,8,9,10,12mm , napkin absorbant all sizes , nasal cannula, infant , nasal cannula, neonate , nasal cannula, premature neonate , nasal cpap 10cm h20 , nasal pack 4.5 cm , nasal pack 8.0 cm , nasal pack with airway 8.0 cm , nasal prongs (disposable) for neonates , nasal tampoone polymethylene 8cm , nasogastric (ryles) tube ( pvc) with connector size : 6fg / 8fg / 10fg , nasogastric (ryles) tube ( pvc) with connector size : 12fg / 14 fg / 16fg / 18fg / 20fg , nasogastric (ryles) tube ( pvc with silicon elastomer coating) with connector size : 6fg / 8fg / 10fg , nasogastric (ryles) tube ( pvc with silicon elastomer coating) with connector size : 12fg / 14 fg / 16fg / 18fg / 20fg , nasopharyngeal airway : suitable for suctioning in i.c.us and provide an alternative way when oro pharyngeal airway is occluded, design of the tube conforms to the nasopharyngeal anatomy, flexible for maximum patient comfort, tube manufactured in medical grade pvc is soft, flexible and kink resistant, soft material for enhanced nasal passage comfort, atraumatic soft rounded edges and smooth surface, specially designed bevel tip reduces mucosal trauma during insertion, tube marked with the internal diameter for easier size identification, thin wall construction provides maximum inner diameter, interior walls with channel grooves facilitate easy insertion of catheter, removal 15 mm connector to allow connection to ventilation systems, individually packed in peelable pack. size : 3.0mm 8.5mm , nebuliser kits (jet/venturi type) – specialty specific , nebuliser kit with ‘t’ piece for ventilator circuit with oxygen tubing , nebuliser kit with adult mask and oxygen tubing , nebuliser kit with neonatal mask and oxygen tubing , nebuliser kit with paed. mask and oxygen tubing , nebulizer mask with double moulded (soft seal) pvc free aerosol mask with 2.0 mtr. tube, metal nose clip should mri compatible sizes: adult, child , needle cutter: stainless steel alloy adjustable blade,safe,hygiene,easy to use, no maintenance cost,compact & practical dimension , needle for – sacrospinal puncture in pelvic floor mesh repair , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore ext set , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore bi ext set , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore tri ext set , needle less syringe 10ml , needle less syringe 2ml , needle less syringe 3ml , needle less syringe 5ml , nelatonurinarycatheter size 6fr 20 fr , neontal weighing machine up to 5 kg , neuro patch 1.5cm x 3cm , neuro patch 2cm x 10cm , neuro patch 4cm x 5cm , newborn kit (consisting of neonatal front open clothes, bib, cloth diapers, baby towel, wet wipes , nibp cuff (all sizes for neonates) compatible with mindray multipara (neonatal) monitors. , noninvasivepositiveairwaypressuredevicewithamouthpiece,walloxygenport&manometerport&can accommodate nebulizer for aerosol therapy , non vented niv masks. disposable, full face mask, for use with niv module of invasive mechanical ventilators, should be completely air tight, no vent should be present over surface of mask, there should be facility to increase or decrese the mask tightness. , one piece pediatric aortic cannula size 6fr 16 fr vented, should be beveled with thin wall tips and should be elongated one piece. size 6fr. / 8fr. / 10fr. / 12fr. /16fr. / 18fr. , ophthalmology hydrophilic acrylic foldable lense optic diameter 6.00mm, overall length 12.50mm, a constsnt 118.00 , ophthalmology hydrophilic acrylic foldable lense optic diameter 6.00mm, overall length 12.50mm, a constsnt 118.00, fully aspheric optics with 360 degree squareedge , ophthalmology hydrophobic foldable single piece intraocular lense , ophthalmology hydrophobic foldable acrylic lens with preloaded injecting system diameter 6.00mm, overall length 13.00mm, a constant 118.4, fully aspheric optics. , ophthalmology hydrophobic foldable acrylic lens semi preloaded, natural yellow, chromophore, 360 degree, square edge, fullr aspheric optics diameter 6.00mm, overall length 13.00mm, a constant 118.4 , ophthalmology hydrophobic acrylic foldable lens diameter 6.00mm, overall length 13.00mm, a constant 118.40 , ophthalmology pmma , ophthalmology amniotic membrane , ophthalmology balanced salt solution with and without glutathian bss plus & bss plain , ophthalmology c3f8 gas for intraocular use , ophthalmology side port blade , ophthalmology cresent blade , ophthalmology keratome blade , ophthalmology implant blade , ophthalmology mvr virectomy blade , ophthalmology glaucoma valve implant / drainage devices , ophthalmology intraocular lens implant (multipiece) foldable , ophthalmology intraocular lens implant (single piece) foldable (firm should quote their higher version/medium and lower version lenses. , ophthalmology laser probe (curved) 23g, 25g , ophthalmology ologen collagen matrix implant , ophthalmology phaco pack for infiniti vision system , ophthalmology sterile eye drape and pad , ophthalmology viscous fliud injector pack , ophthalmology vitrectomy total plus pack valveless in 23 g and 25 g , oro pharyngeal airway : disposable guedel airway 0 no, 00 no, 000 no, 0000 no. , oro pharyngeal airway : disposable guedel airway 1, 2, 3, 4, 5, 6 no. , ostial perfusion cannula with basket tip and soft convex tip sizes 10 fr, 12 fr and 14 fr. should have flanged, radiopaque basket tips/soft tips attached to malleable stainless steel shafts. size 10 fr./ 12 fr. / 14fr. , oxygen mask high concentration with reservior bag , oxygen mask with non rebreathing reservoir bag with 2 3 meter long oxygen tubing , oxygen mask with bacteria filter , oxygen mask with capnography port adult , oxygen mask with co2 monitoring line, adult , oxygen twin bore nasal cannula soft tip curved with tubing adult paed, neon , oygen mask double moulded (soft seal), pvc free oxygen mask sizes adult, child , oxygenator without integrated filter ( adult ) , oxygenator without integrated filter ( paediatric ) , packed red cell & whole blood leucocyte reduction filters. bedside filtration of one & two unit of packed red blood cells or whole blood should have universal spike with microbiological recovery vent, should be with attached straight administration set/automatic self leveling drip chamber performance shouldconsistently average less than 2x105 residual leukocytes per unit, red cell recovery should average greater than 90%. filter housing hold up volume should be <25ml for one unit filter and <35ml for two unit filter it should be single use should be latex free , patient identification band along with logo of rims for mother & baby (combined) , patient identification band along with logo of rims for adult & pediatric , pauls tracheal culture bottle simplifies procedure for sampling of tracheal fluids, secure sterile bottle ensures accuracy of culture tests, vaccum coltrol connector allows easy and quick sampling procedures , graduated suction tubes allows a reading for depth of intubation , pa vent cannula should have a soft, pliable tip with female luer end; should have movable depth marker and an introducer needle should be included. , pcn dilators 6 14 fr , pcn set 10fr , pcn fascial dilator 6fr onwards (indian & imported) , peadritic closed suction with y adapter with colored coded silicon catheter, blunt tip, size 5fr, 6fr, 7fr, 8fr, 10fr , pediatric and adult intraosseous needle , pediatric central venous catheter (femoral) 16/18 and 18/20 gauze , pencil ( all types of electrode tips) , penile cateter large/medium/small , permanent double lumen dialysis curved catheter with split tip,cuff and airguard valve introducer size 14.5f length 19cm, 23cm, 24cm , pigtail stents 7fr/5cm,7fr/10cm, 7fr/15cm, 10fr/15cm, 10fr/5cm, 10fr/10cm, 10fr/15cm , plain sheet large for ot table. 25 micron thick pe hygine film , size 120 x 210cm, note: product should be in sterilized pack.packet material 45 gsm polypropylene one side and another side 25gsm tyvek paper with 5 years expiry life. , plain sheet for instrument table 25 micron thick pe hygine film , size 120 x 150cm, note: product should be packed in sterilized pack.packet material 45 gsm polypropylene film one side and another side 25 gsm tyvek paper with 5 yrs expiry life , plasma exchange kit , plasma exchange kit for multifiltrate , plasma filter 0.2m2 , plasma filter 0.5m2 , plastic apron (above knee length), disposable (sterile, packed individually) , plastic apron (long below knee length) , disposable (sterile, packed individually) , pop bandage different sizes 10cm x 2.7mtrs , pop bandage different sizes 15cm x 2.7mtrs , posterior vitrectomy pack constellation, for retinal surgery 23g and 25g , postrier vitrectomy pack oertli for retinal surgery 23g and 25g , pre filled sterile normal saline flush device (3ml) , pre filled sterile normal saline flush device (5ml) , pre filled sterile normal saline flush device (10ml) , pre filled terminally sterile flush syringes of normal saline in 3 sizes:3ml , pre filled terminally sterile flush syringes of normal saline in 3 sizes:5ml , pre filled terminally sterile flush syringes of normal saline in 3 sizes:10ml , premature soft tip nasal cannula should have soft tip nasal cannula with tubing. ce marked. , pressure domes compatible with maquet heart lung unit , pressure dressing all types , pressure infusion bag disposable 0.5 ltr , pressure infusion bag disposable 0.5 ltr with manometer , pressure infusion bag disposable 1.0 ltr. , pressure infusion bag disposable 1.0 ltr. with manometer , pressure infusion bag reusable 0.5 ltr with manometer , pressure infusion bag reusable 1.0 ltr. with manometer , pressure extension line low pressure large bore extension line madeup of pvc 10cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line low pressure large bore extension line madeup of pvc 150cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line low pressure large bore extension line madeup of pvc 200cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line 100cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line 150cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line 200cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line high pressure monitoring line100cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure extension line high pressure monitoring line150cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure extension line high pressure monitoring line200cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure transducers single dome disposable with the provision of free supply of interface adaptors/cables for all monitors like philips viridia, philips transport, datex, mindray, ge and dash monitors (and 20% extra, total approx. 300) that would be in use in rims for the entire period of rate contract , pressure transducers double dome disposable with the provision of free supply of interface adaptors/cables for all monitors like philips viridia, philips transport, datex, mindray, ge and dash monitors (and 20% extra, total approx. 300) that would be in use in rims for the entire period of rate contract , promethus system – consists of prometh 1 adsorber, prometh 02 adsorber, albuflow afo 1, blood line primary and secondary set, f 60 dialyser, y – adapter, spike adapter and dialyser exchange set , pulse oximter hand held finger . oxygen saturation range: 0 100%, pulse rate range: 15 320, measurement wavelengths and output power* 1. red: 6 0 nanometers @ 0.8 mw maximum average, 2. infrared: 910 nanometers @ 1.2 mw maximum average, %spo2 accuracy: 70 to 100% ± 2 digits, pulse rate accuracy (20 250bpm): ± 3 digits, internal power:battery: two 1.5 volt aaa batteries, operating life: 600 spot checks (30 secs/spot check) in a 6 month period, storage life: 12 months, weight < 75 gms, iec certifitied with respect to operating temperature, humidity and altitiude, 5 year warranty , puncture needle y shape (extra port) 18 g, 20 g 4cm, 7cm , puncture needle 18 g puncture needle, 90 mm length, 1.20 mm diameter, sharp beveled tip, hub of needle should admit 0.038”aus guide wire, e.g. vygon type , respiratory face mask (n 99), filters 99% of particles, folded mask dimension 240 x 85 mm, thickness 3.6 mm, green colour, duckbill shape, ear loop (elastic bands), ce, iso, en , retrograde cardioplegia cannula with auto inflate sizes 13 fr and 15 fr should have silicon/ pvc bodies with auto inflatable cuff and pressure monitoring lines; should have multiport tip/ integral stopcock. sizes 13 fr , retrograde cardioplegia cannula with auto inflate sizes 13 fr and 15 fr should have silicon/ pvc bodies with auto inflatable cuff and pressure monitoring lines; should have multiport tip/ integral stopcock. sizes 15 fr , reusable cautery pad, whole body size. pediatric, adult, neonatal (gel pad type) , reusablepulseoximetrysensorneonate(masimosettechnology)(withtheprovisionfofreesupplyofinterface adaptors /cables for allmonitors like radical masimo, mindray etc (and 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract , reusable silicon bipolar cable , reusable spo2 (pulse oxymeter) sensor with lead (forall monitors like philips viridia, philips transport, ge, datex, mindray and das monitors) pulse oxymeter machine , scalp vein set all sizes , shoe cover (in pair) disposable : • should be of good quality (thick) • made from non toxic non woven, thick fabric. • well stitched in universal regular size. • skid resistant & dust proof. • hard elasticated for better grip and easy to wear. • should cover the ankles. • size: assorted (std. size of shoe from 7 to 12) & blue color. , silicon ostial cannula for continuous perfusion sizes 15 fr,17fr and 20 fr should have a silicon body with soft bulb shaped tips, should have a female luer connection site. , single stage venous cannula with metal tip sizes 12 31 fr , should have kink resistant wire wound taper body with beveled metal tip. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr. , single stage venous cannula with right angle, should have kink resistant wire wound taper body with tapered multiport tips. should be right angled with plastic tip. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr./30fr. / 32fr. / 34 fr. / 36fr. / 38fr. / 40fr. , single stage straight venous cannula malleable, should have kink resistant malleable wire wound taper body with tapered multiport tips. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr./30fr. / 32fr. / 34 fr. / 36fr. / 38fr. / 40fr. , skin punch biopsy needle , skin stapler with multiple pins preloaded (all type & all sizes) , skin staples remover all types and all sizes , snake suture organizer , spinal needle for interventional pain procedures in painot ; size 16g to 27g , spinal puncture needle. all sizes (gauge & lengths) , spinal needle with pencil point having 1mm side hole opening, having clear transparent groved hub and colour coded stylet, instoducer needle 20g x 13/8. size 25g x 3 1/2 (0.53 x 88mm) and 27g x 3 1/2 ( 0.73 x 88mm) , stent metallic ureteral stent for temporary stenting of the ureter, coil design, 6f, length 26 cm , stent soft ureteral stent set with monofilament tether stent with graduation marks to aid in placement along with monofilament tether for repositioning and ease of removal, pigtail straightener, stent positioner with radiopaque tip, and wire guide , sterile gauze swab 12ply sizes 5cm x 5cm , sterile gauze swab 12ply sizes 7.5cm x 7.5cm , sterile gauze swab 12ply sizes 10cm x 10cm , sterile surgical pad / combine dressing ( absorbant cotton pad with non woven fabric ) size 10cm x 10cm , sterile surgical pad / combine dressing ( absorbant cotton pad with non woven fabric ) size 10cm x 20cm , sterilization reel medical grade paper reel for sterilization, compatible to eto size 5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 7.5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 10cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 12.5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 15cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 20cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 25cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 30cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 35cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 40cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 45cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 50cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 60cm with 200m length , stethoscope , stone basket 3f 4w , stone basket 4f 4w , stone basket 5f 4w , stone basket zero tip 3fr 1.9 , stone basket/nitilon 3fr 1.9 , stone extraction balloon (above injection port) , stone extraction balloon (below injection port) , stone extractor tipless 4.5 , straight tip arch cannula vented and non vented; pediatric and adult, should be beveled thin wall tips attached to tapered cannula bodies. should be available in pediatric and adult sizes. size 8 fr./ 10fr. / 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. , streaming microwire , suction catheter plain – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter thumb control sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter flower tip – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter atraumatic tip – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction machine electrical driven , suprapubic drainage catheter for cystostomy and supra pubic drainage size : 12frto 22 fr , surgeons cap disposable: • should be of good quality • made from non woven breathable fabric of 35 gsm • well fitting with back elastic or string. • air permeable. • properly ultrasonically sealed for uniformity. • different sizes & color. , surgical blade with plastic handle disposable (individual sterile pack) all sizes , surgical blades , carbonated steel all types and sizes. high quality, sterile, individually packed. , surgicalbladeswithsafetyhandles&disposablelock,highperformancescalpelblades,sterilizedbygamma radiation,available in varioussizes,in both highcarbon& stainlesssteel,each bladeispacked in aluminium,carbon steel blades are vpi paper protected,blade no. 10,11,12 & 15 fit on all no. 3 fitment handle,blade no. 18,19,20,21,22,23,24,25,36 fit on all no. 4 fitment handle , surgical blades without handle, all sizes disposable (individual sterile pack) , surgicalblades,carbonated/steelalltypesandsizes.highquality,sterile,individuallypacked.conformingto usfda , surgical disposable gown for use in the o.t., icu, cath lab etc. as a protective covering, for operating, impervious to transferofmicroorganisms,bodyfluidsandparticulatematter.thegowncomprisedofasinglelayerofsms (spunbond/meltblown/spunbond)polypropylenefabricmanualclosurewith2waterabsorbantpapertowels,size (small, medium, large, extra large) aami , surgical eye drape , surgical gown sterile breathable impervious to water / blood / bacteria. should be lint resistance / flame resistance. fabricshouldbereinforcedinkey areasforhighfluidcontact.shouldbeavailableindifferentsizes,wrappedin smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670 / 1671.prefered standard is en13795 , surgical gown sterile breathable impervious to water / blood / bacteria. should be lint resistance / flame resistance. fabric should be reinforced in key areas for moderate fluid contact. should be available in different sizes,wrapped in smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670 / 1671.prefered standard is en13795 , surgical gown sterile breathable impervious to water/blood/bacteria, should be lint resistance/flame resistance. fabric should be non reinforced for low fluid contact. should be available in different sizes,wrapped in smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670/1671. prefered standard is en13795 , surgical gowns large, xtra large, l xtra long, breathable performance fabric, raglan sleeves, colour coded neck binding red, adjustable hook & loop neckline, low linting fabric, book fold, ce certified & aami level 3/en 13795 high performance , surgical hoods protective 3 layer sms fabric, tie neck, universal size & aami l 4 compliant , surgical mask fog free, flat pleated shape, blue colour, ear ties, anti fog layer, dimention finished: 177 x 95 mm, thickness 45 mm ce, en, iso , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 3ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 5ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 10ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 20ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 50ml (with needle) , syringe toomy , syringe sterile disposable hypodermic syringe for single use with needle , 1ml , syringe sterile disposable hypodermic syringe for single use with needle , 2ml , syringe sterile disposable hypodermic syringe for single use with needle , 3ml , syringe sterile disposable hypodermic syringe for single use with needle , 5ml , syringe sterile disposable hypodermic syringe for single use with needle , 10ml , syringe sterile disposable hypodermic syringe for single use with needle , 20ml , syringe sterile disposable hypodermic syringe for single use with needle , 50ml , syringe sterile disposable hypodermic syringe for single use without needle , 1ml , syringe sterile disposable hypodermic syringe for single use without needle , 2ml , syringe sterile disposable hypodermic syringe for single use without needle , 3ml , syringe sterile disposable hypodermic syringe for single use without needle , 5ml , syringe sterile disposable hypodermic syringe for single use without needle , 10ml , syringe sterile disposable hypodermic syringe for single use without needle , 20ml , syringe sterile disposable hypodermic syringe for single use without needle , 50ml , syringe sterile disposable hypodermic syringe for single use without needle , 0.5ml , syringe sterile single use , reuse prevention syringe with detachable needle , 2ml , syringe sterile single use , reuse prevention syringe with detachable needle , 3ml , syringe sterile single use , reuse prevention syringe with detachable needle , 5ml , syringe sterile single use , reuse prevention syringe with detachable needle , 10ml , syringe bulb irrigation 50ml , syringe insulin 1ml , t piece connector for ventilator circuit (all male female combinations) , t piece connector with expandable tubing and oxygen tubing of 3 meter. , t piece in line self sealing , t piece resuscitator circuit, disposable,1.6 metres long, for use with mechanical infant resuscitator during resuscitation of newborns , temporary pigtail pacing wireshould include unipolar atrial and ventricular pacing, pediatric unipolar pacing, and the bipolar pacing lead. , thermometer digital (should be 100% mercury free, should have dual display of body temperature (°c & °f), should be ce marked , thermometer disposable tympanic , thermometer rectal & infrared , thoracic drainage catheter size : 12fg/ 14fg / 16fg / 20fg / 24fg / 28fg / 32fg , thoracic drainage catheter with trocar size : 8fg / 10fg / 12fg / 14fg/ 16fg / 20fg / 24fg / 28fg / 32fg / 36fg , three stage venous cannula, should be three stage venous cannula for vacuum assisted venous drainage(vavd) / kinetic assisted venous drainage(kavd) sizes 29/29/29 fr , three stage venous cannula, should be three stage venous cannula for vacuum assisted venous drainage(vavd) / kinetic assisted venous drainage(kavd) sizes 29/46/37 fr , three way stop cock , three way stop cock without any dead space (placenta system) , titanium clips, all sizes and all types alogwith provision of free applicators , tmt paper 215x280mm compatible with shiller tmt machine , tracheal tube introducer (bougie) : should provide rigidity to endotracheal tube to facilitate et intubation , should habe iltra smooth surface for low friction , should have a traumatic angled tip, should have marking provided all along tube to facilitate identification of tube position , should have vented lumen for oxygen feed size 6fr, 10fr, 15fr , tracheostomy button / decannulation plug , tracheostomy cover bib , tracheostomy mask adult , tracheostomy mask paed , tracheostomy speaking valve , tracheostomy tube – cuffed , sizes 3.5mm, 4mm, 4,5mm, 5mm, 5.5mm, 6.0mm, 6.5mm, 7.0mm, 7.5mm, 8.0mm, 8.5mm, 9.0mm, 9.5mm, 10mm, , tracheostomy tube – uncuffed , sizes 3.5mm, 4mm, 4,5mm, 5mm, 5.5mm, 6.0mm, 6.5mm, 7.0mm, 7.5mm, 8.0mm, 8.5mm, 9.0mm, 9.5mm, 10mm , tracheostomy tube (pvc siliconised) cuffed with disposable inner cannula, all sizes , tracheostomy tube (pvc siliconised) cuffed with integrated subglottic suction port, all sizes , tracheostomy tube (pvc siliconised) cuffed with single cannula (without inner cannula), all sizes , tracheostomy tube (pvc siliconised) cuffed with tapered distal tip and inverted cuff shoulder, all sizes , tracheostomy tube (pvc siliconised) uncuffed with disposable inner cannula, all sizes , tracheostomy tube pvc – siliconised, uncuffed with single cannula (without inner cannula), all sizes , tracheostomy tube pvc siliconised with adjustable length/flange, all sizes , tracheostomy tube reinforced with adjustable flanges all sizes , tracheostomy tube silicon cuffed with cuff volume maintenance device, obturator, tracheostomy tube tie and 15 mm disconnect wedge. – sizes 5,6,7,8 , tracheostomy tube with fenestration, all sizes , tracheostomy tube (pvc siliconised) cuffed with reusable inner cannula, all sizes , tracheostomy tube, neonatal, uncuffed, size 2.5mm , tracheostomy tube, neonatal, uncuffed, size 3.5mm , tracheostomy tube, neonatal, uncuffed, size 3mm , tracheostomy tube, neonatal, uncuffed, size 4mm , tracheostomy tubes reinforced with cuff pressure monitoring all sizes , tracheostomy tubes silicon cuffed (air cuff) adult sizes 5, 6, 7, 8, 9 , tracheostomy tubes silicon uncuffed adult sizes 5, 6, 7, 8 , tracheostomy tubes silicon uncuffed neonatal sizes 2.5, 3, 3.5, 4 , tracheostomy tubes silicon uncuffed pediatric sizes 4.5, 5 , tracheostomy tubes with cuff pressure monitoring all sizes , tur set , tur loop cutting , u bag standard (made of medical grade non toxic,biocompatible p.v.c. sheets,two layered,laminated pvc sheet to avoid any leakage/seapage,providing hanging & carrying systems) , ubarpack /ubarpackvi oneouterwrap35x 35,onesuture bag,oneu drapewith controlreinforcement 75x124, one bar drape with control reinforcement 70x98 & ce certified, aami l 4 compliance , ultrasound jelly ( 250 gms tube ) , ultrasound jelly ( 5kgs jar ) , ultrasound transducers water balloon , umbilicalcatheter,radio opaqueandtransparentpvc,distancemarkingseverycentimeterfrom5 25cm,flexible thermo sensitive material with open and rounded distal tip, fr 03,04,05,06,07,08 , umbilical cvc no plain, fr 04/fr 05/fr 06 , umbilical double lumen catheter, polyurethane size: fr 2.5, length 30cm , umbilical single lumen catheter, polyurethane all size & all length for neonates , under buttock drape with fluid collection pouch 101.5cmx112cm, control plus absorbent pad , under pad sheet size 60 x 90cm , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 500ml ( single chamber ) , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 1000ml ( single chamber ) , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 2000ml ( double chamber ) , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe 60x60 cm – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 120x150 cm – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe 40x60 cm, – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 80x175 cm – individual unsterile pouch pack , underpad/underlay/protective sheet, with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 60x90 cm,– individual unsterile pouch pack , universal pack major, 1 back table cover, zone reinforced, 44x90, 112cm x 229cm, 1 mayo stand cover,reinforced,23x54,58cmx 137cm,1 suture bag,1 absorbenttowel,15x22,38cm x 56cm, utility drapes,25x15,63.5cmx55.5cm,withtape,1suturebag,1bottomdrapewithcontrol*plus,76x76,193cmx 193cm, 1 top drape with control*plus, 108 x 50, 274 cm x 127cm, 2 side drapes with control*plus, 44x76, 112 cm x 193cm , universal pack minor, 1 back table cover, zone reinforced, 44x88, 112cm x 224cm, 1 mayo stand cover, reinforced, 23x54, 58cm x 137cm, 1 suture bag, 1 bottom drape with surround, 65x76, 165cm x 193cm, 1 top drape withsurround, 109 x 59, 277 cm x 150cm, 2 side drapes with surround, 45x33, 114 cm x 84cm , urchin heart positioner , ureteral access sheath all sizes and types (8, 10,12,14 fr) , ureteric catheter 3,4, 5,6 fr , ureteric dialation set – teflon (indian) , uretheral catheter open end + closed end different sizes 3, 4, 5 6, 7, 8 , uretheral dialator (teflon) all sizes indian , uretheral stent siliastic 6f, 8f & 10f without balloon catheter used in padiatric urethroplasty , uretheral stents double j stent different sizes , uretheral stents mono j stent different sizes , uretheral stents triple j stent different sizes , urethral dilation set 5f to 20 f , urethral splint : 6,8,10,12,14 f , urine collection bag, graduated in ml with measured volume meter for accurate measurement of urine, also available with needle free sampling port , inlet tube length 120cm, capacity of urine collection bag 2000ml, soft, frosted and kink resistant pvc tubing with t type bottom outlet, available with molded hanger for easy handling. , urinal – autoclavable , urine pot with measure plastic (female) , urine bag with t type bottom outlet for single hand operation and efficient emptying of the bag, capacity 2000ml, tube length 100cm , urine bag for paediatrics , urine bag leg bag set , urine collecting bag, neonatal size , urine pot with measure plastic (male) , urine sample collection bag with sticker (paed) , uro dynamic catheter double lumen 5f , uro dynamic catheter double lumen 7f , uro dynamic catheter triple lumen 7.4f 30cm , urosticks , urostomy one pc pouch * urostomy pouch * cut to fit * softlex skin barrier * without starter hole * without tape border * odour barrier rustle free film * with comfortwear panels boy side only * barrier opeing up to 38 mm & pouch length 22 cm. , urostomy pouch , urostomy pouch with accuseal tap, standard opaque with flange 38,45,57 cm , urostomy/vesicostomy bag (pediatric) , urovac bladder evacuator material latex , uternie evacuation kit double valve aspirators to generate a vacuum equivalent to that of eva, should be steam auto clavable at121 degreecelsius(250degreef)for30minutes,itshould be 610 660 mm(24 26 in)hg vacuumis comparable to eva, usfda approved. , venous cannulae single stage. (neonate) thin flexible wire reinforced straight open light house tip. overall lengthapprox.28cm with ¼ acceptance size 12fr, 14fr and 16fr , vented niv masks s, m, l. disposable full face masks forcpap/bipap machines, should be compatible with all available machines, cushioning technology to maximize comfort, sealing technology to minimize leakage,harness should be easy to remove and reattach. , ventilator/breathingcircuitwith‘y’connector–paediatric.(smoothboretubingwiththesmoothinnerlumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector – adult (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector– neonate. (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector – paediatric. (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator tubings for neonates , ventilator/breathing circuit with ‘y’ connector – adult (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator/breathing circuit with ‘y’ connector –neonate (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventricular catheter , ventricular catheter passer , ventricularexternalcsfdrainagesystem(containingonebag,oneventricularcatheterwithstylet,connector, trocar, catheter anchoring collar, connecting tube) , ventricular part of hydrocephalus shunt , ventricular peritonial shunt (paed) system like ceredrain system , venturi mask adult , venturi mask paediatric , veres needle all types and all sizes , vertical isolation drape for dhs, drape size 90x126, 229cm x 320cm, clear film, adhesive incise area 16x30, 41cm x 76cm, tube holders, centralrelease tape strip forhorizontal rod attachment, fluid collection pouch with suction port, ce certified, aami l 4 compliance , vertical tube attachment device all type & all sizes , vessel cannula with and without valve should have clear and radiopaque bodies.these should terminate with a female luer.should have tips in various sizes and shapes. sizes 2mm,3mm, 4mm , vessel dilator 10f,12f,14f coons type , vessel tip 16g /17 g , voice prosthesis system like provox trachphone , vp shunt (adult) with high pressure , vp shunt (adult) with low pressure , vp shunt (adult) with medium pressure , waterproof sterile ostomy cover , waterproof sterile wound cover , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 10cm , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 20cm , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 25cm , waterproof silk protein and nanocrystalline silver based sterile transparent pu film surgical wound dressing with adhesive border and center non adherent pu foam high absorbent layer 15x15cm , waterproof silk protein and nanocrystalline silver based steriletransparent pu film surgical wound dressing with adhesive border and center non adherent absorbent layer 10x25cm , water repellant silk protein and nanocrystalline silver based sterile antimicrobial non woven surgical wound dressing with adhesive border and center non adherent absorbent layer 10x25cm , water repellant silk protein and nanocrystalline silver based sterile antimicrobial non woven surgical wound dressing with adhesive border and center non adherent absorbent layer 10x30cm , weighing machine digital up to 150 kg , wide area fixation dressing stretchable and wash proof , winged infusion set non coring needles with injection site to access ports, various sizes 20g x 1.00, 22g x 1.00, 19g x 1.00, 22g x 0.5, 20g x 0.75, 22g x 0.75, 20g x 1.5 & 22g x 1.5 , wire enforced arterial cannula (6 fr to 20 fr) , wrapping sheet cotton (dosuti) 1.5 mtrs x 2.5 mtrs for dead body , wristbands(strechable,waterresistant)allsizes adults,pediatricandneonates;differentcoloursforpatient identification , y connector for biventricular shunt , y connector with ultra long ventricular catheter , y connector with xi ventricular catheter , y set for endoscopic irrigation during turp procedure , yankaur suction vacuum control handle with flexible kink resistant tube, sterile, disposable , single pack (all sizes) , zine paste bandage , polypropylene mesh size 6cm x 11cm , polypropylene mesh size 7.6cm x 15.2cm , polypropylene mesh size 15cm x 15cm , polypropylene mesh size 30cm x 30cm , bidirectional & unidirectional tissue control device of various strenght and various size ; unidirectional 20cm, 3.0, 17mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; unidirectional 20cm, 4.0, 17mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; unidirectional 45cm, 3.0, 19mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ;unidirectional 45cm, 4.0, 19mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; bidirectional 7x7, 5.0, 19mm , chromic gut suture, with needle, size 1 0, 152cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 1, 152cm, 1/2 circle rb heavy 40mm , chromic gut suture, with needle, size 2, 152cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 1, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 2, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 1 0, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 3 0, 76cm, 1/2 circle rb 20mm , chromic gut suture, with needle, size 2 0, 76cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 1 0, 76cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 2 0, 76cm, 1/2 circle rb 40mm , chromic gut suture, with needle, size 1 0, 76cm, 1/2 circle rb 40mm , chromic gut suture, with needle, size 1, 100cm, 1/2 circle rb heavy 50mm , chromic gut suture, with needle, size 1, 76cm, 1/2 circle rb heavy 40mm , triclosan coated polyglactin 910 antibacterial 45 cm , 1/2 circle oval round body, needle 16 mm, size 5 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 70 cm , 1/2 circleround body, needle 20 mm, size 4 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 1/2 circleround body, needle 30 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 1/2 circleround body, needle 30 mm, size 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 3/8 circle cutting, needle 25 mm, size 3 0, box of 12 foils , triclosan coated polyglactin 910 70 cm , 1/2 circleround body, needle 30 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body, needle 40 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body, needle 40 mm, size 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body (heavy), needle 40 mm, size 1, box of 12 foils , triclosan coated polyglactin 910 70 cm,1/2 circle round body (heavy),needle 40 mm,size 1, box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle reverse cutting needle 40mm,size 2 0,box of 12 foils , triclosan coated polyglactin 910 45 cm,3/8 circle cutting needle 22 mm, size3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm,3/8 circle cutting needle 26 mm,size 2 0,box of 12 foils , triclosan coated polyglactin 910 90 cm, 1/2 circle reverse cutting os,needle 40 mm,size 1, box of 12 foils , triclosan coated polyglactin 910 70 cm, 1/2 circle round body,needle 20 mm size 3 0, box of 12 foils , triclosan coated polyglactin 910 45 cm,5/8 circle cutting needle 16 mm,size 4 0, box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circlecutting needle 22 mm,size 3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm, 1/2 circle reverse cutting os,needle 40 mm size 2,box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle tapercut, needle 36 mm, size 3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle tapercut,needle 40mm size 0.box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle reverse cutting os, needle 36 mm size 0,box of 12 foils , triclosan coated polyglactin 910 35 cm,1/2 circle reverse cutting (heavy) port, needle 23 mm size 1.box of 12 foils , triclosan coated polyglactin 910 70 cm, 1/2 circle reverse cutting (heavy)port. needle 23 mm size 1.box of 12 foils , triclosan coated polyglactin 910 45 cm, 1/2 circle reverse cutting os 8 needle 40 mm size 2,box of 24 foils , poliglecaprone 25 , 70 cm,3/8 circle reverse cutting ps 1needle 24 mm,size 3 0,box of 36 foils , poliglecaprone 25 ,70 cm,3/8 circle cutting ,needle 25 mm,size 3 0,box of 12 foils , poliglecaprone 25, 70 cm,5/8 circle round body ur 6 uro,needle 26 mm,size 2 0,box of 12 foils , poliglecaprone 25 , 70 cm,1/2 circle round body,needle 30mm,size 2 0,box of 12 foils , poliglecaprone 25, 70 cm,1/2 circle round body needle 30 mm size 0,box of 12 foils , poliglecaprone 25 , 70 cm,straight cutting, needle 60 mm size 3 0,box of 12 foils , poliglecaprone 25, 70 cm, 1/2 circle round body ,needle 20 mm.size 3 0 box of 12 foils , poliglecaprone 25 , 70 cm, 1/2 circle round body, needle 30 mm.size 2 0 box of 12 foils , poliglecaprone 25 , 70 cm, 1/2 circle round body, needle 30 mm.size 0 box of 12 foils , poliglecaprone 25 , 70 cm,3/8 circle reverse cutting, needle 26 mm,size 3 0,box of 12 foils , nylon suture 70 cm,3/8 circle cutting ,needle 16 mm,size 3 0,box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 26 mm, size 3 0, box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 45 mm, size 2 0, box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 45 mm size 0,box of 12 foils , nylon suture 100 cm.1/2 circle reverse cutting (heavy), needle 45 mm,size 1, box of 12 foils , nylon suture 150 cm loop,1/2 circle round body,needle 40 mm,size 0,box of 12 foils , nylon suture 100 cm,1/2 circle round body (heavy),needle 40 mm,size 0,box of 12 foils , nylon suture 100 cm,1/2 circle round body (heavy),needle 40 mm,size 1,box of 12 foils , nylon suture 150 cm loop.1/2 circle round body (heavy),needle 48 mm.size: 1,box of 12 foils , nylon suture 100 cm,1/2 circle reverse cutting (heavy),needle 50 mm size 1, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 3 0, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 0, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 2 0, box of 12 foils , nylon suture 70 cm, 3/8 circle cutting,needle 90 cm , size 1, box of 12 foils , nylon suture 70 cm, 3/8 circle cutting,needle 90 cm , size 2, box of 12 foils , black braided silk 90 cm,3/8 circle cutting , needle 16 mm,size 4 0, box of 12 foils , black braided silk 90 cm,3/8 circle cutting , needle 16 mm,size 3 0, box of 12 foils , black braided silk 76 cm,3/8 circle round body, needle 30 mm,size 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 26 mm,size 3 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 45 mm,size 2 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 45 mm,size 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 16 mm,size 4 0, box of 12 foils , black braided silk 76 cm,1/2 circle reverse cutting, needle 50 mm,size 2 0, box of 12 foils , black braided silk 76 cm,3/8 circle cutting, needle 60 mm,size 1, box of 12 foils , black braided silk 76 cm,3/8 circle round body, needle 16 mm,size 4 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 25 mm,size 3 0, box of 12 foils , black braided silk 76 cm,1/2 circle round body, needle 20 mm,size 4 0, box of 12 foils , black braided silk 76 cm,1/2 circle round body, needle 20 mm,size 3 0, box of 12 foils , black braided silk 76 cm,1/2 circle tapercut, needle 17 mm,size 4 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 35 mm,size 3 0, box of 12 foils , black braided silk 76 cm,straight round body, needle 50 mm,size 2 0, box of 12 foils , black braided silk 76 cm,straight cutting, needle 60 mm,size 2 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 30 mm,size 2 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 30 mm,size 0, box of 12 foils , black braided silk 90 cm,1/2 circle tapercut, needle 17 mm,size 2 0, box of 12 foils , black braided silk 76 cm,1/2 circle tapercut, needle 25 mm,size 2 0, box of 12 foils , polypropylene suture monofilament 70 cm , 3/8 circle cutting , needle 22 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 90 cm , 3/8 circle cutting, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut, needle 25 mm, size 0,box of 12 foils , polypropylene suture monofilament 90 cm , 1/2 circle tapercut, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut double needle, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 60 cm , 3/8 circle cutting , needle 16 mm, size 4 0,box of 12 foils , polypropylene suture monofilament 70 cm , 3/8 circle cutting , needle 13 mm, size 6 0,box of 12 foils , polypropylene suture 45 cm, 3/8 circle cutting , needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body double needle, needle 26 mm, size 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body , needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 70 cm, 3/8 circle round body double needle, needle 12 mm, size 5 0, box of 12 foils , polypropylene suture 70 cm, 3/8 circle round body double needle, needle 13 mm, size 6 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle round body(heavy), needle 30 mm, size 0, box of 12 foils , polypropylene suture 150 cm loop , 1/2 circle round body, needle 40 mm, size 0, box of 12 foils , polypropylene suture 150 cm loop , 1/2 circle round body(heavy), needle 48 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle round body, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body(heavy), needle 30 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body(heavy), needle 40 mm, size 1, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle round body, needle 30 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle round body, needle 30 mm, size 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body, needle 16 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut, needle 36 mm, size 2 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body double needle, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle tapercut double needle, needle 17 mm, size 4 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle tapercut , needle 17 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle reverse cutting, needle 45 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut double needle , needle 25 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle cutting , needle 16 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut double needle, needle 25 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 45 cm, 3/8 circle reverse cutting, needle 12 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body, needle 16 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body double needle, needle 16 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 100 cm, 1/2 circle reverse cutting(heavy), needle 45 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body, needle 20 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, straight cutting, needle 60 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body double needle, needle 20 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut(heavy), needle 30 mm, size 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle tapercut double needle, needle 17 mm, size 3 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle tapercut double needle, needle 17 mm, size 2 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle tapercut , needle 17 mm, size 4 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle reverse cutting os, needle 40 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body, needle 20 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 45 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body (heavy), needle 30 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 150 cm loop,1/2 circle round body (heavy), needle 40 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 150 cm loop,1/2 circle round body (heavy), needle 50 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body , needle 20 mm, size 4 0, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body , double needle, needle 30 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 75 cm,1/2 circle round body , double needle, needle 20 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 40 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 40 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle reverse cutting (heavy), needle 50 mm, size 1, box of 12 foils , polyester suture 90cm , 1/2 circle tapercutdouble needle, needle 17mm, size 2 0, box of 12 foils , polyester suture 90cm , 1/2 circle tapercutdouble needle, needle 17mm, size 2 0, box of 12 foils , polyester suture 100cm , 1/2 circle tapercut (heavy),needle 45mm, size 2, box of 12 foils , polyester suture 100cm , 1/2 circle round bodyneedle 25mm, size 3 0, box of 12 foils , polyester suture 76cm , 1/2 circle tapercut ,needle 17mm, size 2 0, box of 12 foils , polyester suture 100cm , 1/2 circle reverse cutting,needle 50mm, size 0, box of 12 foils , metal skin stapler extractor , titanium clip engulfs tissue tip to tip closure, blue small 6 clips, size 100 , titanium clip engulfs tissue tip to tip closure, white medium 6 clips, size 200 , titanium clip engulfs tissue tip to tip closure, green medium large 6 clips, size 300 , titanium clip engulfs tissue tip to tip closure, yellow large 6 clips, size 400 , open applicator small 20cm length for 100 clips , open applicator small 20cm length for 200 clips , open applicator small 20cm length for 300 clips , open applicator small 20cm length for 400 clips , laproscopic applicator for 300 clips , laproscopic applicator for 400 clips , bladeless trocars with tissue seperating flap 5mm contain two 05mm*100mm sleeve/ cannula and one 05mm obturator , bladeless trocars with tissue seperating flap 10mm contain two 10mm*100mm sleeve/ cannula and one 10mm obturator , bladeless trocars with tissue seperating flap 12mm contain two 12mm*100mm sleeve/ cannula and one 12mm obturator , disposable curved circular stapler 29mm row 3 , disposable curved circular stapler 32mm row 3 , 60mm disposable linear cutter stapler , 80mm disposable linear cutter stapler , disposable linear cutter reload 60 3.8 blue, cut line 60mm, staple line 64mm , disposable linear cutter reload 60 4.8 green, cut line 60mm, staple line 64mm , disposable linear cutter reload 80 3.8 blue, cut line 80mm, staple line 84mm , disposable linear cutter reload 80 3.8 green, cut line 80mm, staple line 84mm , laproscopic powder endocutter stapler 60mm medium. mec60 340 , powder endocutter reload used with endoscopic linear cutter, 60mm blue, articulation 60 degree both side and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm green, articulation 60 degree both side and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm white, articulation 60 degree both side and rotation 360 degree , disposable shear 36mm for ultrasonic generator , tissue seperating dual layer mesh with plcl barrier 20*25 oval , tissue seperating dual layer mesh with plcl barrier 15*20 oval , tissue seperating dual layer mesh with plcl barrier 15*15 square , mesh fixation device non absorbable 15 spikes , mesh fixation device non absorbable 30 spikes , mesh fixation device absorbable 30 spikes , mesh fixation device absorbable 15 spikes , bladeless trocars with tissue separating flap 10mm contain: two 10mm*100mm sleeve/ cannula and one 10mm obturator , bladeless trocars with tissue separating flap 12mm contain: two 12mm 100mm sleeve/ cannula and one 12mm obturator , disposable curved circular stapler 29mm row 3 , disposable curved circular stapler 32mm row 3 , 60mm disposable linear cutter stapler , 80mm disposable linear cutter stapler , disposable linear cutter reload 60 3.8 blue, cut line 60mm, staple line 64mm , disposable linear cutter reload 60 4,8 green, cut line 60mm, staple line 64mm , disposable linear cutter reload 80 3.8 blue, cut line 80mm, staple line 84mm , disposable linear cutter reload 80 3.8 green, cut line 80mm, staple line 84mm , laproscopic powder endocutter stapler 60mm medium. mec60 340 , powder endocutter reload used with endoscopic linear cutter, 60mm blue, articulation 60 degree both sides and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm green, articulation 60 degree both sides and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm white, articulation 60 degree both sides and rotation 360 degree , disposable shear 36mm for ultrasonic generator , tissue separating dual layer mesh with plcl barrier 20 25 oval , tissue separating dual layer mesh with plcl barrier 15 20 oval , tissue separating dual layer mesh with plcl barrier 1515 square , mesh fixation device non absorbable 15 spikes , mesh fixation device non absorbable 30 spikes , mesh fixation device absorbable 30 spikes , mesh fixation device absorbable 15 spikes , eye drape , 26 g disposable needle , 23 g disposable needle , crescent , keratome , site port , lens foldable 16 no. , lens foldable 17 no. , lens foldable 18 no. , lens foldable 19 no. , lens foldable 24 no. , lens foldable 26 no. , lens foldable 26 no. , consumables for dvt pumps and enteral feeding pump – make cardinal health , 73011 sml scd express sleeve t/l intx5 , 73012 med t/l scd express sleeve intx5 , 73013 lge scd express sleeve t/l intx3 , 673656 epump 1000ml non sterile x30 , consumables for crrt and bcm machines,make fresenius medical , ultra flux av600 , av cassette blood lines adults + filtrate line(a/v 143 ml) , multifiltrate substituate line 1heater bags , multifiltrate dialysate line (158ml) , hf female spike adapter , filtrate bag 10l , plasma filter (p1 dry) , plasma filter (p2 dry) , skin electrode , multibic solution , consumables for aerogen solo ultrasonic nebulisers , aerogen solo nebulisers (pack of 10) , aerogen solo convenience pack (pkt of 10) (includes 10 x solo nebulisers, adult tees) , aerogen solo adult tee pieces (pack of 10) , aerogen solo paediatric tee pieces (pack of 10) , continuous neb tube set, tubing assembly only (pack of 5) , continuous neb tube set, syringe & cap only (pack of 5) , continuous neb tube set, syringe & cap only (pack of 50) , aerogen solo single patient use mask kit intl (pack of 5) , aerogen solo single patient use vented elbow (pack of 5) , aerogen pro x controller only , ultra only (pack of 10) adult , ultra only (pack of 10) paediatric , ultra and solo (pack of 10) , aerogen pro control module kit international , aerogen pro usb controller starter kit , aerogen pro nebuliser assembly , aerogen pro filler cap (pkt 5) , aerogen pro adult tee with silicone plug (autoclavable) (pkt 5) , aerogen pro paediatric tee with silicone plug (autoclavable) (pkt 5) , aerogen pro mask kit intl (inc. vented elbow & 22 mm f/22 mm m elbow) (autoclavable) (pkt 5) , battery replacement kit , ultra starter kit (pack of 10) adult mask &solo , ultra starter kit (pack of 10) paed mask & solo , consumables for aerogen solo ultrasonic nebulisers , fx 8 single use dialyser cat no. 5004731 , blood tubing 5008 cat no. f00000384 , peadiatric blood tubing 5008cat no. f00001068 , av fistula needle set (bain avf)16 g cat no. apavf005 , av fistula needle set 17 g cat no. apavf003 , bibag 900 gramm cat no. f00006672 , citrosteril 5 ltrs cat no. ap0005158 , puristerial 340 cat no. 5085621 , diasafe plus cat no. 5008201 , double lumen juglar catheter curved 11.5 f cat no. 817009 , double lumen juglar catheter straight 11.5 fr cat no. 817005 , tripple lumen catheter,std , tripple lumen catheter,std , chlorine test kit cat no. 6316881 , hardness test kit cat no. 6350911 , regeneration salt tablets cat no. 5085531 , compatible part a with bibag , filter cartridge 20 20?m big blue cat no. 6349711 , water inlet filter cat no. m395061 , fx 8 single use dialyser cat no. 5004731 , consumables for hotline fluid warmers , hotline warming set disp 30/ca, l 70 , consumables for patient warmers , snuggle warm, adult full body convective warming blanket 10/bx , snuggle warm, pediatric full body convective warming blanket 10/bx , snuggle warm, upper body convective warming blanket 10/bx , snuggle warm, pediatric underbody convective warming blanket 10/bx , consumables for masimo monitors , pediatric for regional oximetry , sensor disposable for regional oximetery (20/box) , sensor disposable for brain function monitoring (25/box) , sensor disposable for continuous hemoglobin, ori, pvi, spo2, pi (10/box) , disposable neonatal spo2 adhesive sensor (20/box) , clip sensor , rad 97 patient cable , adult bp cuff , hose pipe , filters pod for bed air , pediatric for regional oximetry , disposables and modules for cardiac monitor, make edwards , flotrac cardiac output sensor for hemosphere monitor , cvp transducer with pm line and iv set a. it should be able to give a pressure & waveform on minimally invasive continuous cardiac out put monitor. b.it should be able to give a pressure & waveform on any multipara monitor with ibp module. c.it must have 3±1 ml/hr flow rate across flush device with iv bag pressurized to 300 mm hg. d.it must have moisture resistance connector sheath without pin. e.it should have gold/copper/aluminium plated connector wires. f.it must have an operating pressure range of 50 to 300mmhg, with overpressure tolerance range of 500 to +5000mm hg. g. it must have a provision to put arm strap. h.it should have an integrated flush device which can be operated from any direction for easy accessibility. i.it should have a test port that can be used to check the performance of the transducer when used along with a simulator device for the purpose. , acumen iq sensor a. it must be compatible with hemosphere monitor. b. it must able to provide co,ci,svv,ppv,sv,svi,svri,svr, hypotension prediction index, dp/dt, eadyn. , hypotension prediction index module/software for hemosphere monitor , nirs/ cerebral oximetry module for hemosphere monitor. nirs/ cerebral oximetry sensors – large ,medium, small, neonatal , consumables for high flow, make fisher & paykel , 900pt561heated breathing tube (circuit) + mr290, airspiral™, for airvo 2 (box 10 , opt942nasal interface, optiflow™+, adult, small, for mr850 & airvo (pack 20) , opt944nasal interface, optiflow™+, adult, med., for mr850 & airvo (pack 20) , opt946nasal interface, optiflow™+, adult, large for mr850 & airvo (pack 20) , opt970tracheostomy direct connection, mr850 & airvo (pack 20) , 900pt913filter for airvo 2, pack of 2 , 900mr869probe, airway temp & flow, for use with 1.5m circuits . with right angle connector, , mr850 , 900mr805electrical adaptor dual heated, rt circuits , rt380adult ventilator circuit dual heated + rt019 filter + mr290 chamber (box 10) dual heated , disposables forportable deployable isolation system with negative flow make bed air , filter pod , canopy , negative flow attachment...

Health Medical Education And Family Welfare Department - Jharkhand

38409900 bids are invited for trolley with stretcher (q3) , wheel chair (q3) , examination table (q3) , side screen (q3) , foot step (q3) , weighing machine (q3) , bp machine with stand (q3) , stethoscope (q3) , baby weighing machine (q3) , hospital bed (q3) , mattress (q3) , bed side locker (q3) , saline stand (q3) , bed sheet (q3) , pillow (q3) , pillow cover (q3) , dressing trolley (q3) , dressing drum (q3) , medicine trolley (q3) , labour table (q3) , standing lights (q3) , radiant warmer (q3) , top light (o. tlight) (q3) , suction machine (q3) , ambu bag ( baby) (q3) , baby laryngoscope (q3) , ambu bag (adult) (q3) , adult laryngoscope (q3) , foetal doppler (q3) , chemical balances (q3) , simple balances (q3) , micro pipettes of different volumes (q3) , water bath (q3) , hot air oven (q3) , electri centrifuge, table top (q3) , haemoglobinometer (q3) , electric calorimeter (q3) total quantity : 195...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

38298336 tender for supply of picu equipments , decription , mobile x ray (portable x ray) , low cost glucometer (glucometer) , trans illuminator cold light source (procedure spotlight portable) , cpap (bubble cpap machine with compressor) , defibrillator , nebulizers (electric) , laryngoscope (paediatric laryngoscope curved and straight blades) , oxygen hood (oxygen hood large size) , self inflating reservoir bag (paediatric ambu bags with different size masks) , portable eeg , opthalmoscope , stethoscope...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

38297688 supply of machine and equipments under the xv finance plan head for different categories of facilities , decription , test tubes( set of ten) , vacuum blood collection tube , blood specimen collection tubes , hemocytometer , clorimeter , centrifuge , iodine in salt testing kit , micropipettes for fixed volume , bar code reader , rotor shaker , stethoscope , needle destroyer , b.p instrument...

Department of Medical Health and Family Welfare - Jharkhand

38082513 bids are invited for diagnostic instruments ( mouth mirror, probe, twizzer ) ( q3 ) , kidney tray ( q3 ) , cotton holder ( q3 ) , sphygmanometer and stethoscope ( q3 ) , maxillary anterior extraction forceps ( q3 ) , maxillary posterior extraction forceps ( q3 ) , mandibular anterior extraction forceps ( q3 ) , mandibular posterior extraction forceps ( q3 ) , decidous teeth extraction forceps ( q3 ) , straight elevators ( q3 ) , coupland elevators ( q3 ) , periosteal elevators ( q3 ) , cross bar ( q3 ) , james warwicks elevator ( q3 ) , apexo elevator ( q3 ) , cryer ( q3 ) , bone file ( q3 ) , chiesel, mallate ( q3 ) , needle holder, scissor ( q3 ) , suture material ( 3 0, 4 0 ) ( q3 ) , myo scissor ( q3 ) , stich cutting scissor ( q3 ) , b p handle ( no. 03, 04, 07 ) ( q3 ) , b p blade ( no. 11, 12, 15 ) ( q3 ) , currete ( q3 ) , suction machine ( q3 ) , micromotor with surgical straight hand piece ( q3 ) , surgical bur ( q3 ) , autoclave sterlizer boiler ( q3 ) , ultrasonic scaler ( q3 ) , straight & contrangle hand piece ( q3 ) , composite curing light ( q3 ) , composite ( q3 ) , calcium hydroxide dressing ( q3 ) , spoon excavator ( q3 ) , glass inomer cement ( type 1 ) ( q3 ) , glass inomer cement ( type 2 ) ( q3 ) , matrix band ( q3 ) , k file ( 15 40 ) ( q3 ) , k file ( 45 80 ) ( q3 ) , gutta percha ( 15 40 ) ( q3 ) , gutta percha ( 45 80 ) ( q3 ) , ed ta ( q3 ) , ball burnisher ( q3 ) , plugger ( q3 ) , temporary filling material ( q3 ) , root canal sealer ( q3 ) , ultra voilet cabinet ( q3 ) , sodium hypo chloride 3% 500ml ( q3 ) , suction tip ( q3 ) , formocresol ( q3 ) , airoter ( q3 ) , lignocaine 2% ( la ) ( q3 ) , straight bur ( q3 ) , round bur ( q3 ) , inverted cone ( q3 ) , tapered fissure ( q3 ) , pear shaped ( q3 ) , composite finishing bur ( q3 ) , plastic filling instruments ( q3 ) 1 35 total quantity : 1339...

Health Medical Education And Family Welfare Department - Jharkhand

38033063 bids are invited for screen seperator with stand (q3) , designated new born tray ss with lid (q3) , digital thermometer (q3) , ambu bag (q3) , baby weighing scale (elect. ) (q3) , weighing machine digital (q3) , baby weighing machine (infant) (manual) (q3) , needle destroyer electrical (q3) , hub cutter (q3) , adult stethoscope (q3) , bp cuffs (q3) , sunction machine electric (q3) , dressing drum with lid (q3) , autoclave (q3) , iv stand with wheel (q3) , surgical dressing trays (q3) total quantity : 4344...

Health Medical Education And Family Welfare Department - Jharkhand

38019979 bids are invited for supply of products for h. w. c ( q3 ) dressing drum with lid n mattress 72335x zp digital blp machini near vision chart foot step double rubier top powder coated 45x45x45cm pillow pillow cover adult hospital blanket baby fursoft blanket disposable mask 3ply caps disposable floor moping stick hand towel kelly sapo weight machine iniant pocket fetal doppler sterilised gloves size 4&7 wall clock adult stethoscope digital thermkineter gauze cutting scissors wexht machine adult glass hwc stregth ening measuring tap metal snellens vision chart stadiometer cheatle forceps dressing tray with lid xo ss tray with cover 12xxx2 inch artery forceps sims specullum medium cord cutting scissor l bowl for antiseptic loton 4 kidney trays mall 6 kidney tray big 1...

Health Department - Jharkhand

37890677 rate contract for instruments at sadar hospital deoghar , items : , baby warmer machine , stainless steel abdominal hysterectomy set , n.s.v set(s.s) , g.v set , self abdominal detractor , m.t.p set. , vaccine carrier (small size) , x ray digitalisation with high end cr system (with installation & 1 yers. warrenty) console software with mulitmodality work station the cr system should have advances workstation provided with 17 high resolution monitor, keyboard & ouse, with the fol. , digital ultrasound machine colour dopler(high resolution ) with 4 probe , eye checkup machine , auto analyzer , hotair oven , binocular microscope , centri fuge machin , micropipette (0 50 microliter) , micropipette (0 500 microliter) , micropipette (0 1000 microliter) , microtips(0 50 microliter) , microtips(0 1000 microliter) , bed side screen with cloth1round pipe with wheel , sponge holding 8 , sponge holding 6 , artery forceps 6 curved , artery forceps 6straight. , artery forceps 8 curved , artery forceps 8straight. , artery forceps 4straight. , alliys tissue forcep 8 , mosquito forcep 6 , scissor 6 curved , scissor 6 straight , scissor mosquito straight. 5 straight , diatheromy (machine) , laparoscopic instrument , needle holder 8 curved , needle holder 8 straight , needle holder 6 curved , needle holder 6 straight , needle holder 4 curved , needle holder 4 straight , doner couch (3 motor) , blood weighting mechine , digital bp mechine , blood band refrigerator (300 bag) temp.display outside , elisa mechne e printer. , blood collection monitor (with battery backup) , boyls appratus , gas pipe line n2o , gas pipe line o2 , electral dental chair 1.should be electricly operated with zero programme. 2. should have a switch operated operating light with minimum 2 steps of intensity control. 3. should have a auto water connection for spitoon, and tumbler with auto filling senssor. , detal forcep set , detal cortraie machine , infusion pam machine , bed side trolly table , patient table , ecg machine 12 leading , dressing table with instrument , alice tooth forcep , alice plane forcep , plane forcep , sponge holding forcep , b.p blade. , artery forcep curved , artery forcep plane , stitch cutting night. , scissor curved , scissor plane , multiparamoniter , table sterilazation machine , pulse oximeter (table top) bulit in rechargeable li polymer battery for uniterrupted monitorig compact and flexible appearance, easy and be suitable fo indoor and outdoor(in ambulnce monitoringwith user friendly interface disply , syringe pump , foetal doppler , refrigerater 290 ltr. , blood warmer machine , airpurifier , allis tissue , artery forcep (long) , tooth forcep , needle holder , sponge holder , bp handle , scissor straight , allies tissue forceps 6 (tungston carbide coated) german. , ambu bag (adult) , ambu bag (baby) , artery forceps 4 curved (tungston carbide coated) german. , artery forceps 5 curved (tungston carbide coated) german. , artery forceps 7 curved (tungston carbide coated) german. , artery forceps curve 140 mm 180 mm(german) , artery forceps straight 140 mm 180 mm(german) , auto reflectometer with table , doyens retractor , b.p. holder , bad pan plastic , bauel 10 , bed side locker , bed side screen with curtain. , boils appratus with gas clinder , boul stand. , bowl, metal, sponge, 600 ml. , bp instrument (diamond) , bp instrument dial , bp instrument digital , bp instrument stand(diamond) , cardiac monitor , cord cutting scissor(tungston carbide coated) german. , curved cutting needle (tungston carbide coated) german. , diathermy , dilator utrenne double , dressing table , dressing tray with cover 310* 200* 600 mm ss , drug trolley , drum , steritizing cylindrical 275 mm dies 132 mm (dressing drum) , drum stand clinical , g.v set , electricauto clave big3 drums , electric auto clave medium 1 drum , electric auto clave medium 2 drums , electric hub cutter big , electric instrument strlizer , electric needle cutter , electric sterlizationbig , electric sterlization medium , electric sterlization small , episiotomy or curved scissor , episiotomy scissors 6 (tungston carbide coated) german. , episiotomy scissors 8 (tungston carbide coated) german. , examination table , femaly planning operation scissor set. 01 set. , feotoscope , flower bed 18 mm steel. , foammattress for labour table , food trolly big wheel , foot step , forceps hemostatic, halsteads mosquito strcight, 125mm ss (german) , forceps obstetiric, wrigleys 280 mm, stainless stand (german) , forceps uterine neleton solid tip one eye (german) , forceps vulselium dubty borble carved 280 mm ss (german) , forceps, spongs holding, 228 mm(german) , froceps, bucplaus towel, 130 mm(german) , glucometer , hospital bed 18 mm steel. , hospital bed with adjustable back rest 18 mm steel. , hub cutter big , hub cutter small , hydraulic ottable , hydrocele operation scissor set 01 set. , hysterectomy operationset 01 set. , self abdominal detectorset , auto clave (big. verticle) , eye checkup machine , cbc machine (5 part blood cell counter machine) 1. should have throughput 50 samples/hour 2.system should use cation exchange hplc principle for estimation of stable a1c. 3. system should have built in computer with the system software and must be able to work independent of exte. , m.t.p set. , i.v. stand , ilr medium with stabilizer , infusion pump , ingramometermeasures , kidney tray (big) , kidney tray (medium) , kidney tray (small) , knife blade surgicalsize 11, 15 for minor surgery , knife blade surgicalsize 22 no.for major surgery . , knife handel surgical for minor & major surgery 3 & 4(german) , labour table , larengoscop adult , larengoscop child , ledo.t light single dome dia 22 no. led 48, linght intensity 100000 lux, +10%, cri>90, colour temperature>4300k, life of led minimum 50000 working hours. , no of dome heads 4, fully laminar flow compatible disigned dome. , lifter , matress for examination table , mattress for bed , mayos scissors 5 curved(tungston carbide coated) german. , mayos scissors 5 straight (tungston carbide coated) german. , mayos scissors 7 curved (tungston carbide coated) german.. , mayos scissors 7 straight (tungston carbide coated) german. , mosquito artery forceps curved (tungston carbide coated) german. , mosquito artery forceps straight (tungston carbide coated) german. , multi para monitor , nebuliser , needle holder , needle holder big (tungston carbide coated) german. , needle holder mayo strainght, nagrouthaw, 175 mm ss (german) , needle holder small (tungston carbide coated) german. , needle suture round body 3/8 circle no. 12 , needle suture triangular point size 7.3 , o.t light mutible double dome72 led, 130000 lux, central focusing focus point 15cm, penentrapion depth 8 10 intensity controlar. , oxygen concentrator , oxygen cylinder regulator , oxygen cylinder , oxygen trolley , oxygen key , oxygen maskadult , oxygen mask child , plain forceps 7 (tungston carbide coated) german. , pump sunction , radient warmer , revolving sitting stool , round body needle , rubber sheat , sahlis hemolglobinometer. , scissor big(gauge+ bandag cutting) , scissor opreting curved mayo blunt pointed 17 mm german. , semi follower bed 18 mm steel. , shadowless lamp led , souce pan with lid. , sound uterine simpson 300 mm (german) , sound uterine simpson blunt (german) , sponge holder 5straight(tungston carbide coated) german. , sponge holder 5curved (tungston carbide coated) german. , stethoscope diamond(adult) , stethoscope diamond(child) , stitch removal scissors 6 (tungston carbide coated) german. , stitch removal scissors 8 (tungston carbide coated) german. , stretcher folding , stretcher on trolleybig wheel 5.5 , stritch cuttingscissor , stritch removing instrument (eye) , suction machineelectric with pump power supply 230 240 volt, 50hz, vaccum capiity 18 lter./ mini max. depression 75 kpa( 263hg.) vaccum is created by a plastic piston and cylinder system with four vaccum creating modules. , thermometer digital , tooth forcep big , tooth forcep medium (tungston carbide coated) german. , tooth forcep small (tungston carbide coated) german. , towel clips forceps , tray, instruned cover, 310, 200, 600 mm ss , tube sealer (solid statef) , urine pot steel. , utrain sound , weighing machine for adult , weighing machine for child (electronic) , wheel chair , durm, sterilizing cylindrical (275 mm oiax 132 mm ss as per is) , tcdc count apparatus , esr stand with tubes , test tube stand , test tube rack , test tube holders , spirit lamp , sami auto analiser (with installation(specifications attached) , hydrolic stretcher on trolly big wheel...

Rural Works Department - Jharkhand

37816730 bids are invited for requirements for u hwc furniture & fixtures 1 patient bed 2 patient bed mattress 3 pillow 4 pillowcover 5 bedsidelocker 6 blanket 7 revolving stool steel 8 examination table 9 foot step 10 bed sheet 11 wheel stretcher 12 wheel chair 13 officetable 14 plastic chair 15 15 office chair 16 3 seater running chair steel 17 almirah 18 iron self rack 3 fold bedside screen with curtain stand 19 20 1ed tube light 21 led bulb ( t shape ) 22 ceiling fan 23 wall fan 24 2 battery+inverater 25 water purifier 26 refrigerator ( 3 star ) 27 air conditioner 28 stablizer v guard 29 aio desktop computer 2 register 6 3 register 10 4 register 12 sscessior medium 6 scessior small 7 scissor big 8 a4 paper white 9 10 pen fly leaf 11 stapler with pin small 12 stapler with pin big 13 punching machine 14 paper weight 15 wall clock 16 stamp pad medium blue 17 fevi stick big 18 plastic scale 19 link lock 45 20 link lock 50 21 link lock 55 22 opd register 23 opd slip 24 attendance register 25 stock register 26 visitor register / book 1 floor wiper rubber floor wiper jut 2 3 door mat 4 harpic 1 ltr. 5 colin spray 6 7 broom ( phul ) broom ( nariyal ) 8 phenyl 9 phenyle goli 10 dustbin with cover 11 plastic bucket big 12 plastic bucket medium 13 plastic bucket small 14 plastic mug colour coded bin ( waste 15 disposablebuckets ) set of 5 coloured bucket 16 garbage poly bag black ( 10 kg. ) 17 garbage poly bag red ( 10 kg. ) 18 hand wash liquid 19 hand wash soap 20 water bottle 1 ltr. 1 bp machine digital 2 bp machine mercery 3 digital gulocmeter 4 digital hemogobinometer 5 thermometer digital 6 |weight machine adult 7 weight machine infant 8 stethoscope 9 hub cutter 10 medicine tray 12 cotton roll 13 |leukoplast tap 1.25 cm 14 leukoplast tap 5 cm 15 iv stand 16 gloves 6.5...

Health Department - Jharkhand

37709215 group a medical equipment and others at sadar hospital koderma , items : , tray instrument / dressing with cover , forceps, backhaus towel, ( 130 mm ( tungsten carbide tip anti rust quality ) , forceps, sponge holding, ( 228 mm ( tungsten carbide tip anti rust quality ) , artery forceps ( straight 140 rnrn ( titanium ) , artery forceps ( straight 180 mm ( titanium ) , artery forceps ( curved 140 rnrn ( titanium ) , artery forceps ( curved 180 mm ( titanium ) , forcep mosquito ( titanium ) , forceps, hemostatic, halsteads mosquito, straight, ( 125 mrn ss ( tungsten carbide tip anti rust quality ) , forcep lifting , forcep ppiucd , knife handle ( surgical for minor & major surgery # 3 ( ss anti rust quality ) , knife handle ( surgical for minor & major surgery # 4 ( ss anti rust quality ) , knife blade ( surgical, size 11 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 15 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 22 for major surgery ( ss anti rust quality ) , needles, suture triangular point, ( 7.3 cm ) , cheatles forceps , cuscos speculum ( medium ) , cuscos speculum ( large ) , sharp and blunt curette , ovum forceps , oral airway , needles, suture, round bodied, ( 3 / 8 circle no. 12 ) , plain forceps ( 8 ( tungsten carbide tip anti rust quality ) , tooth forceps ( 8 ( tungsten carbide tip anti rust quality ) , kidney tray ( 8 ) , kidney tray ( 10 ) , cord cutting scissor ( ss ( titanium ) , scissors, operating curved mayo blunt pointed ( 170 mm ( tungsten carbide tip anti rust quality ) , scissor operating straight ( 230 mm ( tungsten carbide tip anti rust quality ) , scissor, gauze, straight ( 230 rnrn, ss ( titanium ) , bowl, metal sponge ( 600 rnl, ref. is: 5782 ) , drum, sterilizing cylindrical ( 275 mm oia x 132 rnrn, ss as per is: ) , foetoscope , kellys pad ( for labour and ot table set ) , thermometers ( para ) , thermometers ( digital ) , b.p. instruments ( portable ) , measuring tape , glucometer , ambu bag ( baby ) ( silicon ) , sahlis haemoglobinometer , airway guedel or berman, autoclavable rubber , endotracheal catheter ( w / cuff, rubber ) , breathing tubes, hoses, connectors for item 1, ( anti static ) , tcdc count apparatus , counting chamber , esr stand with tubes , test tube stands , test tube rack , test tube holders , spirit lamp , forceps obstetric ( wrigleys, 280 mm, stainless steel ( titanium ) , speculum vaginal bi valve ( cusco medium, ( ss anti rust quality ) , speculum, vaginal, sims double ended # 3 ( ss anti rust quality ) , forceps obstetric, wrigleys ( 280 mrn, stainless steel ( tungsten carbide tip ) , forceps, vulselium, duplay double cured, 280 mm ss ( ( tungsten carbide tip ) , sound, uterine, simpson ( 300 mm with 200 mm graduations ( ss anti rust quality ) , dilator, uterine, double ended hegar ( set of 5 ( ss anti rust quality ) , curette, uterine, sims blunts ( titanium ) , anterior vaginal wall retractor stainless ( ( ss anti rust quality ) , clamp intestinal, doyen ( curved 225 mrn, ss ) , clamp intestinal, doyen ( straight 225 rnrn, ss ) , uterine elevator ( ranathlbod ) ( ss ) , bag, reathing, self inflating ( anti static rubber, set of 4 ) , b.p. instruments with stand , timer stop watch , 3 fold reclining bed manually , weighing machine baby electronic ( 5 kg capicity with fiber tray ) , fetal monitor ( ctg monitor ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ecg machine ( 12 chennel ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , semi auto analiser ( with installation ) ( specification should be attached in technical bid turms & condition ) , micro scope binoculor ( with installation ) ( specification should be attached in technical bid turms & condition ) , cardiac monitor with defribillator ( with 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , cardiac table , oxygen cylender stand with trolly , auto clave ( elec. ) dubble drum 6x12 , b.p. instrument digital , electronic strailiser 6x8 , electronic straliser 8x10 , electronic straliser 10x12 , auto clave ( elec. ) dubble drum 4x10 , dressing drum small 9x9 , dressing drum big 12x15 , dressing drum big 9x11 , dressing drum big 12x17 , delivery table ( 72x24x3 ) power coated , ambu bag silicon adult , electric strailiser foot oprated big , fetal doppler machine digital , fetal doppler machine table model , thump forcep with tooth ( titanium ) , thump forcep without tooth ( titanium ) , straight cocker ( titanium ) , curve cocker ( titanium ) , green armittage ( titanium ) , alis forcep 6 ( titanium ) , alis forcep 8 ( titanium ) , outlet forcep ( titanium ) , kocchers forcep ( titanium ) , tissue forcep 6 ( titanium ) , tissue forcep 8 ( titanium ) , stethoscope ( best quality ) , paediatric stethoscope ( best quality ) , baby tray ( ss , ce inbuild ) , x ray film processing tank 9 lit. , x ray film processing tank 13.5 lit. , oxygen flow meter ( best quality ) , mox with yolk assombily , examination table with matress ( 72x24x3 ) ( iron ) , pulse oxymeter ( multi para ) ( with installation & 1 yrs. warrenty ) ( 8.5 tft display with ecg ) , centrifuge machine for blood storeg unit ( with installation & 1 yrs. warrenty ) , vein detector led , besin boul ( with stand ) , foot step ( 2 step ) , bed side screen with cloth ( 1 round pipe with wheel ) , salin stand with wheel with four hook ( ss ) , nsv kit set ( ss ) ( specification acched ) , streture trolly ( 85x22x32 power coated with matress ) , cotton folding strecher for ambulance ( best quality ) , weighing machine adult ( best quality ) , bed side locker ( best quality ) , hospital bed ( best quality ) ( general ) , semi fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , circle absorber with soda lime ( for boyles apparatus ) , portable oxygen cylinder ( best quality ) , baby weighing machine digital , high vaccum suction machine , iucd kit ( specification acched ) , minilap kit ( specification acched ) , water bath ( pathology department ) ( • should have double walled chamber made of stainless steel and outer wall made of thick mild steel sheet duly powder coated. • should have concentric rings are also made of stainless steel. • should have temperature co , hot air sterilizer ( oven ) digital construction: ovens are sturdy, with double walled construction. inner chamber is made of highly polished stainless steel. outer chamber is made of mild steel sheet duly pre treated in seven tanks process for surface , pulse oxymeter baby ( finger tip ) type: blood pressure monitor power supply: battery size: 57 ( l ) * 33 ( w ) * 32 ( h ) mm , pulse oxymeter adult ( table top ) built in rechargeable li polymer battery for uninterrupted monitoring compact and flexible appearance, easy for carrying and be suitable for indoor and outdoor ( in ambulance ) monitoring with user friendly interface displ , nebuliser should be lightweight, portable and compact. should have a dust filter. should be able to deliver a flow rate = 7 lpm should h ave air pressure = 35 psi. should have a check valve to protect the device against contamination due to backward , fumigation machine input power : 220 vac, 3.5 amp, 50hz consistant particle size generation : 5 15 microns vmd reach : 20 30 ft distance & 18 20 ft height. space treatment : up to 7000 cuft & even larger. nozzle assembly : non rotating vortex design , non , otoscope 1. should be a convenient pocket type otoscope. 2. should be provided with a halogen light source. 3. should be able to detach the otoscope head. 4. should provide no reflections and obstructions. 5. should provide detachable accessories of var , straight needle , o.t. table hydrolic ss ( best quality ) , focus light led ( spot light ) , laboratory autoclaves , pulse oxymeter , pulse spo2 , infusion pump , vacuum extractor metal ( best quality ) , head box for oxygen ( best quality ) , tuning fork ( best quality ) , examination instruments set ( speculums, tongue dipressors, mirrors, bulls lamp ) ( best quality ) , cervical biopsy set ( best quality ) , endometrial biopsy set ( best quality ) , vaginal hysterectomy set ( best quality ) , g.i. operation set ( best quality ) , uretheral dilator set ( best quality ) , stomach wash equipment ( best quality ) , emergency resuscitation kit adult ( best quality ) , air way 0, 1, 2, 3, 4 adult , air way peadiartric , tongue depressors , oxygen cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small d type jumbo ) , wheel chair ( ss ) folding , nibulisyer adult with mask , nibulisyer child with mask , nibulisyer mask for adult , nibulisyer mask for child , anaesthesia work station ( include anaesthesia machine with vaporiser, ventilator, monitor ) , boyles machine, brain circuit, jr , magills forceps , blood transfusion set ( best quality ) , back rest , medicine trolley ( ss ) , basin assorted ( ss ) , basin stand assorted ( ss ) ( 2 basin type ) , bed pan ( ss ) , urinal female , urinal male , waste disposal bin / drums , waste disposal trolley ( ss ) , diet trolley stainless steel , doctors overcoat , hospital worker overcoat , patients housecoat for female , patients paiiarna ( for male ) shirt , mouth mirror , waste disposal colour coded buckets swine bing 60 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets swine bing 30 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , tharmometer , nasogastric tube ( 8, 10, 12 fg ) , flow meter with humidifier bottle , bed side locker ( fully ss ) ( best quality ) , instrument trolly ( best quality ) , central patient monitoring station , bronchoscope , adjustable walker , bipap machine , cpap cum hfnc for newnate , paediatric vein circuit , ecg monitor cable , plastic tray bigh heavy , plastic box big heavy with led , x rey hanger 12x15 , x rey hanger 12x12 , x rey hanger 12x10 , x rey hanger 8x10 , x rey grid ( lead ) 12x15 , x rey grid ( lead ) 10x12 , mva aspirator , glass pippette , forceps, uterine nelaton solid tip one eye ( ( tungsten carbide tip ) , suction tube ( 225 rnrn, ss ) , valve inhaler ( chrome plated brass, y shape ) , intravenous ( set in box ) , needle spinal stainless ( set of 4 ) , syringe, anesthetic ( control 5 ml luer mount glass ) , head light ( ordinary ) ( boyle davis ) , beds semi recilining , feeding equipments ( tubes, katoris & spoon ) , channel semi automatic coaglomater with regent , x ray machine 100 ma with dark room assoseries ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , standalone color doppler machine ( specification should be attached in technical bid turms & condition ) , portable ultra sound with pw ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , portable cooling unit ( vaccine / blood bags ) ( specification should be attached in technical bid turms & condition ) , o.t light ( dichroic reflector ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , hospital bed ( ss head & foot side rod ) ( specification should be attached in technical bid turms & condition ) , led light ( single ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ultra high speed laboratary centrifuge ( specifications attached ) , digital incubator ( specifications attached ) , boyles machine ( specifications attached ) , 72 led dome ( double dome ) , lux 1, 30, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , 48 led dome ( single dome ) , lux 1, 00, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , coutery machine ( 400 w ) , coutery machine ( 250 w ) , portable o.t. light ( abs doom 19 single reflecter polycarbonate ) , portable o.t. light led , vaccu suck suction tube ( titanium ) ( for suction machine ) , alis forcep 10 ( titanium ) , tissue forcep 10 ( titanium ) , convex array tranducer c343ua ( for ultra sound machine ) , phototherephy unit single surface ( stand model ) , phototherephy unit single surface led ( with led buld ) , silent genrator 10 kva ( with installation ) ( 10 kva, 3 phase, water cooled ) , silent genrator 15 kva ( with installation ) ( 15 kva, 3 phase, water cooled ) , silent genrator 20 kva ( with installation ) ( 20 kva, 3 phase, water cooled ) , silent genrator 50 kva ( with installation ) ( 50 kva, 3 phase, water cooled ) , silent genrator 82 kva ( with installation ) ( 82 kva, 3 phase, water cooled ) , magil circuit with mask ( for boyles apparatus ) , patho fast test kit ( for patho fast machine ) , blood gas analyser test kit ( for blood gas analyser ) , dossimeter , peak expiritory flow meter ( best quality ) , laryngoscope fibreoptic ent ( best quality ) , p.v. tray ( best quality ) , varicose vein set ( best quality ) , connector set of six for en ( best quality ) , tubes connecting for en ( best quality ) , leqqinqs , explorar , endo explorar , amalgam carrier in sliver , murcury ball burnisher , carver ( dimond ) , compactor , element carrier , gic ( glass ionomer cement ) , zinc phosphate cement , temporary filling material , room thermometer , electric ventouse , radient baby warmer , right angel artry 4 , right angel artry 6 , automated autoref stand ( for ophthalmic ) , 2 mirror cronioscope ( for ophthalmic ) , disposable needle 26 g ( for ophthalmic ) , ppiucd forcep , uterus collection ( sister u and mama u ) , water cooler with purifire ( 120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap , hemoglobinometer ( 1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g / dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd / us fda / isoapproved 6. automatic correction of hb. 7. 20 , digital x rey film ( konika ) 8x10 , digital x rey film ( konika ) 10x12 , digital x rey film ( konika ) 12x12 , digital x rey film ( konika ) 12x15 , x ray digitalisationwith high end cr system ( with installation & 1 yrs. warrenty ) console software with multi modality work station the cr system should have advanced workstation provided with 17” high resolution monitor, keyboard & mouse, with the fol , x ray 500 ma ( with 1 yrs. warrenty ) x ray genera tor: high frequency x ray generator of frequency 40khz should be provided. power output of generator should be of sokw. kv range should be: • radiographic kv: 40 to 12sky. • fluoroscopic kv: 40 to 120k , suction machine foot operated ( powder coated m.s. chassis. noise level of suction apparatus from is 50 db + / 03 db. leakage current of suction units is less than 84 ua. electrical requirement – 220 ~ 230v, 50hz, 1 phase. ideal for mtp / medical / surgic , suction apparatus ( electric ) suction machine with pump: power supply: 230 240v / 50hz vacuum capacity: 18 litres / mim maximum depression: 75kpa ( 563mmhg ) vacuum is created by a plastic piston and cylinder system, with four vacuum creating modules ( , phototherapy unit 1 led phototherapy with intensity upto 6 50microwatts / nm / cumm / mwatt, adjustable intensity. 2 .height adjustable and tiltable light unit. 3 digital time totaller of led usage time. 4 stainless steel tray. 5 –provision for double surf , opthalmoscope 1. should be rechargeable battery with charger / mains operated. 2. should have halogen / led light source 3. should have red free filters 4. should have small and large spot sizes, fixation targets, slit aperture, hemi spot and cobalt blu , wireless indirect ophthalmoscope ( led ) ( compact and light weight, stereo optical system has all pupil features rechargeable battery integrated on headbrilliant white light with uniform and well spread led illumination ( focus distance : 300 800 mm, inter p , dental chair 1. should be electrically operated with zero program. 2. should have a switch operated operating light with minimum two steps of intensity control. 3. should have auto water connection for spittoon and tumbler with auto filling sensor. 4. s , av retractor 1.stainless steel 2.double ended, serrated 3.rust free 4.sturdy construction 5.accurate dimensions , vulcellum stainless steel size: 10 inch colour: silver shape: curved , ppiucd forcep ss , baby forceps ss ( big – straight ) , baby forceps ss ( big – curve ) , baby forceps ss ( big – straight ) , baby forceps ss ( small – curve ) , baby forceps ss ( small – straight ) , folis catheter 24 no , lab incubator 1. should have 4 inch attractive lcd display 2.should have intelligent controller to help maintain temperature incase of sensor failure 3. should have battery backup for temperature controller 4. should have auto tuning of controller , electricentrifuge, table top ( table top electric centrifuge ) 1. should have stepless speed regulator 2. should have safety lid interlock to prevent cover opening during centrifugation. 3. dynamic brake for quick deceleration 4. wide choice of swing out , cbc machine ( 5 part blood cell counter machine ) 1. should have throughput – 50 samples / hour 2.the sample volume should be < 17 ?l 3.should have technology – impedance ( wbc, rbc, plt ) , spectrophotometry ( hcg ) , should have optical laser methodfor 5 , incubator for culture sensitivity , esr stand with tubes , elisa reader cum washer , glycosylated haemoglobinometer , blood collection monitor , intensifying screen x ray , dossimeter , peak expiritory flow meter ( best quality ) , baby incubators ( best quality ) , craniotomy ( best quality ) , static vaccum extractor ( best quality ) , head light ( ordinary ) ( boyle davis ) ( best quality ) , ent operation set including headlight, tonsils , ent nasal set ( smr, septoplasty, nasal endoscopic set ( 00 & 300 ) polypetcomy, dns, rhinoplasty ) ( best quality ) , laryngoscope led ( best quality ) adult , laryngoscope led ( best quality ) pediatric , tracheostomy set ( best quality ) , proctoscopy set adult ( best quality ) , proctoscopy set peadiartric ( best quality ) , p.v. tray ( best quality ) , abdominal hysterectomy set ( best quality ) , laparotomy set ( best quality ) , varicose vein set ( best quality ) , thomas splint ( best quality ) , laproscopy set for cholecystectomy , amputation set ( best quality ) , colposcope ( best quality ) , mouth prop , regional anaesthesia devices, epidural set , vascular clamp set ( best quality ) , steel cup board , case sheet holders with clip ( ss ) , draw sheet , pereneal sheets for ot , explorar , spoon excavator , twizer , endo explorar , amalgam carrier in silver , murcury ball burnisher , carver ( dimond ) , diathermy machine , doyess ( medium ) , gernes retractor , metal catheter , mayo scissor curved , lma ( adult ) , steel galipot small , dressing drum size 9x11 , sims vaginal speculam , epsiotomy scissor , ovum forcep , tailor scissor , doctor & nurse dress with designation ( paijama & kurta ) , doynes retroctor 1.5” ( german steel ) each , doynes retroctor 2” ( german steel ) each , doynes retroctor 2.5” ( german steel ) each , doynes retroctor 3” ( german steel ) each , doynes retroctor 3.5” ( german steel ) each , czernys retractor ( german steel ) each , formalin chamber ( 20x8x8x5 mm ) , formalin chamber ( 26x8x8x5 mm ) , lifter with jar , strraight scissor 5” ( german steel ) each , strraight scissor 6” ( german steel ) each , strraight scissor 7” ( german steel ) each , strraight scissor 8” ( german steel ) each , s.s. bowl30 cm ( super fine quality ) each , s.s. bowl36 cm ( super fine quality ) each , babcock clamp 6” ( german steel ) each , babcock clamp 8” ( german steel ) each , ambu bag adult ( silicorised ) ( super fine quality ) , ambu bag child ( silicorised ) ( super fine quality ) , ambu bag 250 ml , artery forceps 6” curved ( german steel ) , artery forceps 6” straight ( german steel ) , mayo scissor long curved 6.5” each ( german steel ) , mayo scissor long curved 7.5” each ( german steel ) , tooth forceps 6” each ( german steel ) , non tooth forceps 6” each ( german steel ) , tenaculum long each ( german steel ) , myome screw each ( german steel ) , morrisen retractor each ( german steel ) , sim speculum medium each ( german steel ) , sim speculum long each ( german steel ) , waste disposal colour coded buckets swine bing 80 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets ( black, red, yellow, blue ) ( neelkamal, cello, suprem ) , dust bin ( ss ) small ( best quality ) , dust bin ( ss ) big ( best quality ) , sauce pan with lid , chest stand for x rey unit , oropharyngeal airway ( 000 4 guydel size ) , oxygen cylinder 10 ltr. mo2 with valve , bipap machine , elvo gloves – per pair , lyarigoscope set adult with led – each , lyarigoscope set child with led – each , hemoglobino meter digital – each , massiring mug – each , hair tremer branded – each , hot air oven , urino meter , adk drain , concigated drain ( plastic ) , diatharmy plate for vally lab , laryngoscope adult set , laryngoscope ped. set , coutry pencil , crash card with steel drower , digital spirometer , carbonmonoxide monitor , pulse oximeterfor ccu ( specifications attached ) , pulse oximter with nib for ccu ( specifications attached ) , carm for ccu ( specifications attached ) , laryngoscope for ccu ( specifications attached ) , nibulisor adult with mask , nibulisor child with mask , nibulisor mask for adult , nibulisor mask for child , infant weighing scale , lc dcp and dcp basic instrument set ( specifications attached ) , small fragment lc dcp & dcp® instrument set, st. steel ( specifications attached ) , select lcp upgrade instrument set large & small fragment ( specifications attached ) , dhs / dcs instrument set ( specifications attached ) , css 4.5mm instrument set in vario case ( specifications attached ) , css 6.5mm instrument set in vario case , synream ( specifications attached ) , distractor set large ( specifications attached ) , distractor set medium ( specifications attached ) , bone forceps range ( specifications attached ) , general instrument set ( specifications attached ) , instruments for damaged screw removal ( specifications attached ) , chisel and impactor set ( specifications attached ) , tomofix instrumentset in syncase ( specifications attached ) , instrument set for minimally invasive plate insertion osteosynthesis ( mipo ) in vario case ( specifications attached ) , collinear reduction clamp in vario case ( specifications attached ) , reduction handles, toothed and rounded, small & large in modular tray ( specifications attached ) , mipo cerclage passer ( specifications attached ) , hohmann retractor ( specifications attached ) , soft tissue spreader set ( specifications attached ) , periarticular reduction forceps ( specifications attached ) , pelvic basic instruments ( specifications attached ) , pelvic reduction & retraction ( specifications attached ) , pelvic c clamp ( specifications attached ) , wire instrumnents set ( specifications attached ) , shoulder instruments ( specifications attached ) , gili pot ss , weight machine hanging ( for bmw ) , sterlizer indicator , bio west trolly single bin ( ss ) , bio west trolly doubble bin ( ss ) , bio west trolly triple bin ( ss ) , variable pipette ( ce certified ) , variable pipette ( ce certified ) , spirometer , carbon monoxide breath monitor , portable 3 channel ecg recorder , 300ma fixed x ray unit with multi position table , 100 ma, 100 pps line frequency mobile x ray , biphasic defebrillator with aed , ctg nst machine , digital radiography system high frequency ( digital x ray ) , high end premium ultrasound system , syringe pump , ales tissue forceps6 no. , stragiht artery forceps 6 no , curved artery forceps 6no , mayo curved sessior6no , cord clamp forceps , mayo straight sessior 6 no , fomigator macine , tooth forceps , towel clip , bp blade holder 4 no , needleholder 8 no. , drum big size , drum medium size , sucetion pipe , formalin chamber big size , cut sheet , opration gown front with plastic , spinal cover sheet , opration plain seat , opration table cover ( plastic ) , plastic soft sleeper7no , instrument trolly table big size , split ac 1. ton with installation , split ac 1.5 ton with installation , split ac 2 ton with installation , window ac 1. ton with installation , window ac 1.5 ton with installation , window ac 2 ton with installation...

Health Department - Jharkhand

37551293 rate contract for supply of upchar samgri (healing material)(group b) at latehar rate contract for supply of upchar samgri (group b)at latehar , items : , color coded buckets(black,red,yellow,blue) 80 ltr , color coded polybags(black,red,yellow,blue) 80 ltr , color coded buckets(black,red,yellow,blue) 20 ltr , color coded polybags(black,red,yellow,blue) 20 ltr , towels (big size) , towels (baby size) , cotton wool (400 gm) , gauze (than) 16cmx90cm , bandage(than) 16cmx90cm , bandage(roll) 03 inch , bandage(roll) 04 inch , rubber sheet roll , bed sheets (bombay dyeing minimum 200 tc cotton) , pillow (with cover) , blanket (2 kg) , baby blankets , mosquito net (for hospital bed) , ceilling fan (havells) , office table (godrej) , table (computer) (godrej) , revolving stool (godrej) , revolving chair for computer (godrej) , chair office (godrej) , chair plastic (neelkamal) , steel almirah (04 celf) 22 g(godrej) , steel racks (05 celf)(godrej) , gown,operation,cotton , cap. operation, surgeons 36x46 cm , macintosh, operation, plastic , phynile (05 ltr) , plaster of paris (5 kg) , foot step (two step) , sline stand , three seater waiting chair (iron) , three seater waiting chair (steel) , x ray view box , b.p instruments with stand (dimond/mukhargee/doctor) , b.p instruments digital , mucous sucker , lifter forcepe (cheter forcep) , battery (12 volt 200 amp) exide , invertor ( 1400 va) sukam/microtek , air cooler (symphoni/bajaj/sony) medium size , washing machine (comercial) 10 kg lg , washing machine (comercial) 10 kg whirlpool , tube light , curtains with rods , buckets (ss with lid) , waste disposal twin bucket for hypochlorite solution/bleach , dustbin with lid , sauce pan with lid , drum with tap for storing water , digital wall clock , room heater , filing cabinets , computer set with printer& ups (based on latese technology) , xerox machine (black&white) , bed with matteres , matteres for bed , delivery table , rack (04 cell minimum) , lock (link) large size , lock (link) medium size , food trolley (kitche applainces) , garbage hand carts (garbage trolley) , trolley for patient transport. , trolley for transporting medicine and medical supplies , outdoor garbage bins with stand (90 ltr) , indoor garbage bins (90 ltr) , outdoor wheelchair , handicapped walking equipment , deadbody cover (bag) , water heater kettle , led bulb12 watt (havells) , weight machine digital , refrigerators 285 ltr (lg) , refrigerators 285 ltr (whirlpool) , refrigerators 285 ltr (samsung) , astroturf doormat , shoe rach plastic (neelkamal) , bed sheet for children (cartoon print) , stethoscope , ro kent 15 ltr , electric mopping machine...

MGM Medical College - Jharkhand

37441743 supply of medicine and mise surgical items , name of medicine chemical misc surgical , inj. ketamine hydrochloride 50 mg / ml in 10 ml vial , isoflurane100 ml bottle , sevoflurane250 ml bottle , inj. thiopental sodium 0.5 gm , inj. vecuronium bromide 10mg , inj. bupivacaine hydrochloride 0.5% in vial 20ml vial , inj. bupivacaine hydrochloride0.5 in 4 ml ampoule to be mixed with 7.5% glucose solution 4ml ampoule , inj. lidocaine hydrochloride2% 30ml vial , inj. lidocaine hydrochloride 5% to be mixed with 7.5 glucose solution 2ml ampoule , lidocaine hydrochloride ( jelly ) ( topical ) 2% 30gm tube , inj.lidocaine hydrochloride ( viscous solution ) ( topical ) 4% 30ml vial , inj. lidocaine hydrochloride + epinephrine ( adrenaline ) 1% + epinphrine 1:200 000 30ml vial , lidocaine hydrochloride + epinephrine ( adrenaline ) 2% + epinphrine 1:80 000 in 2.2 ml cartridge ) ( dental cartridge ) 50ml vial , inj.lidocaine 2% + epinephrine ( adrenaline ) ( 0.005 mg / 1:2, 00, 000 ) 30ml vial , gel choline salicylate ( 8.7%w / w ) + lidocaine ( 2% w / w ) + benzalkonium chloride ( 0.01% w / w ) , topical spray lidocaine / lignocaine ( 15.0% ) , inj. glycopyrrolate usp0.2mg / ml 1ml ampoule , inj. myopyrrolate , inj. glycopyrrolate + neostigmine methylsulphate 5ml ampoule , inj. atropine sulphate 0.6 mg / ml 2ml ampoule , inj. diazepam5 mg / ml 2ml ampoule , inj. morphine ( sulphate or hydrochloride ) 10 mg 1ml ampoule , inj. fentanyl citrate0.05mg / ml 2ml ampoule , inj. midazolam 1mg / ml 5ml vial , tab. ibuprofen400 mg , suspension ibuprofen100mg / 5ml 60ml bottle , tab. paracetamol 500 mg , tab. diclofenac sodium 50mg , inj. diclofenac sodium25mg / ml pgsurfactant free 3ml ampoule , diclofenac sodium gel1% w / v 25 gm tube , tab. diclofenac potasium50mg , inj. ketorolac1ml 15mg / ml , syrup paracetamol 125mg 60ml , drop paracetamol 100mg / ml 15ml bottle , tab baclofen 5mg , tab. ibuprofen150mg+ paracetamol 500mg , tab. aceclofenac 100mg + paracetamol 500mg , inj. pentazocine 30mg / ml 1ml ampoule , tab. tramadol 50 mg , inj. tramadol 50mg / ml – 5ml , inj. butrophenol , tab. hydroxy chloroquine ( as phosphate or sulphate ) 150 mg ( base ) , tab. sulfasalazine 500 mg , tab. methotrexate 7.5 mg , inj. chlorpheniramine 10 mg / ml 1ml ampoule , tab. chlorpheniramine ( hydrogen maleate ) 4 mg , inj. dexamethasone phosphate disodium 4mg / ml 2ml ampoule , inj. epinephrine hydrocholride ( adrenaline ) 1mg / ml 1ml ampoule , powder for inj. hydrocortisone sodiumsuccinate vial 100 mg , tab. cinnarzine 25mg , syrup cetrizine 5mg / ml , tab. methylprednisolone 4mg , tab. levo cetrizine 5 mg , inj. phenaramin meleate 25mg / ml 2 ml amp , inj. calcium gluconate100 mg / ml 10ml ampoule , inj. pralidoxime25mg / ml 20ml vial , tab. prazocin2mg , tab. deferiprone500 mg , tab. carbamazepine 400mg , tab. diazepam5mg , inj. magnesium sulphate 500mg / ml 10ml ampoule , syrup phenobarbitone20mg / ml 60ml bottle , inj. phenobarbitone 200 mg / ml 1ml ampoule , tab. phenytoin sodium100 mg , inj.phenytoin sodium 50 mg / ml 5ml vial , tab. valproic acid ( sodium salt ) 200mg , tab. valproic acid ( sodium salt ) 500mg , valproic acid ( sodium salt ) ( liquid oral solution ) 200mg 100ml bottle , inj. valproic acid ( sodium salt ) 100 mg / ml 5ml , inj. leveteracetam100mg / ml 5ml vial , syp.leveteracetam100mg / 5ml 200ml bottle , tab. albendazole ( chewable ) 400mgsingle dose pack , suspension albendazole 200mg / 5ml 10ml bottle , tab. mebendazole100mg , suspension mebendazole100mg / 5ml 30ml bottle , tab. diethyl carbamazine citrate50mg , tab. diethyl carbamazine citrate100mg , syp.diethyl carbamazine citrate 10mg / 5ml 30ml bottle , tab. or cap. amoxicillin anhydrous 250mg , tab. or cap. amoxicillin anhydrous 500mg , amoxicillin anhydrous ( powder for oral suspension ) 125mg / 5ml 30ml bottle , ampicillin sodium ( powder for injection ) 1gm vial , inj. amoxicillin 250mg + potassium clavulanate 50mg vial , inj. amoxicillin 500mg + potassium clavulanate 100mg vial , inj. clindamycin 150mg / ml 2ml vial , benzathine benxzyl penicillin ( powder for injection ) 1.44g. benzylpenicillin ( =2.4 million iu ) 5ml vial , cap. cloxacillin sodium 500 mg , tab. or cap. cefalexin500mg , cephalexin ( powder for reconstitution with water ) 125mg / 5ml 30ml bottle , cephalexin ( powder for reconstitution withwater ) 250mg / 5ml 30ml bottle , ceftriaxone sodium ( powder for injection ) 250mg vial , ceftriaxone sodium ( powder for injection ) 1gm 30ml vial , inj. ceftazidime vial 250mg , inj. ceftazidime vial 1gm , imipenem monohydrate + cilastatin sodium ( powder for injection ) 250mg / 250mgvial , tab. amoxicillin + clavulanic acid 250mg + 125mg ( 375mg ) , tab. amoxicillin + clavulanic acid500mg + 125mg ( 625mg ) , syrup cefpodoxime 30ml 50mg / 5ml , tab. cefpodoxime 200mg , tab. ciprofloxacin hydrochloride 250mg , tab. ciprofloxacin hydrochloride 500mg , cap. doxycycline hydrochloride 100 mg , tab. azithromycin 250 mg , tab. azithromycin 500 mg , syrup azithromycin 100 mg / 5ml 15ml bottle , inj. gentamicine sulphate 80 mg 2ml vial , tab. ofloxacin 200mg , tab. ofloxacin 400mg , tab. metronidazole 200mg , tab. metronidazole 400mg , tab. sulphamethoxazole + trimethoprim 800 mg + 160mg ( co trimoxazole ds ) , oral suspensionsulphamethoxazole + trimethoprim 200 mg + 40mg , syrup cefadroxyl 125mg / 5ml 30ml bottle , inj. amikacin vial 250mg / 2ml , inj. amikacin vial 500mg / 2ml , tab. cefixime 200mg , syrup cefixime 100mg / 5ml 30ml bottle , inj. meropenem 500 mg 5ml vial , inj. hyaluronidase 1500iu , inj. placenta extracs 0.1 gm , inj. meropenem 1gmvial , inj. vancomycin 250mg vial , inj. cefotaxime 250mg vial , inj. cefotaxime 1gm vial , inj. netilmicin 50 mg 5 ml vial , inj. netilmicin 300 mg / vial , inj. piperacillin + tazobactum 4g+0.5gvial , inj. etofylline + theophylline2ml ampoule , inj. cefoperazone + sulbactum vial 500mg + 500mg , inj. paracetamol – 5ml , tab ursodeoxycholic acid 300mg , syrup cough 100 ml bottle , inj. methyleprednisolone 40mg / ml , inj. ceftriazone 1gm + tazobectum 125mg / vial , inj. ceftriazone 1gm + sulbectum vial , tab cefpodoxine 200mg + clavulanic acid 125mg , tab. clindamycin 300mg , tab. clindamycin 600mg , tab. rebamipide 100mg , oral suspension ibuprofen ( 100mg ) + paracetamol ( 162.5mg ) , syrup / oral suspension amoxycillin 200mg + clavulanic acid 28.5mg , syrup / oral suspension amoxycillin 400mg + clavulanic acid 57mg , tab misoprostol 100mcg , tab misoprostol 200mcg , inj. methylergonovine ( methergine ) , inj. oxytocine5 iu– 1 ml , inj. carboprost ( pgf2a ) as tromethamine 250mcg / ml – 1 ml amp , inj. carbetocin 100mg / ml – 1ml , inj. ethamsylate 125mg / ml 2ml ampoule , tab ethamsylate 500mg , tab. tranexamic acid500mg , inj. tranexamic acid 500mg / 5ml 5ml ampoule , haemocoagulase lotion 0.2 cu , inj. haemocoagulase , feracrylum gel 15gm , tab ursodeoxycholic , tab l ornithine l aspartate , inj. l ornithine l aspartate , inj. camofylin ( comylofin ) , inj. valethamate bromide , amphotericin b lipholised ( powder forinjection ) 50 mg vial , cap. fluconazole 150 mg , inj. fluconazole 2mg / mlvial , clotrimazole ( mouth paint ) 1% w / v , clotrimazole+steroid ointment1% w / w+0.025% w / w 10g tube , ketoconazole cream , tab. acyclovir 200 mg , acyclovir ( oral solution ) 200mg / 5ml 60ml bottle , acyclovir ( ophthalmic ointment ) 5gm tube 0.03 , acyclovir ( as sodium salt ) ( powder forinjection ) 250 mg 10ml vial , tab. acyclovir 800mg , acyclovir ointment , cap. oseltamivir 75mg , tab. tinidazole 500mg , tab. ornidazole 500mg , norfloxacin 400mg + tinidazole 600mg , ciprofloxacin 500mg + tindazole 600mg , ofloxacin 200mg + ornidazole 500mg , syrup nitazoxamide 100mg / 5ml 30 ml , syrup sodium alginae , tab. itopride 50 mg , tab. itopride 150mg , tab. chlordiazepoxide + clinidium + bromide , inj. artemether 80 mg / ml 1ml ampoule , inj. artesunate 60mg 2ml ampoule , tab. chloroquine ( as hydrochloride, phosphate or sulphate ) 150 mg base , syrup chloroquine ( as phosphate or sulphate ) 50mg / 5ml 60ml bottle , tab. primaquine diphosphate / phosphate 7.5mg , tab. primaquine diphosphate 2.5mg , tab. quinine ( bisulphate or sulphate ) 300mg , quinine ( bisulphate or sulphate ) ( oral solution ) 150mg / 5ml 60ml bottle , inj. quinine dihydrochloride 300mg / ml 2ml ampoule , inj. artether 2ml 150mg , syp. artemethar 200mg + lumefantrin 120 / 5ml 30ml bottle , syp. artemethar 40mg + lumefantrin 240 / 5ml 30ml bottle , drop. ferrous fumarate5mg / ml , ferrous sulphate ( oral solution ) equivalent to 25 mg iron , tab. ferrous sulphate + folic aciddried ferrous slphate ip eq. to ferrous iron 100 mg & folic acid ip 0.5 mg , tab. ferrous sulphate + folic acid equivalent to 20 mg iron + 0.1mg folic acid , syrup ferrous sulphate + folic acid equivalent to 20 mg iron + 0.1mg folic acid per 1ml in bottle , tab. folic acid 5mg , inj. folic acid ( sodium salt ) 1mg 1ml ampoule , inj. ferric carboxymaltose 500mg / 10ml , inj.iron sucrose 100mg / 5ml , inj. heparin sodium5000 iu / ml 1ml vial , inj. phytomenadione10 mg / ml 5ml ampoule , inj. protamine sulphate 10mg / ml 5ml ampoule , tab. warfarin sodium5mg , inj. vitamin k 1mg / ml 1ml ampoule , low molecular weight heparin 40mg , tab. isosorbide medicines 5mg , tab. isosorbide medicines 10mg , tab. verapamil hydrochloride 40mg , inj. glyceryl trinitrate 25mg 5ml ampoule , tab. glyceryl trinitrate 2.6 mg , tab. clopidogrel 75mg , tab. atenolol 50mg , tab. atenolol 25 mg , tab. digoxin 250mcg , digoxin ( oral solution ) 50mcg / ml 30ml , inj. verapamil hydrochloride2.5mg / ml 2ml ampoule , tab. amiodarone200mg , inj. amiodarone150mg 3ml vial , tab. diltiazem 30mg , inj. diltiazem vial 30mg , inj. adenosine 3mg / ml 2ml ampoule , tab. enalapril 2.5mg , tab. enalapril 5mg , tab. methyldopa250mg , cap. nifedipine 5mg , tab. nifedipine 10mg , tab.nifedipine 20mg , inj. mephentermine 30mg / ml 10 mlvial , inj. nor adrenaline 4mg / 2ml 2ml ampoule , tab. metoprolol 25mg , tab. metoprolol 50mg , tab. labetalol 100mg , inj. labetalol 10mg / ml 20ml vial , tab. telmisartan 20mg , tab. telmisartan 40mg , tab. s amlodipine 2.5mg , tab. s amlodipine 5mg , inj. sodium nitropruside 5ml vial , inj. dopamine hydrochloride 40mg 5ml vial , tab. hydrochlorothiazide 25mg , inj. dobutamine 50mg / ml 5ml ampoule , tab. furosemide 40mg , tab. ramipril 2.5mg , tab. ramipril 5mg , tab. atorvastatin 10mg , tab. atorvastatin 20mg , tab. fenofibrate 300mg , miconazole nitrate ointment or cream 2% 15 gm tube , framycetin sulphate cream 0.50% 15 gm tube , povidone iodine solution 5% 500 ml bottle , povidone iodine ointment 5% 500 gm jar , neomycin sulphate + bacitracine zinc ointment 5 mg + 500 iu / gm 1 gm tube , fusidic acid cream 2.00% 10 g , permentherine 5% ointment 10gm , permentherine 5% lotion 60ml , gambenzine hexachloride and certimide lotion 100mg bottle , sodium fusidate skin cream , furosemide ( oral solution ) 20mg / 5ml , inj. furosemide 10mg / ml 2ml ampoule , tab. spironolactone 100mg , tab. acetazolamide 250mg , tab. torsemide 5mg , tab. torsemide10mg , tab. aluminium hydroxide + magnesium hydroxide + active dimethicon / simethicon ( chewable tablet ) 500mg ( 250mg + 250mg +50mg ) , tab. ranitidine150mg , inj. ranitidine50mg / 2ml 2ml ampoule , cap. omeprazole 20mg , cap. omeprazole 40mg , tab.pantoprozole40mg , inj. pantoprozole40mgvial , tab aspirin gastro resistant 150mg , tab. sodium bicarbonate 500mg , tab. metoclopramide hydrochloride10mg , inj. metoclopramide hydrochloride 5mg / ml 2ml ampoule , tab. domperidone10mg , inj. promethazine hydrochloride 25mg / ml in2 ml ampoule , tab. prochlorperazine5mg , inj. ondansetron2mg / ml 4ml ampoule , syrup ondansetron2mg / 5ml 30ml , tab. ondansetron 4mg , liquid paraffinliquid 500 ml bottle , tab. dicyclomine hydrochloride10mg , inj. dicyclomine hydrochloride 10mg / ml 2ml ampoule , inj. drotavarine20 mg / ml 2ml , tab. drotavarine40mg , syp. drotavarine 10mg / 5ml 30ml bottle , syp. drotavarine 20mg / 5ml 30ml bottle , inj. degludec + aspart , inj. aspart analogue , placentrex ointment , nano silver colloid gel 50gm , amnioheal – af gel , tab. bisacodyl5mg , syrup lactulose 667mg / ml 60ml , bisacodyl ( suppository ) 10mg , glycerine sodium chloride ( enema ) 15% w / v 30ml 20ml plastic ampoule , glycerine sodium chloride ( enema ) 15% w / v 50ml 20ml plastic ampoule , oral rehydration salts 1 sachet ( 1 litre ) 20.5 g / l;components to reconstitute 1 litre of glucoseelectrolyte solution: glucose: 13.5g / sodiumchloride: 2.6g / l; potassium chloride:1.5g / l; trisodium citrate dehydrate*: 2.9g / l , zinc sulphate ( dispersible tablt ) 20mg , tab. rifaximin 550mg , tab. zinc 50mg , liquid prednisolone5mg / 5ml 120ml bottle , inj. insulin injection ( soluble ) 40 iu / ml 10ml vial , inj. inermidiate acting insulin ( as compound insulin zinc suspension orisophane insulin ) 40 iu / ml 10ml vial , tab. metformin hydrochloride500mg , tab. glimipride2mg , tab. glipizide 5mg , inj. premix insulin 40iu / ml30 :70vial , inj. rapid acting insulin2ml / cartvial , tab. gliptin , tab. levothyroxine sodium25mcg , tab. levothyroxine sodium50mcg , tab. levothyroxine sodium 100mcg , tab. propyl thiouracil50mg , tab. carbimzole5mg , inj. antitetanus immunoglobulin ( human ) 500 iu vial , inj. diphtheria antitoxin 10000 iuvial , inj. rabies immunoglobulin equine 300 u / ml 5ml vial , inj. anti – d immunoglobulin 150 mcg , inj. anti – d immunoglobulin300 mcg , inj. tetnus immunoglobulin 250 iu , inj. human normal immunoglobulin 16.5% 2mlvial , inj. hepatitis b vaccine 20mcg 1ml vial , inj. tetanus vaccine ( inj. tetanus toxoid ) 0.5 ml ampoule , inj. anti rabies vaccine 2.5 iu 1ml vial , inj. anti rabies vaccine 2.5 iu – 0.5 ml vial , inj. anti snake venum , inj. neostigmine metilsulfate 500 micrograms 1ml ampoule , inj. neostigmine metilsulfate2.5mg 5ml ampoule , gentamicin sulphate eye / ear drop ( solution ) 0.30% 5ml , ciprofloxacin hydrochloride eye / ear drop ( solution ) 0.3% w / v sterile aqueous 5ml , ciprofloxacin hydrochloride ointment ( eye / ear ) 0.30% 5gm tube , acyclovir ophthalmic ointment 3.00% 5gm tube , ofloxacin eye drops ( solution ) 0.30% 5ml , tobramycine eye drops ( solution ) 0.30% 5ml , moxifloxacin eye drops ( solution ) 0.5% v / w 5ml drops , moxifloxacine +dexamithasone eye drop , tab. prenisolone 10mg , carbachol vial , hyaluronidaze vial 1500iu , trypan blue solution vial 0.06% , tropicamide +substance hypromellose 2% , pilocarpine eye drop 2% , carboxymethylcellulose eye drop 0.5% , atropin eye ointment , atropin sulphate eye drop , tab. acetazolamide250mg , surfactant 200mg per vial – 8ml vial , inj. aminophylline 25mg / ml – 10ml amp , salbutamol sulphate ( respirator solution for use in nebulizers ) 5mg / ml 15ml , salbutamol sulphate ( mdi ) ( cfc free ) 100mcg / dose in 200 doses 200 mdi , tab. etiophylline + theophylline77mg+23mg ( 100mg ) , ipratropium bromide ( inhalation ) 200 mdi20mcg / metered dose , formetrol+fluticaxone ( inhalation ) 150 mdi5mcg+50mcg , tab. monteleukast4mg , tab. monteleukast10mg , dextrose ( injectable solution ) ( intravenous fluid ) 5% 500ml , 25% dextrose 25ml ampoule , dextrose ( injectable solution ) ( intravenous fluid ) 10% isotonic 500ml , dextrose with sodium chloride ( injectablesolution ) ( intravenous fluid ) 5% dextrose, 0.9% sodium chloride 500ml , manitol 20% 100 ml , inj. potassium chloride 20ml ampoule11.2% ( equivalent to k+1.5mmol / l, cl 1.5mmol / l ) , sodium chloride ( injectable solution ) ( intravenous fluid ) 0.9% isotonic ( equivalent to na+154 mmol / l, cl 154mmol / l ) 500ml , sodium bi carbonate ( injectable solution ) ( intravenous fluid ) 1.4% isotonic ( equivalentto na+167 mmol / l, hco3 167 mmol / l ) , sodium lactatecompound sloution ( ringer lactate solution ) ( intravenous fluid ) each 100ml contains: sodiumlactate 0.32gm, potassiumchloride 0.4gm, sodium chloride 0.6gm, calcium chloride 0.027gm. 500ml , electrolyte g ( multi electrolytewith 5% dextorse iv injection type iii usp ( injectable solution ) ( intravenous fluid ) each 100ml contains: anhydrous dextrose 5gm, sodiumchloride 0.37gm, potassium chloride 0.13gm, ammonium chloride 0.37gm: sodium sulphate 15mg. 100ml , electrolyte m ( multi electrolytewith 5% dextorse iv injection type iii ip ( injectable solution ) ( intravenous fluid ) each 100ml contains:anhydrous dextrose 5gm, sodiumacetate trihydrate 0.28gm, potassium chloride 0.15g, dibasic potassium phosphate 0.13g sodium chloride 0.091 g 100ml , electrolyte p ( multi electrolytewith 5% dextorse iv injection type iii ip ( injectable solution ) ( intravenous fluid ) each 100ml contains: anhydrous dextrose 5gm potassiumchloride 0.13gm, sodium acetate 0.32 gm, dibasic potassiumphosphate 0.026gm, magnesiumchloride 0.031gm 100ml , amino acid 5% 500ml , amino acid 10% 500ml , haemaccel 500ml bottle , i.v. hydroxy ethyl starch 6% , infusion paracetamol 100ml , human albumin 20% in 100ml , infusion / inj. metronidazole 500mg 100ml bottle , infusionciprofloxacin hydrochloride 100ml 2mg / ml , infusion levofloxacine 500mg / 100ml , tab. ascorbic acid ( vit. c ) 500mg , cap. vitamin e , tab. vitamin a palmitate50000iu , vitamin a palmitate ( as per nrhm supply ) oral oily solution multidose dispenser 100000 iu / ml , inj. thiamine hydrochloride ( vit b1 ) 50mg 10ml , tab. riboflavin ( vit b2 ) 5mg , tab. pyridoxine hydrochloride ( vit b6 ) 25mg , tab. / cap. multivitamin ( b1, b2, b6, niacinamide, pantothenate , folic, acid, ascorbic acid, biotin ) 10mg+10mg+3mg+100mg+50mg+1.5mg+150mg+ 100mcg , cap / tab vitamin e / tocopherol 10.0iu + copper 1.0mg + zinc sulfate 27.5mg + beta carotene 10.0mg + l selenium 75.0mcg + alpha lipoic acid 50.0mg + lycopene 5.0mg , tab. iron , tab b complex , inj. vitamin b complex with vitamin b12 2ml ampoule , vitamin d360000 iu , tab. calcium salts 500mg ( as elemental clacium ) , syrup multivitamin + multimineral 100ml , drop. vitamin d3400iu 30ml bottle , syrup zinc acetate 20mg 30ml bottle , tab. deferasirox 250mg , tab. deferasirox 500mg , xylometazoline nasal drop10ml 0.05% not in childrenless than 3 month , tab cinnarizine25mg , ofloxacin +clotrimazole+beclomethasone+lignocaine ear drops , paradichlorfevzene +chlorbutol +terpentine oil ear drop / wax softner , levofloxacin ear drop , polymyxin b sulphate +chloramphenicol+dexamethasone ear drop , sodium chloride 0.65%+benzalkonium sodium 0.01% nasal drop , l. alanyl l glutamine 50ml bottle20% , silver sulfa diazine 1% w / w with chlorhexidine gluconate solution 0.20%w / w, aloe 0.5% w / w, allontion 0.1% w / w, cream base 200 gm , formalin 5 ltrpack , white petrolium jelly ( medicinal use ) 1 kg jar , silk protein nano silver powder 100gm , recombinant human epidermal growth factor 150? gel , recombinant human epidermal growth factor silver sulfadizine and chlorhexidine gluconate 30gm tube , collagen sheet 15 x 30 cm , collagen sheet 10 x 10 cm , tab. flucoxetine 20 mg , tab. flucoxetine 40 mg , tab. escitalopram 5 mg , tab. escitalopram 10 mg , tab. risperidone 2mg , tab. risperidone 3mg , tab. risperidone 2mg + trihexylphenidine 2mg , tab. risperidone 3mg + trihexylphenidine 2mg , tab. olanzapine 5mg , tab. olanzapine 10mg , tab. olanzapine 15mg , tab. haloperidol 1.5mg , tab. haloperidol 5mg , tab. divalproex sodium 500mg , tab. divalproex sodium 1000mg , tab. lithium carbonate 300mg , tab. carbamazepine 200mg , tab. clonazepam 0.5mg , tab. clonazepam 1mg , tab. lorazepam2mg , tab. trihexyphenidyl 2mg , inj. haloperidol 5mg / ml , inj. lorazepam 4mg / ml , inj. phenargan 2mg / ml , hydrogen peroxide solution 6% w / v 1litre , surgical spirit solution 94% 500ml , carbolic acid 450ml bottle , cidex solutions – 5 ltr jar , chloroxylenol ( dettol ) 1 ltr bottle , e.c. lotion – 450 ml bottle , ethanol – 95% , acetic acid for via , g.v. paint 20ml , lysol 450ml bottle , m. c. marcrom 20ml , chlorhexidine gluconate + cetrimide ( savlon ) – 1ltr bottle , terpentine oil – 500ml bottle , hand sanitizer 500ml bottle ethyl alcohol ( denatured ) 95% ip 76% v / v eq. to absoulute alcohol 72.34% v / v , alkaline phasphatase kit ( pnpp kinetic method ) – 500 ml bottle , ammonium oxalate powder 500gm bottle , strips for occult blood strip per pkt 100 strip , blood glucose kit ( god / pod ) end point method 500ml bottle , blood urea kit ( berthelot method ) enzyme method / end point method – 500ml bottle , brillient cresyl blue ( bcb ) for retic count. liquid 100ml bottle , capillary tube – per tube , combistix ( ph / sp / gr / glucose / proteine ) – per packet 100 strip , cover slip good quality – per packet 100 strip , e dta powder – 250 gm bottle , filter paper – per pkt , serum cholesterol ( chod / pap method ) ( end point method ) 500ml , serum triglyceride ( gpo / pap method ) ( end point method ) 500ml , immersion oil – liquid prafin – 50ml , blood collection glass tube with cap plain 3” x ½” per piece , plan glass tube without cap 3” x ½” per piece , k2 e d t a vial blood collection tube –edta 3” x ½” per piece , blood collection glass tube oxalate 3” x ½” per piece , blood collection glass tube –fluoride 3” x ½” per piece , leishman powder – 25 gm , lugol’s iodine – 100ml bottle , methylene blue – 100 ml bottle , micro cover slip – english glass 22mm x 30mm , n / 10 – hcl for hb% 500 ml bottle , platelets diluting fluid ( ammonium oxalate crystals ) – 100 ml bottle , potassium oxalate powder – 500 gm , r. b. c. fluid ( tri sodium citrate + formalin ) – 100 ml bottle , semen diluting fluid ( sodium bicarbonate powder ) – l00 ml bottle , serum creatinine kit ( jaffes method ) end point method – 500 ml bottle , serum bilirubin kit ( jendrassik method ) end point method – 100ml bottle , s. g. o. t. kit ( modified ifcc method ) – 500 ml bottle , s. g. p. t. kit ( modified ifcc method ) – 500 ml bottle , sodium citrate crystals – 500 gm , sodium fluoridepowder – 500 gm , sodium, potassium and chloloridekit ( end point method ) – 15 tests / kit , sodium hypochloride liquid – 5 ltr jar , sprit rectified – 500 ml bottle , sulphur powder – 500 gm , sulphosalisilic acid powder 500gm , w. b. c. fluid ( glacial acetic acid + sod.chloride ) 100 ml bottle , hemoglobino meter set , urine strips 2k ( ketone+glucose ) per packet 100 strips , urine strips for sugar, protein, blood & ketone ( multistix ) – perkit 100 strips , hbsag test kit – per test , uric acid kit –end point method 100ml bottle , micro pipette 1000 ?l ( 1ml ) per piece , micro pipette 5 – 100 ?l per piece , esr stand – 50 holes per piece , esr stand – 20 holes per piece , test tube stand 100 holes per piece , test tube stand 50 holes per piece , test tube stand 20 holes per piece , glass slide per piece , glass marker pencil per piece , anti a1 – 5 ml , anti a grouping kit – 10 ml , anti b grouping kit – 10 ml , anti d grouping kit – 10 ml , anti d rh typing kit– 10 ml , anti h – 5 ml , anti ab grouping kit – 10ml , anti ahg kit 5ml , copper sulphate crystal anhydrous 500gm , anti human globulin 15 ml , band aid – per pice , distilled water –5 ltr jar , hbsag test kit elisa ( iv generation ) – per test , hcv test kit elisa ( iv generation ) – per test , hiv test kitelisa ( iv generation ) – per test , malaria test kit ( antigen ) – per test , vdrl ( rpr ) test kit – 20 ml , lactin a1 , sensitizes o cell , single blood collection bag per piece , double blood collection bag per piece , triple blood collection bag per piece , hand press ball per piece , kahn tube per piece , micro tips – 1000 ?l per piece , micro tips – 100 ?l per piece , micro slide english glass per piece , lancet per piece , ambu bag 240ml , abdominal drain no. 12 , abdominal drain no. 14 , abdominal drain no. 16 , absorbable gelatin spongegel ( ab gel ) , bandage cloth ( as per f ii ) 100 x 20 meters , blood transfusion set ( b. t. set ) , b. p. blade no. 11 , b. p. blade no. 15 , b. p. blade no. 20 , b. p. blade no. 22 , b. p. blade no. 24 , b.p. instrument marcural , b.p. instrument digital , b.p. instrument marcuralwith stand , crescent knife , cotton 400 gm. net. loss on drying – i.p. limit – nmt 8%w / w sinking time – i.p. limit – nmt 10 seconds , dispossible apron , lead apron , dispossible face mask triple layer , n 95 particulate respirator mask , personal protection equipment ( ppe kit ) , dispossible cap , foly’s catheter with styletno. 8 , foly’s catheter no. 10 , foly’s catheter no. 12 , foly’s catheter no. 14 , foly’s catheter no. 16 , electric needle burner with syring destroyer , endotracheal tube ( disposable size 0 , endotracheal tube ( disposable size 1 , endotracheal tube ( disposable size 2 , endotracheal tube ( disposable size 6.5 , endotracheal tube ( disposable size 7 , endotracheal tube ( disposable size7.5 , endotracheal tube ( disposable size 8 , epidural kit 18 g , sterile feeding tube no. 4 , sterile feeding tube no. 5 , gauge cloth ( as per f ii ) 90 x18 meters , paraffin gauze dressing ( jelonet ) , gulco meter strips – ( accu chek active ) , gulco meter strips – ( romo check plus ) , i gel airway 3 , i gel airway 4 , i.v. cannula no. 16 , i.v. cannula no. 18 , i.v. cannula no. 20 , i.v. cannula no. 22 , i.v. cannula no 24 , leucoplast4” x 5 mtr ( adhesive tape ) , round adhesive tape , liga clip 300 , microporous 1” , needle 26g , keratome knife 2.8mm , site port 15 degree , neonatal nasal prongs size 0 , neonatal nasal prongs size 1 , neonatal nasal prongs size 2 , oxygen flow meter ( for oxygen cylinder ) , oxygen face mask adult size , oxygen face mask child size , oxygen nasal mask , plaster of paris roll 4” , plaster of paris roll 6” , ryles tube size – 6 , ryles tubesize – 8 , ryles tube size – 10 , ryles tubesize 12 , ryles tube size – 14 , ryles tube size 16 , ryles tube size – 18 , saline set ( i. v. set ) , scalpvein set size – 22 , scalpvein set size – 23 , scalpvein set size 24. , silicone ventouse cup 40mm , silicone ventouse cup 50mm , stethoscope , neonatal stethoscope , digital thermometer , chromic catgut with needle no. 1 , chromic catgut with needle no. 1 0 , chromic catgut with needle no. 2 , chromic catgut with needle no. – 2 0 , chromic catgut with needle no. – 3 0 , mersilk cutting needle no. 1 , mersilk cutting needle no. 1 0 , mersilk cutting needle no. 2 0 , mersilk cutting needle no. 3 0 , mersilk cutting needle no. 4 0 , vicryl with needle no. – 1 , vicryl with needle no. – 3 0 , vicryl with needle no. – 4 0 , suture 10 0 absorble , suture 8 0 , silk suture 3 0 with reverse cutting needle , silk suture 4 0 with reverse cutting needle , port closure needle with vicryl , proline no. 1 , proline no. 1 0 , proline no. 2 0 , proline no. 3 0 , proline no. 4 0 , ethelon cutting no. 2 0 , ethelon cutting no. 3 0 , proline mesh 15 x 15 , proline mesh 7.6 x 15 , proline mesh 3 x 6 , surgical gloves disposable sterilized size – 6” , surgical gloves disposable sterilized size – 6½” , surgical gloves disposable sterilized size – 7” , surgical gloves disposable sterilized size – 7 ½ ” , elbow length gloves size 7” , insulin syringe with short needle disposable 1 ml , syringe with needle disposable – 2 ml. , syringe with needle disposable – 3 ml. , syringe with needle disposable – 5 ml. , syringe with needle disposable – 10 ml. , syringe with needle disposable – 20 ml. , syringe with needle disposable – 50 ml. , nebulizer mask adult size , syringe pump connecting tube , three way cannula , chest aspiration needle , peripheral nerve stimulator nerve block needle 5cm , peripheral nerve stimulator nerve block needle 10cm , disposable needle18g , urobag , spinal needle n0. 25g , plastic suction cannula , m.v.a. kit with cannula syringe , bakri balloon catheter for p.p.h. , lbc ( liquid based cytology ) kit , pipelle cannula for endometrial biopsy , pap smear kit ( koplin jar, cyto brush, ayre spatula ) , pusle oxymeter , interceed , umbilical cord clamp ( disposal ) , delivery kit , x – ray film size 6.5” x 8.5” , x – ray film size 8” x 10” , x – ray film size 10” x 12” , x – ray film size 12” x 12” , x – ray film size 12” x 15” , x – ray film size 14” x 17” , dvbdigitalx ray film size 8” x 10” , dvbdigitalx ray film size 10” x 12” , dvbdigitalx ray film size 14” x 17” , dve digitalx ray film size 8” x 10” , dve digitalx ray film size 10” x 12” , dvedigitalx ray film size 14” x 17” , digital cassett with screen8x10 , digital cassett with screen10x12 , digital cassett with screen14x17 , ultra sound film , c.t. scan film fuji ( 14” x 17” ) , c.t. contrast 100ml , x ray developer ( to make 9 ltrs ) , x ray fixer ( to make 9 ltrs ) , replenisher ( to make 4.5 ltrs ) , ultra sound jelly 5 ltr , rubber sheet ( mackintosh ) double colour, water proof , ecg jelly – 250 gm , dinoprostone gel – 150 gm tube...

Ranchi Municipal Corporation - Jharkhand

37218738 bids are invited for b.p. apparatus , hub cutter , needle destroyer electric , adult stethoscope , digital thermameter , iv set , weighing machine infant , weighing machine adult , dental probe , nebulizer , measuring tape , snellen vision chart , near vision chart , height measurement , tongue depressure , mouth gag , mouth mirror , dressing tray with lid , surgical needle curvical , baby weighing scale , new born tharmameter , designated new born tray ss with led , ss trayu with cover , scissors , artery forceps , rack table for keeping trays fluids , examination table , footstep , revolving stool , screen saparator with stand , side locker , bed sheet , blanket , matress for examination table , chairs for waiting area 3 seater , stadio meater height measurement , gause cutting scissor straight , dressing drum with lid , dressing table , suction machine electric foot operated suction apparatus , oxygen set mask with tubing , cheatle forcaps , kidney tray , x ray stand , pillow , torche led total quantity : 2976...

Ranchi Municipal Corporation - Jharkhand

37021659 bids are invited for bp apparatus , hub cutter , needle destroyer electric , adult stethoscope , digital thermameter , iv set , weighing machine infant , weighing machine adult , dental probe , nebulizer , measuring tape , snellen vision chart , near vision chart , height measurement , tongue depressure , mouth gag , mouth mirror , dressing tray with lid , surgical needle curvical , baby weighing scale , new born thermameter , designated new born tray ss with led , ss tray with cover , scissors , artery forceps , rack table for keeping trays, fluids , examination table , footstep , revolving stool , screen saparator with stand , side locker , bed sheet , blanket , matress for examination table , chairs for waiting area 3 seater , stadio meter height measurement , gause cutting scissor straight , dressing drum with lid , dressing table , suction machine electric , oxygen set mask with tubing , cheatle forcaps , kidney tray , xray stand , pillow , torch led , revolving chair , table , chair , almirah , lock and key...

Rural Works Department - Jharkhand

36985276 bids are invited for nuhm jamshedpur 1 50 patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chairsteel , almira , iron self rack , 3fold bedside screen with curtain stand , bp machinedigital , bp machinemercery , thermometerdigital , weight machineadult , weight machineinfant , stethoscope , hub cutter , medicine tray , cotton roll , leukoplast tap , leukoplast tap 5 cm , iv stand , gloves 65 , register4 , register6 , register10 , register12 , scessiormedium , a 4 paperwhite , pen , fly leaf , stapler with pinsmall , stapler with pinbig , panching machine , paper weight , wall clock , stamp pad mediumblue , fevi stickbig , plastic scale , link lock45 , link lock50 , link lock55 , opd register , opd slip , attendance register , stock register , visitor registerbook , pillow , pillow cover , floor wiperrubber , floor wiperjut , door mat , harpic1 ltr , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , dustbin with cover , plastic bucket big , plastic bucketmedium , plastic bucketsmall , plastic mug , colour coded bin waste disposable buckets , garbage poly bagblack 10 kg , garbage poly bagred 10 kg , hand wash liquid , hand wash soap , water bottle 1 ltr , tiolet cleaning brush , bed sheet , plastic chair , led tube light , led bulb tshape , ceiling fan , wall fan , desktop , webcame , speaker total quantity : 4812...

Health Medical Education And Family Welfare Department - Jharkhand

36850504 bids are invited for functional refrigerator. , boiler or autoclave , dressing drum with lid , kellys pads , torch torch boxtype prefocused 4 cell , examination lamp , wall clock with second hand , iv stand , bp apparatus , adult stethoscope , fetoscope doppler , basin 825 ml ss , digital thermometer , gauze cutting scissor stratight , weighing machine infant , weighing machine adult , thermometer rectal , dental probe , nebulizer , measuring tape , tallquist hb scale , snellen vision chart , near vision chart , stadiometer height measurement , sims retractor depressor , kellys heamostat forceps straight 140 mms , vulsellum uterine forceps curved 25.5 cm , cuscos graves speculum vaginal bivalve small, , cuscos graves speculum vaginal bivalve medium , cuscos graves speculum vaginal bivalve large , plain force s , tongue depressor , mouth gag , mouth mirror , cheatle forceps , dressing tray with lid , suturing tray with lid ss small , suring needle curved , suturing thread , round slit hole towel , ambu bag , maskneonatal size 0 , maskneonatal size 1 , designated new born tray ss with lid , ss tray with cover , scissors , artery forceps , sims speculum veginal double ended iss mediam , cord cutting scissor surgical blade for cutting cord , bowl for antiseptic solution , kidney tray small , kidney tray big , episiotomy scissor , allis forceps , toothed forceps , thumb non toothed forceps , needle holder , suture needle straight 10 , suture needle curved , ppiucd insertion forceps , airway , labour table , rack table for keeping trays, fluids , foot step , stool , screen seperator with stand , almira , rack for keeping sleepers shoe covers outside labour room , side locker , bed sheets , blankets , office table , visitor chair , examination table , mattress for examination table , bucket big , bucket small , mugs , chairs for waiting area three in one set , white wrighting board , syringes 20 cc, 10 cc, 5 cc, 2 cc and ad syringes 0.5ml and 0.1 ml , disposable masks , sterile surgical gloves , gown apron , shoe cover , caps , mucous extractor , disposable cord clamp , heavy duty gloves , foleys catheter , disposable sterile urethral catheter rubber plain 12 fr , disposable lancet pricking needles , chlorine tablets , wooden speactula , iv cannula 16, 18, 20, 22 , iv set , mackintosh sheet 5 meter , 5 l plastic tub for keeping chlorine solution , bucket for keeping 1percent chlorine solution for spillage , colour coded bins yellow , colour coded bins red , colour coded bins black , colour coded bins blue , colour coded plastic bags yellow, red, blue and black , mopping stick , micropore tape , urine bags , feeding tube , hand towels , gauze piece roll , cotton swab roll...

Medical College Hospital - Jharkhand

36774360 tender for supply and installation of medical equipments nebulizer infantometer stadiometer phototherapy unit infant radiant warmer nasal prongs iv cannula scalp vein set nasogastric tube oropharyngeal airway iv infusion sets iv infusion sets centrifuge (angle head) microsope (binocular, inclined) illuminator slides (microscope, plain) clinical (box) mattress for hospital bed spot light (for delivery) generator set blood pressure apparatus stethoscope tongue depressor thermometre clinical instrument trolley iv stand foetoscope hub cutter and needle destroyer ambu bag ambu bag etc.,...

Health Medical Education And Family Welfare Department - Jharkhand

36768509 bids are invited for adult stethoscope , allis forceps , almira , crash card full ss , ambu bag , artery forceps , autoclave 12x22 , bed sheets , bowl for antiseptic solution , bp machine digital , bucket big , caps disposable , chair , 3 seater visitor chair , cheatle forceps , colour coded bins black , linner for dustbin black 24x24 , colour coded bins blue , linner for dustbin blue 24x24 , colour coded bins red , linner for dustbin red 24x24 , colour coded bins yellow , linner for dustbin yellow 24x24 , dari with room size 12 x 15 , dental probe , digital hemoglobinometer , digital hemoglobin strip , digital thermometer , disposable cord clamp , disposable mask , dressing drum with lid 11x9 jointed , dressing tray with lid 10x8 with cover , episiotomy scissor , examination table , feeding tube , fetal doppler , fire extinguisher 4500g co2 type vid full , folyes catheter , foot step , gauge cutting scissor straight , glucometer , glucometer testing strips , hand towels , heavy duty gloves , hub cutter , iv set , iv stand , kellys pads , kidney tray 12inch , kidney tray 8inch , labour table , mackintosh sheet 10 mtr , mats for yoga , micropore tapes 1x5mm 12 roll , mouth mirror , mugs , near vision chart , nebulizer , niddle destroyer electric , needle holder , new born thermometer infrared , oxygen hood neonatal , oxygen set mask with tubing , pillow , pillow cover , ppiucd insertion forceps , sanitizer 100 ml , scissors , shoe cover disposable pair , sims retractor , snellen vision chart , soap , sterile surgical gloves pair , suction machine electric , syringe 5 ml , tongue depressor , toothed forceps , towel , tuning fork , urine bags , urine pregnancy rapid test , weighing machine adult , weighing machine infant...

Department Of Personnel & Administrative Reforms - Jharkhand

36760231 bids are invited for hwc stenghthening doctor table , doctor chair , counter table , mattress , bed side locker , chair , medicine rack , mop , ceiling fan , digital thermometer , examination table , refrigerator , surgical dressing tray , labour table with mattress , instrument trolley , bench , iv stand , stethoscope , digital bp machine , almirah , hand held fetal doppler , radiant warmer , weight machine adult , infant weighing scale , ambu bag adult , ambu bag child , water purifier , episiotomy scissor , colour coded bin , disposable gown , disposable face mask , disposable cap , utility gloves , cheatle forceps , autoclav , surgical gloves 7 , surgical gloves 6.5 , nebulizer machine , wall clock , vaporizer machine , blanket , sharp container , bed side screen , baby towel , socks and cap for baby disposable , disposable sheet for covering labour table total quantity : 60846...

Department Of Agriculture - Jharkhand

36610606 bids are invited for veterinary equipments veterinary stethoscope , digital rectal thermometer , b.p handle s.s no. 4 , scalpel blade s.s no. 24 , suturing needles curved , suturing needles straight traumatic , silk thread roll , alice tissue forcep , dressing forcep , artery forcep , hand gloves disposable vinyle examination 8 no gloves , infusion set , bandage drapes , cotton absorbant 400 gm total quantity : 13600...

Nagar Palika Parishad - Jharkhand

36579833 tender for supply of following materials desktop computer all in one 20 24’inc intel core/511th generation onwards ram 8gb, hard drive 1 tb or 512 ssd, ups with inbuilt antivirus, ms office colour printer with scanner (hp/canon/epson) office table (size 5×3) doctor chair revolving office chair visitor (steel with leather seat) almirah 4 or 5 rack (branded) iron rack for medicine patient examination table pulse oximeter glucometer haemoglobin meter digital stethoscope bp machine digital weight machine digital height meter thermometer digital wall clock door mat lock (link) register large register medium bed side screen guard with curtain emergency durg tray nebulizer machine patient waiting 3 seater chair patient stool (steel) invertor with battery (1000 va+180 ah battery) fire extinguisher ambu bag i/v stand tongue depression mouth gag selling fan(bajaj/havells/v guard) dustbin 50 litre colour coded bin sharp container towel suction machine foot step nebulizer torch phooljhadoo mop sikjhadoo jholjhadan a4 paper pen bucket (20 25 ltr.) mug bulb 15 wt baby weight machine digital ...

Rural Works Department - Jharkhand

36523485 bids are invited for basic equipment urban hwcs 1 53 patient bed , patient bed mattress , pillow , pillow cover , bed side locker , blanket , revolving stoolsteel , examination table , foot step , bed sheet , office table , plastic chair , office chair , running chair steel , almira , iron self rack , curtain stand , led tube light , led bulb t shape , ceiling fan , wall fan , battery and inverater , water purifier , register 4 , register 6 , register 10 , register 12 , scessior medium , scessior small , scessior big , a 4 paper white , pen , fly leaf , stapler with pinsmall , stapler with pinbig , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock , link lock 50 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register book , floor wiper rubber , floor wiper jut , door mat , harpic 01 ltr , colin spray , broom phul , broom nariyal , phenyl , phenyl goli , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , disposable buckets , garabage poly bag , hand wash liquid , hand wash soap , water bottle 1 ltr , tiolet cleaning brush , bp machine digital , bp machine mercery , digital gulocmeter , digital hemogobinometer , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , cottion roll , leukoplast tap 125 cm , leukoplast tap 5 cm , iv stand , gloves , computer desktop total quantity : 14430...

Nagar Palika Nigam - Jharkhand

36521692 tender for supply of following items almirah visitor chair revolving chair patient stool iron rack (non brand) inverter battery (200ah) dustbin 25 lit (4set) digital hb meter digital hb meter strip glucometer strip for glucometer lancet pulse oximeter garbage bag (kg) curtin with fitting water purifier (ro) refrigerator semi fowler hospital bed with cushion bed side locker side screen fire extinguisher abc powder 6kg executive table b.p. /apparatus hub cutter needle destroyer electric adult stethoscope digital thermometer iv set weighing machine (infant) weighing machine (adult) dental probe nebulizer measuring tape snellen vision chart near vision chart height measurement tongue depressor mouth mirror dressing tray with lid surgical needle cervical baby weighing scale new borne thermometer designated new born tray ss with lid ss trayu with cover scissors artery forceps rack/table for keeping trays, fluids examination table foots pet revolving stool screen separator with stand side locker bed sheet blanket mattress for examination table chairs for waiting area (3 seater) stadiometer (height measurement) gause cutting scissor straight dressing drum with lid dressing table suction machine electric/foot operated suction apparatus oxygen set (mask with tubing) cheatle forceps kidney tray x ray stand pillow torch led ...

Urban Development And Housing Department - Jharkhand

36505547 bids are invited for equipments for uhwc under xv fc for ranchi bp apparatus , hub cutter , needle destroyer electric , adult stethoscope , digital thermameter , iv set , weighing machine infant , weighing machine adult , dental probe , nebulizer , measuring tape , snellen vision chart , near vision chart , height measurement , tongue depressure , mouth gag , mouth mirror , dressing tray with lid , surgical needle curvical , baby weighing scale , new born thermameter , designated new born tray ss with led , ss tray with cover , scissors , artery forceps , rack table for keeping trays, fluids , examination table , footstep , revolving stool , screen saparator with stand , side locker , bed sheet , blanket , matress for examination table , chairs for waiting area 3 seater , stadio meter height measurement , gause cutting scissor straight , dressing drum with lid , dressing table , suction machine electric , oxygen set mask with tubing , cheatle forcaps , kidney tray , xray stand , pillow , torch led , revolving chair , table , chair , almirah , lock and key total quantity : 720...

Nagar Palika Nigam - Jharkhand

36447044 tender for supply of following items desktop computer all in one 20 24’ inc. – intel core i5 11th generation onwards ram 8 gb, hard drive 1tb or 512 ssd, ups with inbuilt antivirus, ms office – 1 pc 27 invertor with battery (1000 va+ 180 ah battery) color printer with scanner (hp/canon/epson) 28 fire extinguisher office table (size 5x3) 29 ambu bag doctor chair revolving 30 i/v stand office chair visiter (steel with leather seat) 31 tongue depression almirah – 4 or 5 rack (branded) 32 mouth gag iron rack for medicine 33 ceiling fan (bajaj/havels/vguard) patient examination table 34 dust bin 50 ltr. pulse oxymeter 35 color coded bin gluco meter 36 sharp container hemoglobin meter digital 37 towel stethoscope 38 suction machine b.p. machine digital 39 foot step weight machine digital 40 nebulizer height meter 41 tourch thermometer digital 42 phool jhadoo wall clock 43 mop door mat 44 sik jhadoo lock (link) 45 jhol jhadan register large 46 a4 paper register medium 47 pen bed side screen guard with curtain 48 bucket (20 – 25 ltr.) emergency durg tray 49 mug nebulizer machine 50 bulb 15 wt patient waiting 3 seater chair 51 baby weight machine digital patient stool (steel) ...

Rural Works Department - Jharkhand

36284227 bids are invited for necessary items functional refrigerator , autoclave , dressing drum with lid , mattress , kellys pads , torchtorch box type pre focused 4 cell , examination lamp , wall clock with second hand , iv stand , sunction machine electric operated , oxygen cylinder b type with troly , oxygen set mask with tubing , bp apparatus digital , adult stethoscope , doppler , basin 825 ml ss , hub cutter , needle destroyer , digital thermometer , gauze cutting scissor stratight , weighing machine infant , weighing machine adult , thermometer rectal , dental probe , nebulizer , measuring tape , digital hemoglobinometer , snellen vision chart , near vision chart , stadiometer height measurement , tongue depressor , mouth gag , mouth mirror , cheatle forceps , dressing tray with lid , suturing tray with lid ss small , suring needle curved , suturing thread , round slit hole towel , radiant warmer table with side rails , ambu bag , mask neonatal size 0 , mask neonatal size 1 , baby weighing scale , new born thermometer , oxygen hood neonatal , designated new born tray ss with lid , ss tray with cover , scissors , artery forceps , sims speculum , cord cutting scissor surgical blade for cutting cord , bowl for antiseptic solution , kidney tray small , kidney tray big , episiotomy scissor , allis forceps , toothed forceps , thumb non toothed forceps , needle holder , cuscoss graves speculum vaginal large , cuscoss graves speculum vaginal medium , cuscoss graves speculum vaginal small , sponge holding forceps , ppiucd insertion forceps , uterine sound for iucd , airway , labour table , racktable for keeping trays fluids , delivery troly , foot step , stool , screen seperator with stand , almira , rack for keeping sleepersshoe covers outside labour room , cot , pillow , pillow cover , side locker , bed sheets , blankets , office table , plastic chair , examination table , mattress for examination table , plastic bucket big , plastic bucket small , plastic mugs , chairs for waiting area three in one set , led tv for iec , white wrighting board , syringes 20 cc pic 10 cc 5 cc 2 cc and ad syringes 05ml and 01 ml each 250 pic , disposable masks , sterile surgical gloves , apron , shoe cover , caps , mucous extractor manual , disposable cord clamp , heavy duty gloves , foleys catheter , dry cell battery , partograph in case sheets , iv cannula 16 18 20 22 , iv set , sanitary napkins , mackintosh sheet 5 meter , disposable delivery kit for delivering hiv patients emergency , disposable delivery kit for normal delivery , 5 l plastic tub for keeping chlorine solution , bucket for keeping 1 pracent chlorine solution for spillage , colour coded bins yellow , colour coded bins red , colour coded bins black , colour coded plastic bags yellow red and black , mopping stick , micropore tape , urine bags , iucd 375 380a , sheets for drying and wrapping baby , feeding tube , cleaning material and detergents , insectiside treated net , window screens , inter dental cleaning aid , 200 watt led bulb , online ups 1 kva with 60 minute backup , fire extinguisher , hand towels , hand washing soap , towel , gauze piece roll , cotton swab roll , tuning fork , ice pack box , vaccine carrier , floor mopping stick , dari with room size , mats for yoga , curtains , nasal speculum st claires , ear speculum metallic dull finish , jobson horne probe , eustachian catheter , micropore tapes , feeding tubes total quantity : 54295...

Personnel and Administrative Reforms Department - Jharkhand

36257777 bids are invited for medical equipement mse bp appartus , adult stethoscope , hub ctter , neddle destroyer electric , digital thermometer , guaze cutting scissor , weighing machine , nebulizer , measuring tape , standiometer , dressing tray with lid , baby weighing scale , scissors , rack table for keeing trays , fluids , foot steps , stool , screen seperator with stand , patient bed , pillow , pillow cover , side locker , bed sheets , blankets , examination table , mattress for examination taable , chairs for waiting area , dressing drum with lid , examination lamp , iv stand , suction machine electric foot oprated suction apparatus total quantity : 171...

Health Medical Education And Family Welfare Department - Jharkhand

36143151 bids are invited for supply of hospital equipments 1 ultrasound machine 2 autoclave 3 bp cuff / sphygmomanometer 4 electric hub cutter delivery table 5 6 warmer 7 nebulizer suction machine 8 9 infantometer 10 fetoscope 11 stethoscope 12 ecg machine 13 digital x ray machine 300 ma 14 ma...

MGM Medical College - Jharkhand

36097553 supply of chemicals and reagents , xylene (500 ml) , eosine (125 ml) , paraffin wax (500 gm) , formaline (5 litre) , glycerol (500 ml) , ecg gel (250 ml) , tissue paper (each packet) , wash bottle (each) , paster pippette (each) , multidet 10x (1 litre) , blotting paper (each) , acetic acid (500 ml) , capillary tube (each) , anti abd (10 test) , cotton (400 gm) , spirit (500 ml) , leishman stain (500 ml) , distilled water (5 litre) , glass slide (50 piece) , watch glass (100 piece) , dropper (1000 piece) , rbc diluting fluid (500 ml) , wbc diluting fluid (500 ml) , cedar wood oil (500 ml) , benzoic acid (500 gm) , thio urea (500 gm) , creatinine powder (100 gm) , picric acid (500 gm) , sodium tungstate (500 gm) , sulphuric acid (500 ml) , ferric chloride (500 gm) , (85%) phosphoric acid (500 gm) , diacetyl monoxime (100 gm) , thiosemicarbazide (100 gm) , phenylmercuric acetate (500 gm) , urea powder (500 gm) , sodium sulphate (500 gm) , copper sulphate (500 gm) , rochelle salt (500 gm) , albumim powder (500 gm) , succinic acid (500 gm) , brij 35 solution (500 gm) , bromocresol green (100 gm) , sodium azide (500 gm) , sodium chloride (500 gm) , cholesterol powder (100 gm) , l1 buffer reagent (500 gm) , l2 colour reagent (500 gm) , calcium powder (standard) (100 gm) , absolute methanol (500 ml) , sodium nitrate (500 gm) , brilrubin (standard) (100 gm) , buffer (r1) (500 gm) , buffer (r2) (500 gm) , magnesium chloride (500 gm) , 4 nitrophenyl phosphate (500 gm) , zinc sulphate (500 gm) , 2 amino 2 methyl 1 propanol ph 10.4 (500 gm) , hedta (each) , acetone (500 gm) , sodium citrate (500 gm) , alcohal (5 litre) , rectified spirit (5 litre) , syringe ( 5 ml) , a naphthol (100 gm) , centrifuge (each) , solvent mixture n butanol (500 gm) , whatman filter paper no. 1 (per packet) , p.h. meter (each) , electronic weight machine (each) , dipstick for urien analysis (per box) , spirit lamp , blood pressure instrument , stethoscope , syringe 2ml (100 pieces pack) , syringe 5ml (100 pieces pack) , syringe 10ml (50 pieces pack) , glucon d (500 gm) , test tube holder , test tube (12 x 75) , test tube (12 x 100) , band aid long (1000 pieces) , savlon (1000 ml) , scissor , bone marow needle (klimas type) , bone marow needle (salahstype) , jamshedi aspiration biopsy needle , westerngren pipette , wntrobes tube , disposable needle (100 pcs) , surgical cotton (400 gm) , povidine iodine (450 ml) , formaldehyde (5 litres) , ethyl alcohol (500 ml) , methanol (500 ml) , microtome blade , hydrochloric acid (500 ml) , potassium alum (500 gm) , ea 36 (125 ml) , ea 50 (125 ml) , og6 (125 ml) , ammonia solution 500 , micro slide (50 pcs) , cover slip 22x30 , cover slip 22x50 , rubbing solution (500 ml) , tri sodium citrate (500 gm) , glacial acetic acid (500 ml) , sodium nittropurside (100 gm) , fouchets reagent (100 ml) , lieishman stain (500 ml) , haemotoxylin (100 ml) , eosin stain (100 ml) , diethyl ether (500 ml) , dpx mountant (250 ml) , edta k3 vaccutainer (100 pcs) , plain vaccutainer (100 pcs) , oxalate flouride vaccutainer (100 pcs) , geimsa stain (25 gm) , hydrochloric acid (500 ml) , liquid hand wash (1 litre) , hand senitizer (500 ml) , nitrile hand gloves (50 x 2 pair) , examination gloves (each pair) , lifeboy soap (per pcs) , blood calture bottle (per pcs) , mackonkey agar (500 gm) , nutrient agar (500 gm) , nutrient broth (500 gm) , cled agar (500 gm) , soyaben broth (500 gm) , sda agar (500 gm) , malaria card (50 pcs) , filarial (10 pcs) , widal test (4x5 ml) , aso titer (35 test) , crp (35 test) , ra factor (35 test) , syringe (5 ml) , hand wash (500 ml) , glass tube (big size) (100 pcs) , rpr (500 test) , test tube stand (each) , swab stick (100 pcs) , urine calture pot (100 pcs) , petridish disposable (each) , marker pen (each) , room thermometer digital (each) , hbsag card (50 test) , hav card (10 test) , hcv card (50 test) , ns1 card test (10 test) , albert stain (100 ml) , atcc strain (100 ml) , potassium hydroxide (500 ml) , seder oil (10 ml) , normal saline (1 litre) , buffer water (500 ml) , basic fushin (500 gm) , ethanol 95% (500 ml) , phenol (500 gm) , iodine (100 gm) , potassium iodine (500 gm) , crystal violet (25 gm) , methylene blue (100gm) , safarnine (500 gm) , apron (each) , cover slip (50 pcs) , slide box (50 pcs) , nacl (500 gm) , hcl concentrated (500 ml) , hemoglobin kit , phenol red (500 gm) , sodium hydroxide (500 gm) , hydrochloric acid (500 ml) , test tube , burette , phenyl (500 ml) , leishman powder (25 gm) , potassium hydroxide (500 gm) , potassium iodide (500 gm) , lysol (500 ml) , white vaseline (1 kg) , yellow vasline (1 kg) , glycerine (500 ml) , methyle alcohol (500 ml) , salieylie acid (500 ml) , mercurochrome (25 gm) , bleaching powder (500 gm) , multi det 10x solution (1 litre) , filaria card (10 test) , widal (4x5 ml) , calcium chloride powder (500 gm) , muller hinton agar (500 gm) , peptone water (500 ml) , tsi agar (500 gm) , urease agar (500 gm) , methyle red indicator (125 ml) , oxidase reagent (5 gm) , anaerobic agar (500 gm) , brain heart infusion (500 gm) , oxidase disc (each) , lugols iodine (100 ml) , grams stain (100 ml) , bhi suppliment with 0.05% sps (each) , pa coliform test kit (each) , urea agar base (500 gm) , x.i.d. agar (500 gm) , simmons citrate agar (500 gm) , triple sugar iron agar (500 gm) , mr vp medium glucose broth (500 gm) , glucose broth (500 gm) , all antibiotic disc (25 discs) , meropenam (each) , feropenam (each) , ea 36 (each) , i v set & scalp vein set (each) , syringe (10 ml) (100 pcs) , syringe (20 ml) (50 pcs) , insulin syringe (100 pcs) , intracath iv (camula 18g) , intracath iv (camula 20g) , intracath iv (camula 22g) , intracath iv (camula 24g) , tourniquet , leucoplase , drip stand , drip rl , drip ns , hitamine , nebulizer , insulin pen device , lp neddle , ryles tube , enema appliance , disposable enema pack , salicylic acid (500 gm) , benzidine powder (100 gm) , anti a (10 ml) , anti b (10 ml) , anti d (10 ml) , magnesium oxide (500 gm) , activated charcol powder (250 ml) , tannic acid (250 ml) , clove oil (250 ml) , mercuric oxide (250 gm) , b.a.l. (500 gm) , e.o. sin (125 ml) , custer oil (100 ml) , mercuric iodide (250 gm) , edta (200 gm) , sodium oxalate (500 gm) , sodium flouride (500 gm)...

Personnel and Administrative Reforms Department - Jharkhand

36045860 bids are invited for medical equipments bp appartus , adult stethoscope , hub ctter , neddle destroyer electric , digital thermometer , guaze cutting scissor , weighing machine , nebulizer , measuring tape , standiometer , dressing tray with lid , baby weighing scale , scissors , rack table for keeing trays , fluids , foot steps , stool , screen seperator with stand , patient bed , pillow , pillow cover , side locker , bed sheets , blankets , examination table , mattress for examination taable , chairs for waiting area , dressing drum with lid , examination lamp , iv stand , suction machine electric foot oprated suction apparatus total quantity : 57...

Health Medical Education And Family Welfare Department - Jharkhand

35985969 bids are invited for boq s jharu , hand wash , towel , lab coat and apron , stand fan , garbage beg , blanket , phynyl , 3 ply mask , head cap , led bulb , table cloth big seize green colour , bleaching powder , hub cutter needle cutter , stethoscope , gloves 6.5 , detergent powder , pochha , detergent soap , gloves 7 no , cockroach hit spray , laxman rekha for ant others , gate lock, departments lock , chargable torch , tiolet cleaner , wiper , wall clock , pencil battery , sanitizer , bp instument , foot operated garbeg bin 20 liter , plastic chair , printer cartridge , opd register , opd slip , genral register , a4 seize paper , hmis monthaly formate print , fetal dopller , surf , phenyl , liquid hand wash , almirah , photo copy machine , office table , rack , stapler small seize , stapler big seize , punching machine , pin , stapler pin small seize , stapler pin big seize , ink pad , ball pen , pencil , paper weight , ceiling fan , desktop , laptop , projector , big hub cutter , shoe rack , garbeg bin , stablizer 5 kva , ups total quantity : 9263...

Health Medical Education And Family Welfare Department - Jharkhand

35779760 bids are invited for palliative ward fowler bed with set , bed side locker , autoclave medium , medicine trolley , instrument trolley , crash trolley , movable focus light , x ray view box , instrument sterilizer , ecg machine , wheel chair , patient trolley , iv stand , bp instrument digital , stethoscope , suction machine , nebulizer , nedulizer mask , monitor trolley , multi channel monitor , staff chair , wall hanging panels partition with curtain , attendent stool , attendent waiting chair 3 seater , adjustable walker , almirah , doctor table big , doctor chair , coloured bed sheet , patient dress , door curtain , window curtain , ambu bag adult , weighing machine , plain wall watch , bed pan , urinal pan , bmw trolley foot operated , 3 bucket system , branding total quantity : 943...

Employees State Insurance Corporation - Jharkhand

35720949 bids are invited for minor surgical instruments mse stretcher mattress , pediatric stethoscope , knee hammer , stadiometer , electronic weighing machine a , measuring tape , b p apparatus hg , pediatric cuffs w l 4cm 8 cm , pediatric cuffs w l 6cm 12 cm , pediatric cuffs w l 9cm 18cm , pediatric cuffs w l 10cm 24cm , electronic weighing machine pediatric or new born baby , bp instruments digital with adapter , pots for sitz bath big size , glucometer sd total quantity : 117...