South Eastern Railways - Jharkhand

39871653 supply of double scissor hydraulic lifting table for lifting and removing of the 3 phase loco filters as per els / rpm drg. no. m / els / rpm / sk 116. [ warranty period: 30 months after the date of delivery ] ...

State Livelihood Promotion Society - Jharkhand

39667657 supply of office stationary items 2 copy long size (11.7 x 8.3) with 160 pages good quality 3 copy long size (11.7 x 8.3) with 100 pages good quality 4 copy long size (11.7x8.3) with 50 pages good quality 5 ball pen (black/blue) 6 ball pen (blue) use in through 7 cellotape good quality 8 chart paper different colour good quality 9 fevi stick (75 gm) 10 fevicol 100gm good quality 11 gum bottle 12 highlighter pen good quality 13 paper clip good quality 14 pencil dark black (hb) good quality 15 pencil eraser good quality 16 pencil sharpener good quality 17 permanent marker pen (black/blue) good quality 18 a4 paper (70 gsm) 01 rim of 500 pages good quality 19 a4 paper (75 gsm) 01 rim of 500 pages good quality 20 plastic folder good quality 21 register long (38x25 cm)with 72 pages good quality 22 register long (38x25 cm)with 120 pages good quality 23 register with 200 pages (38x25cm) good quality 24 register with 240 pages (38x25cm) good quality 25 scale 30cm glass good quality 26 stapler (big) 27 stapler pin (big 24/6) 28 stapler (10 no.) 29 stapler pin (no 10) 30 white board marker pen good quality 31 writing pad (25 cm x 18.5 cm with 50 pages) good quality 32 writing pad (25 cm x 18.5 cm with 100 pages) good quality 33 calculator 12 digit good quality 34 special cloth cobra file (index) 35 plastic arch file (index) good quality 36 arch file (index) good quality 37 spring file good quality 38 double punching (big) good quality 39 double punching (smal) good quality 40 single punch good quality 41 liquid eraser pen good quality 42 paper cutter knife with blade good quality 43 stamp pad ink(blue/black/violet) good quality 44 tag (long+small) good quality 45 paper weight good quality 46 notic board pin good quality 47 sketch pen (pkt. of 12 pcs.) good quality 48 note sheet (green sheet a4 size) 70 gsm, 50 pages good quality 49 paper flag good quality 50 chesal marker good quality 51 double guming tap 52 stamp pad (small) good quality 53 stamp pad (big) good quality 54 cd marker pen good quality 55 cash book register fullscape size, double column, no 03 good quality 56 envelop (10x8) inch good quality 57 scissor small good quality 58 scissor big good quality 59 brown tape 2 inch with 65 meter length 60 plastic stick file good quality 61 tag file/leafe file good quality 62 note ped normal rulling good quality 63 note ped spiral rulling good quality 64 safty pin good quality 65 paper pin good quality 66 white board clip big good quality 67 white board clip small good quality 68 envelop a4 size good quality 69 fixed assets register standard good quality 70 stock register standard good quality 71 attendance register normal 72 attendance register standard good quality (time of arival & time of departure) 73 pokar good quality ...

State Livelihood Promotion Society - Jharkhand

39581503 tender for supply of ajeevika pashu sakhi kit ( aps kit ) 1 package i 2 small castrator ( burdizo ) 3 thermometer 4 surgical scissor 5 surgical forceps ( tissue forceps ) 6 vaccine box 7 vaccine carrier 8 package ii 9 anti diarrhoea powder ( 100 gm ) 10 anti cough powder ( 100 gm ) 11 growth promoter ( 250 ml ) 12 liver tonic ( 500 ml ) 13 antiseptic cream ( 100 gm ) 14 potassium permegnate 15 parasitic tablet ( 150 mg ) 16 parasitic liquid ( 100 ml ) 17 digestive powder ( 15 gm ) 18 package iii 19 electronic weigh balance, hanging type ( 50kg ) ...

Ministry Of Statistics And Programme Implementation - Jharkhand

39574762 bids are invited for lab items secchi disk , head lamp , insect forceps , insect scissors , zip lock , permanent market , hand sanitizer , phenol , magnifying glass , electric led lamp , extension cord , butter paper envelope , pencil , plastic exam board , plastic sheet , plastic box , rain coat , mud boot , first aid kit , aerial insect net , insect pin , insect pinning board , insect stretching board , latex gloves , tissue paper , needle , blade , fevi gum , cello tape , note book , droppers , ph meter total quantity : 286...

Department Of Information Technology - Jharkhand

39555980 bids are invited for boq medicine iv metronidazole 100ml , iv mannitol 20 100ml , hand wash 5 ltr , inj ranitidine , inj tranexamic acid , inj vitamin k1 , inj amikacin 100mg , inj pan 40mg , tab dicyclomine pcm , cap amoxycilline 500mg , cap amoxycilline 250mg , tab ranitidine 150mg , cap omeprazole 20mg , drum m size 9by11 inch , allis forcep 6 , artery forcep 6 , sponge holder 10 , needle holder 6 , tooth forcep 6 , bp handle no 4 , corved mayo scissor , gloves 6 5 no , gloves 7 0 no , leucopore 3 , leucopore 1 , cord clamp , gauze than , syringe 2ml , syringe 3ml , syringe 5ml , syringe 10ml , bt set , iv set , mucus ebytractor , folley s catheter 14 no , folley s catheter 16 no , betadine 500ml , trusillk 1 no , bp blade 24 no total quantity : 47748...

Health Department - Jharkhand

39485354 supply for office stationery, equipments etc. , items names : , executive chair , revolving chair , study chair , office table , almirah ( for office use ) , glass almirah , journal rack , computer table , dinning table set ( 1 table + 6 chairs ) , dinning table , lab table , examination table , stool steel chair , bed side locker , single bed ( for hostel ) ( double decker ) , almirah , chair , table , needleholder : , 6 , 7 , 8 , suture cuttingscissors , sutureneedle : , straight , curved , mackintosh roll : , full bed length ( qtyin meters ) , draw mackintosh , extra for treatment and dressing , hot water bag , ice caps , ice collar , corrugated rubber sheet , gloves different sizes , catheters : , urinary catheters , foleys catheters , nasal catheters , plain catheters , rectal catheters , finger stalls different sizes ( set ) , air rings , mucus sucker , breast pump , nipple shield , gastric lavage tube , ryles tube , flatus tube , blakemore sange staken tube , rubber tubes with different diameter and size , rectale syringe with nozzle , ring pressories each size , douche nozzle different sizes , mortar and pestle , nelsons inhaler , spirit lamp , test tube stand , test tube holder ( in dozen ) , sterilizer small , portable autoclave , weighing scales , adult weighing scale , baby weighing scale , back rest , splints different sizes , i. v .stand , microscopes , sphygmomanometer ( mercury ) , a regular ( dial ) , b electronic ( digital ) , stethoscope , over bed table ( cardiac table ) , screens / bed side curtains , three way adapter , mattress: , adult , child , mattress cover: , adult , child , bed sheets , baby cot sheets , draw sheets , sandbags with covers , sponge cloth , hot water bag covers , ice cap covers , air ring / cushion covers , gowns masks , patient s clothes: , male ( set ) , female ( set ) , baby dresses of different sizes ( set ) , diapers different sizes ( set ) , trolley cover , dirty linen bag / box , leggings ( pair ) , perineal sheets , triangular bandages , many tailed bandages , eye shields , dusters , slings , t binder , screen curtains ( set ) , adult human articulated skekelton with hanging facility in a glass cupboard with locking facility. , full set of dis articulated human skeleton. , full size human body showing all muscles and articals , human torso : , male , female , skin cross section , heart and large blood vessels , heart with detachable parts on a stand , eye with different sections , ear with different sections , human brain with spinal cord , lungs and trachea , larynx , digestive system: , stomach , female reproductive system: , uterus on stand , male reproductive system , urinary system: , kidney: , joints and ligaments: , wrist , elbow , shoulder , ankle , knee , hip , teeth , skeleton system , muscular system: , showing different muscles of the body , joints and ligaments: , nervous system: , brain , cardio vascular system , respiratory system , lungs , trachea , larynx , digestive system , oral cavity , teeth , stomach pancreas and spleen , small intestine , large intestine , liver and gallbladder , kidney macroscopic structure , skin , eye , ear , female reproductive system , menstrual cycle , male reproductive system , endocrine glands , first aid for burns , cardiac pulmonary resuscitation: , adult , children , infant , first aid charts or emergencies such as fracture, drowning, wounds, poisoning, bites ( each ) , stages of development of embryo ( set ) , female bony pelvis , foetal skull , female dummy ( zoe model ) / obstetrical training with doll , placenta , full size fetus , new born baby , baby cradle , breast changes in pregnancy , uterine changes in pregnancy showing height of uterus at different terms of pregnancy , stages of labour , first stage , second stage , third stage , breech presentation , complete breech , incomplete breech , foot presentation , shoulder presentation , face presentation , brow presentation , twin pregnancy , placenta previa different stages , caput succedaneum, cephalhaematoma , congenital malformation of new born: , cleft lip palate , spina bifida , hydrocephalus , anencephalus , all in one computer set , laptop , xerox machine , color printer , air conditioner , lcd projecter , lcd screen , over head projecter , community health nursing for anm , community health nursing for anm ( hindi ) , health worker keliyepathyapustak , community health nursing ( samudayikswasthvigyan ) ( hindi ) , nursing manual of nutrition and therapeutic diet , essentials community health nursing in hindi , where there is no doctor a village health care handbook , where there is no doctor hindi , mecical surgical nursing , fundamentals of nursing , principal & practice of nursing , health promotion for anm , aaharavumposhan , text book of anatomy & physiology for nurses , anatomy & physiology anotomy and physiology for nurses ( sharirrachanavigyanevamsharirkriyavigyankewalnursonke live ) ( hindi ) , prathamiksahayataevamsankatkalindekhbbal ( hindi ) first aid and emergency care , manual of first aid ( prathamikupcharka manual ) ( hindi ) , health promotion , nurse keliyemanovigyanavumswasthya , psychiatric meantal health nursing , text book of microbiology for nurses , sukhamjivvigyankipathyapustak ( text book for microbiology for nurses ) ( hindi ) , primary health care nursing for anm , psychology and sociology for anm and bt students , nursing arts proceduces ( nursing kemoolsidhanth ) valume i ( hindi ) , fundamentals of nursing ( hindi ) , senior nursing procedure ( nursing kemoolsidhant volume ii ( hindi ) , sociology for nurses , pharmacology for nurses , medicine kipathyapustak , baal swasthya nursing for anm , child health nursing for anm ( hindi ) , quick look nursing pathophysiology , comprehensive manual of pediatric nursing procedures , pediatric nursing , english for nursing , textbook of computer in nursing , textbook of obstetrics , midwifery & gynecological nursing ( hindi ) , maternal & neonatal nursing care plans , midwifery for anm , midwifery and gynecological , nursing ( hindi ) , manual of midwifery procedures , pedicatric nursing care plans , cumulative record for general nursing midwifery course , health centre management , imnci module for basic health worker , chart booklet , simplified partograth ( big size ) , family planning , journal of midwifery, women health &gynaecological nursing. , journal of community & social health nursing , patient cots adult , child , bed side locker , revolving stools / chair , manikins for demonstrating nursing procedure: , adult male imported , adult female , child manikin , new born , cpr ( full body ) , trays different sizes: , 24x16 , 14x10 , 11x9 , 8x5 , trays with cover assorted sizes , bowls: , 16diameter , 10diameter , 4diameter , 2 3diameter , bowls with cover , 6diameter , 4diameter , enema can , 1 1t. capacity , 1 / 2 1t. capacity , kidney trays of assorted sizes ( big ) , measuring jugs , 1000 ml. , 500 ml. , 250 ml. , assorted size basins , catheter dish with cover , knife dish with cover , feeding cups , douche can , sputum mugs , bed pans , urinals male , funnel: , 4diameter , 2diameter , jars with covers: , 12x8 , 6x4 , dressing drums: , 8x4 , 12x9 , tub for sitz bath , saucepan with lid: , 1 1t. capacity , 2 1t. capacity , kettle: , 1 1t. capacity , 2 1t. capacity , trolleys with upper and lower shelves ( without steel top ) , pint measure , gallipots , mugs , bottle brush , cheatle forceps , sponge holding forceps , artery clamps: , straight 6 , curved6 , dissecting forceps: , toothed , non toothed , mosquito forceps , kocher’s , scissors: , surgical 8 , bandage , mayos cutting scissors , tissue forceps , sinus forceps , biopsy forceps , liver biopsy needle , alice forceps , probe , groove director with probe , mouth gag , tongue depressor , tongue holding forceps , nasal speculum , aural speculum , re tractors: , single hook , double hook , bladder sound , male urethral dilator ( set ) , packing forceps: , nasal , oral , ear irrigation syringe , ear speculum , shaving set , safety razor with blades , bard parker knife handle , surgical blades different sizes set ) , catheters , airway , laryngoscope: , paediatric , adult , proctoscope , infusion set , autoscope , ophthalmoscope , tracheostomy set with various size of tracheal tubes ( set ) , head mirror , tanning fork , oxygen cylinder with stand , oxygen mask , measuring cups: , 240ml. , 120 ml. , 30 ml. , undine , eyebath cup , pipettes & droppers , glass connection: different types e.g. y.t.l. ( each ) , wolfs bottle , conical flasks , ounce glass , dram glass , thermometers : , oral , rectal , bath , room , lotion , pulse meter , urinometer , lactometer , heamoglobinometer , specimen glasses , test tubes ( dozen ) , glass slides with cover ( box ) , bottels500 ml. capacity for lotion and mixtures , automizer , manometer , glucometer , head mirror , tuberculin syringe , insulin syringe with needle , needle all sizes ( one dozen each ) , lumbar puncture needle , trochar, cannula for abdominal paracentesis , i.v. cannula different type sand sizes , biopsy needle : , adult , children...

Health Department - Jharkhand

39468446 supply for materials supply for materials and medical equipments , equipments name: , hospital seat bed , semi flower bed with ms side rail , flower bed with ms side rail , hospital i.c.u bed , hospital bed matress , hospital pellow , hospital sline stend , hospital bed side locker , hospital 3 fold screen , hospital strecture on trolly , pediatric bed , pediatric flower bed , ecg machine computerized , ventilators ( adult ) , pulse oxymeter , a.c1.5 ton 5 star with fitting , a.c 2ton 5 star with fitting , stabilizer automatic for ac double phase 5 kva , stabilizer automatic for ac double phase 3 kva , b.p apparatus stand model (isi mark) , stehoscope (isi mark ) , thermometer ( isi mark) , ecg paper roll cardiart gen x 3 cardiart 6208 view , suction machine , foetal doppler ( pocket doppler ) , foetal doppler ( tabple top ) , r o water machine , autocalve double drum , kidney tray big , curve kocher clamp , iv set ( adult ) , uro bag , sanitary pads , focus light , plastic apron , shoe cover , disposable cap , rubber sheet , eb x49 xga projector brightness: 3600lm with hdmi port (optional wi fi) , dustbin with lid 30 ltr. , hub cutters ( mannual ) , hub cutters ( electric ) , water container ( steel 20 ltr) , stools for immunization room (steel ) , torch light 4 cell , air rotor , bed pan (ss) , coolers big (isi mark) , table cloth , double door 308 litres 5 star refrigerator , 205 l direct cool single door 5 star refrigerator , chromic catgut 1/0no , chromic catgut 2/0no , chromic catgut 3/0 no , shadoless cellar light led , mersilk 1/0 no , mersilk 2/0 no , surgical instrument set , foelys cather 14 no , foelys cather 8 no , foelys cather 10 no , foelys cather 16 no , foelys cather 18 no , disposable syringe 3 ml , disposable syringe 10ml , disposable syringe 5 ml , disposable syringe 20 ml , b.p blade ( 15 no. ) , b.p blade ( 20 no. ) , b.p blade ( 22 no. ) , spinal needle 25 no , skin hook single , skin hook double , foreign body remover , foreign body extractor , needle holder ( big) 9’’ , needle holder ( small ) 6’’ , tooth forceps , plainforceps , scissors mayo’s ( 7’’ & 9’’) , scissors ( suture cutting ( 7’’ & 9’’) ) , b.p handle no 3 , b.p handle no 4 , surgical spirit 500 ml , scissors 8’’ , pen elkos first , handi palast ( round ) , lifter , intrument sterliser ( electric ) small , intrument sterliser ( electric ) medium , intrument sterliser ( electric ) large , arteriforcep medium straight , arteriforcep medium curve , arteriforcep large , elices forceps , niddle holder 8’’ , abdominal retracter small , abdominal retracter medium , abdominal retracter large , doins retracter , bone lever small , bone lever large , bone holdinyforcep small , bone holder forcep large , periostium elevator , pop 50 kg drum , towel clip , k wire1 , k wire1.5 , k wire2 , ss – wire 20 , ss – wire 22 , ss – wire 24 , k – nail all size , v – nail , sq – nail , cotton roll 400gm nett. , cotton roll 100gm nett. , kit kath 16 no , kit kath 18 no , kit kath 20 no , kit kath 22 no , kit kath 24 no , bandage 6 inch , bandage 4 inch , gauze than , green cloth , cotton bed sheet , blanket ( 4x 6 )2.5 kg , blanket ( 4x 6 )3 kg , carpet ( dari )( 30/ 30) , bp instrument electronic chargeable , glucose meter (isi mark) , hemoglobin test machine , stethoscope (isi mark) , thermometer genral , x ray view box large size , pulse oximeter , blood bag ( singal ) hl , hiv rapid card aspen , hbsag papid card aspen , hcv rapid card aspen , para hit total (mp) , r.p.r test card aspen , r.p.r test strip aspen , blood group kit (abd) arkary , anti ab arkray , anti human globulin arkray , 22% bovine albumin arkray , hiv elisa kit , hbsag elisa kit , hcvelisa kit , hiv rapid card retroquik , hbsag rapid card hepaview , hcv rapid flaviscreen , refrigerator digital thermometer , blood bag collection monitor , glass slide blue star , distilled wateer , sodium hypochlorite solution. , khan/khans test tube borosil , copper sulphate crystal , lancetblood , dobule cap e.d.t.a tube , khan/khans test tube stand 60 hole plastic , colorimeter , digital weight machine baby , digital adult weight machine , b.p machine ( mercury ) , elisa processor transasia elan 30 s , pumping ball/smiley ball , electric insects killer , elisa reader , elisa washer , autoclave electric vertical( pressur & temp display) , blood bag tube sealer , drabkins reagent , measuring cylinder 50ml , hydrometer ( specific gravity ) , pippet stand , cuvette ( for colorimeter) , needle destroyer ( electric ) , blood bag storage refrigerator , blood bag storage refrigerator thermofisher 650 ltr. , hydrogen peroxide 500 ml , hydrogen peroxide 100 ml , ec( 500 ml ) , stirrup pump ( ddt spray machine ) , cotton roll 25 gm nett. , cotton rol l 50 gm nett. , cotton roll 200 gm nett. , cotton roll 400 gm nett. , crepe bandage 6’’ , crepe bandage 4’’ , office table t9with two drawer , examination table , office table t104( three drawer ) , office table t8both side drawer , patient stool revolvingtable , impres table 1800mm , premium visitor chair with full arm , chair ch7b , laseda high back chair , sedna high back chair , bandage 6 , bandage 4 , revolving chair with arm , barvo high back chair , computer table c3d , strowel plain (almira 20 gauge )7’’/3.5’’ , strowel plain (almira 20 gauge )4’’/3.5’’ , steel rack 6’’/3’’ ( 5 rack ) , mattrics 3 seeter chair with arm , mosquito net small , mosquito net medium , mosquito net large , xerox machine (mp 2014) , didital ups eb 1650 ah inverter with inva tubular battery 220 ah , computer i3/11 gen/ 8 gb ram / 512 gb ssd rom/ windows 11/20” display/web came , • printers • laser printer • m438nda laserjet a3 monochrome all in one printer with network, duplex & adf , scannerlide 120 , coolers big ( isi mark ) , pillows covers , pillows , wire cutter , digital x ray machine 100ma , pen drive 32gb(hp) , pen drive 16gb(hp) , floor duster with handle , plastic chiar , epson ecotank m3170 wi fi all in one monochrome ink tank printer ith adf & duplex , computer table , office table size 4ft x 2.5ft double drawers , office table size 3ft x 2ft single drawers , laptop core i5 12th gen. 8gb ram, 1tb/ssd hard disk/ 2gb graphics, windos 11 , 3.8% sodium citrate solution 500 ml , abo & rh(anti ab&d) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent gauze than 18 m x 90 cm special , adenosine , airway 0 no. , airway 1 no. , airway 2 no. , airway 3 no. , airway 4 no. , ambu bag adult , ambu bag pediatric , ambu bag neonatal , apron , aso latex (span) (20 pcs) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , baby cap , baby dress , baby socks , baby tag , barium chlorine 500 ml , bendicts solution 500 ml , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blood bag350 ml , blood bag 100 ml , botroclot 10ml , bovine albumin 22% (5 ml) , bt set , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 24 no , cannula 26 no , capillary tube , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , cleansole , color coded bins black 20 litre , color coded bins black 40 litre , color coded bins black 60 litre , color coded bins black 80 litre , color coded bins blue 20 litre , color coded bins blue 40 litre , color coded bins blue 60 litre , color coded bins blue 80 litre , color coded bins red 20 litre , color coded bins red 40 litre , color coded bins red 60 litre , color coded bins red 80 litre , color coded bins yellow 20 litre , color coded bins yellow 40 litre , color coded bins yellow 60 litre , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , lam/i gel 01234 , lancet (100 pcs) , leishmans stain (500 ml) , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malaria pf/pv antibody card rapid test (50 kits) , malaria pf/pv antigen card rapid test (30 kits) , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , memantine , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micropore 1 inch , micropore 1/2 , micropore 2 , mucus sucker , iron bed , mattress 3x6 , foot step , dustbin plan , hydraulic bed , bucket , bed side screen , test tube (khan tube) , test tube (khan tube) 2.5 3 ml , test tube (khan tube) 3 4ml , test tube holding clamp , test tube rack , thiopentone , thrombophob ointment , tissue paper roll , tourniquet , color coded bins yellow 80 litre , cord clamp , cotton roll 400gm nett , cotton thread , cover glass (100 pcs) , cpr (latex) (20 pcs) , creatinine(creast) (35 pcs) , crescent blade disposable , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1ltr , distilled water 5ltr , donepezil , duolin respules , ec (700 ml) (agrawal) , ecg jelly , edta vial , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , enoxaparin , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , g.v. paint lotion 400ml , glacial acetic acid (500 ml) , glass slide (100 pcs) , gloass rod , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer strip , glucometer (ozocheck) , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hbsag card rapid test kit (50 pcs) , hcv rapid (30 kits) , heavy duty gloves , hiv card rapid test (50 kits) , nasal prongs (neonats) (cannula) , needle straight , new born diaper , oxygen mask adult , oxygen mask child , paraffin mesh , pedia set , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial , pottasium permagnate (400gm) , povidone iodine lotion 500ml , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pyrethrum extract 2% , rhyles tube16 no. , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , saline set , shoe cover disposable , side port disposable , slide dying rack , sodium calcium hypochloride (5 litre) , spirit 100 ml , spirit 1000 ml , spirit (methylated) 1000ml , sprit lamp , stritching thread , suction catheter , suction tube6fr , suction tube 8 fr , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , uro bag , vdrl (strip) , vdrl (syphilis) card rapid test (100pcs) , vdrl rapid card , vdrl rapid latex , vicryl(1 0) , vicryl1no , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl (2 0) , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , yellow tips for micropipette , temophos 25 ltr , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , swab , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , towel (24x18) , plastic mug 1 ltr , plastic bucket 20 ltr , anteseptic soap 75 gm , plastic sputum container with sticker , lence paper , potasium per magnate , zipper pouch , falcun tube , oxygen regulator with flow meter , non chlorinated biohazard bags black size 80kg , non chlorinated biohazard bags blue size 80kg , non chlorinated biohazard bags red size 80kg , non chlorinated biohazard bags yellow size 80kg , non chlorinated biohazard bags black size 2litre , non chlorinated biohazard bags red size 2litre , non chlorinated biohazard bags black size 40kg , non chlorinated biohazard bags blue size 40kg , non chlorinated biohazard bags red size 40kg , non chlorinated biohazard bags yellow size 40kg , hemogllobin test kit , hemogllobin test strips , lancet , glucometer , glucometer strips rate per pc , urine strips , hiv and syphilis test kit , hiv test kit , syphilis test kit , sickle cell rapid test kit , iodine test kit , hbsag test kit , filariasis test kit , malaria test kit , sanitary pad , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , oxygen cylinder small , oxygen cylinder medium , oxygen cylinder large , tubular battery 220 ah , ambu bag , eletric automatic unicron demmart star dental chair , dental x ray machine , vatech rvg sensor , desktop & color printer , dentail air compresor , auto clave , ultrasonic scalerhand pic walldent , waldent digital glass bed sterlizer , gdc extraction forcep kit set of 12 , gdc root elevator set kit10 , local anesthesia with aderenaline , dental micro moter with straight contra hand pic , walldent pro dental set 15 , mask , waldent dental lead appron , dental patient drape , gdc surgical curettee 3 (186) , air rotor handpic 2 lead (nsk) dyna , type 1 glass ionomer restorative , type 2 glass iconomer restrative , waldent composite kit , ewaldent eco plus light curring unity 2 , waldent endomeeter hand pic esw 2 , super endogald hand portopear file ( pack og of ) , waldeent flexgald rotry file 21 mm 25 mm , waldeent h hand file gald rotry 21 mm 25 mm , waldent e dta gutta percha paint 6% , waldent seal pexrin baid roat camal sealing matrial , raund barrel , stat barrel , farama cresal , calsium hydroxide podear 10 , saliva ejector , un chamber with 12 tray , gownpreparatior kit , endo2 bur , flish box , dj 16 , k hhand file , k file 6 to 15 , k file 8 to 15 , micro tourch & gas , skin mirar , mouth mirror , dental probe , dental twerer , dental cement carrier , steel visitor chair , transmittance / absorbance photometry based digital haemoglobinometer with auto / self calibration (no manual code / chip insertion) and 0 25gm/dl , strips / cuvette compatible with above digital haemoglobinometer , fad gdh enzyme based glucometer strips (1 glucometer free on 1,000 strips) , boronate affinity chromatography method based hba1c glycated haemoglobin analyzer with inbuilt bluetooth for wireless data transfer, in built rechargeable battery and weight less than 100g , strips compatible with above hba1c glycated haemoglobin analyzer , reflectance photometry based lipid analyzer for measuring tc, hdl, tg, ldl & tc / hdl ratio and inbuilt bluetooth for wireless data transfer , strips compatible with above lipid analyzer , auto disable / safety lancet (28g) with ec declaration of conformity / usfda & iso 13485:2016 , nt probnp rapid card , vitamin d rapid card , troponin i rapid card , troponin t rapid card , point of care device for hemoglobinopathies (sickle cell &? thalassemia) testing , point of care rapid test kit for sickle cell anaemia and beta thalassemia screening compatible with above device , portable automated abrneonatal hearing screeningdevice : based onbrainstem evoked response audiometry (bera) method batteryoperated device high sensitivity and specificity (more than 97%) test time: less than 5 minutes usb port and wi fi enabled non invasive and easy to use easy interpretable report: pass, refer and redo as the result validated and recommended by icmr (indian council of medical research) & department of health research (dhr) ministry of health,government of india...

Health Department - Jharkhand

39447878 purchase of items for hwcs purchase items for hwcs , functional refrigerator 195 ltr. , boiler or autoclave small size , dressing drum with lid , mattress , kellys pads , torch / torch box type pre focused ( 4 cell ) , examination lamp , wall clock with all hands , iv stand , sunction machine electric / foot operated suction apparatus , oxygen cylinder with troly , oxygen set ( mask with tubing ) , bp apparatus , adult stethoscope , fetoscope / doppler , basin 825 ml ss , hub cutter , needle destroyer , digital thermometer , gauze cutting scissor stratight , weighing machine ( infant ) , weighing machine ( adult ) , thermometer rectal , dental probe , nebulizer , measuring tape , tallquist hb scale , snellen vision chart , near vision chart , stadiometer ( height measurement ) , sims retractor / depressor , kellys heamostat forceps straight 140 mms , vulsellum uterine forceps curved 25.5 cm , cusco’s / graves speculum vaginal bi valve small, , cusco’s / graves speculum vaginal bi valve medium , cusco’s / graves speculum vaginal bi valve large , plain forceps , tongue depressor , mouth gag , dental probe , mouth mirror , cheatle forceps , dressing tray with lid , suturing tray with lid ss small , suring needle curved , suturing thread , round slit ( hole ) towel , ambu bag , mask neonatal size ( 0 ) , mask neonatal size ( 1 ) , baby weighing scale , new born thermometer , oxygen hood ( neonatal ) , designated new born tray ss with lid , ss tray with cover , scissors , artery forceps , sims speculum veginal double ended iss mediam , cord cutting scissor / surgical blade for cutting cord , bowl for antiseptic solution , kidney tray ( small ) , kidney tray ( big ) , episiotomy scissor , allis forceps , toothed forceps , thumb non toothed forceps , needle holder , suture needle straight 10 , suture needle curved , cuscoss / graves speculum vaginal ( large ) , cuscoss / graves speculum vaginal ( medium ) , cuscoss / graves speculum vaginal ( small ) , sponge holding forceps / cheatle forceps , ppiucd insertion forceps , uterine sound ( for iucd ) , airway , labour table , rack / table for keeping trays, fluids , delivery troly , foot step , stool , screen seperator with stand , almira , rack for keeping sleepers / shoe covers outside labour room , cot , pillow , pillow cover , side locker , bed sheets , blankets , office table , chair , examination table , mattress for examination table , bucket big , bucket small , mugs , chairs for waiting area ( three in one set ) , led tv for iec , white wrighting board , syringes ( 20 cc , syringes 10cc , syringes 5cc , syringes 2cc , ad syringes ( 0.5ml , ad syringes ( 0.1 ml ) , disposable masks , sterile surgical gloves , gown / apron , shoe cover , caps , mucous extractor , disposable cord clamp , heavy duty gloves , foleys catheter , disposable sterile urethral catheter ( rubber plain 12 fr ) , disposable lancet ( pricking needles ) , routine immunization monitoring chart , blank immunization cards / joint mch card ( one per pregnant mother ) and tally sheets ( one per immunization session ) , interdental cleaning aids , chlorine tablets , sanitary napkins , 200 watt bulb ( 2 ) , salt – iodine test kit , wooden spatula , dry cell / battery , partograph in case sheets , iv cannula 16 , iv cannula18 , iv cannula 20 , iv cannula 22 , iv set , sanitary napkins , mackintosh sheet 5 meter , disposable delivery kit for delivering hiv patients ( emergency ) , disposable delivery kit for normal delivery , 5 l plastic tub for keeping chlorine solution , bucket for keeping 1% chlorine solution ( for spillage ) , colour coded bins yellow , colour coded bins red , colour coded bins black , colour coded bins blue , colour coded plastic bags ( yellow, red, blue and black ) , insecticide treated nets , mopping stick , micropore tape , urine bags , sheets for drying and wrapping baby , feeding tube , cleaning material and detergents , insectiside treated net , window screens , chlorine tablets , inter dental cleaning aid , 200 watt bulb , online ups 1 kva with 60 minute backup , fire extinguisher , hand towels , soap , towel , gauze piece ( roll ) , cotton swab ( roll ) , tuning fork , ice pack box , vaccine carrier , floor mopping stick , dari with room size. , mats for yoga , curtains , micropore tapes* , urine bags* , slide drying rack , specimen collection bottle , spirit lamp , test tube holding clamp , test tube rack , test tubes , wooden spatula , glass rods , glass slides , kit for testing residual chlorine in drinking water , rapid pregnancy testing kit , rapid test kit for dengue , rapid test kit for malaria , n / 10 hydrochloric acid , reagents such as hydrochloric acid, acetic acid, benedict’s solution, bleaching powder, hypochlorite solution, methylated spirit etc. , acetic acid solution , micropippette , yellow tips for micropipette , dipsticks for urine test for protein and sugar ( 1 container of 25 strips ) , whole blood finger prick hiv rapid test and sti screening test each , h2s strips test bottles for water testing , salt iodine tesitng kit , talquish hb scale....

Indian Army - Jharkhand

39398027 bids are invited for title cardboard , binding cloth , large scissor , large knife , stiching needle total quantity : 26...

State Livelihood Promotion Society - Jharkhand

39341017 supply of office stationery , name of the items : (package i) , notebook bd with 096 pages 65 gsm (size 300mmx180mm) , notebook bd with 192 pages 70 gsm (size 300mmx180mm) , notebook bd with 288 pages 70 gsm (size 300mmx180mm) , copier xerox paper a4 size 75 gsm white (packet of 500 sheets) , copier xerox paper a4 size 75 gsm colour (packet of 500 sheets) , chart paper (56x71cms) 90 gsm different colour (144 sheet per ream) , ball pen (black/blue/red/green) with tip 0.6 mm , gel pen (black/blue/red/green) , ball pen (use n throw) , pencil dark black (hb) @10pcs/packet , pencil eraser (dust free) @20pcs/packet , sharpener @20pcs/packet , scale 30cms glass @10pcs/packet , plastic button file @12pcs/packet (good quality) , lever arch file (plastic coated) , fly leaf file with cloth patti inside good quality with official detail printed , cobra clip files hard cover , cover file (water proof, good quality) , cotton tag @50 pcs/lachhi (good quality) , stapler no. 10 , stapler pin no.10 1m (@20box/packet) , stapler big size kangaro hs 45p , stapler pin 24/6 1m (@20box/packet) , stapler hd 23s24 heavy duty , stapler ds 23s24 heavy duty , stapler pin hd 23s24 heavy duty , stapler pin ds 23s24 heavy duty , white board marker pen (blue/black/red/green) @10pcs/packet , cd ohp marker (blue/black/red/green) @10pcs/packet , sketch pen (12 different colours per packet) , chisel marker (@10pcs/packet) , highlighter pen (@10pcs/packet) , permanent marker bold (@10pcs/packet) , writing pad (25 cm x 15 cm) (30 sheet) , staff attendance register printed (24 pages) 75 gsm , stock book register (192 pages) (leather bound) , stock book register (240 pages) (leather bound) , stock book register (288 pages) (leather bound) , stock book register (480 pages) (leather bound) , cash book register (144 pages) , cash book register (192 pages) , fevicol mr 100 gm , fevicol mr 22.5 gm , glue stick (15 gm) , both side mounting tape (1”) , tape (transparent/brown2”) , calculator 12 digit , design board pin (plastic on top) , binder clip, tin steel 32 mm , binder clip, tin steel 51 mm , paper pin t shaped , envelope (white/brown) 10*4.5 inch , envelope laminated (white/brown) 10*4.5 inch , envelope (white/brown) 11*5 inch , envelope laminated (white/brown) 11*5 inch , envelope laminated (white/brown) a4 , envelope laminated (white/brown) fs size , stamp pad small , stamp pad big , ink for white board marker (blue/red) , ink for permanent marker (blue/red) , punching machine (single hole 4.5) , punching machine (single hole) hdp 2320 heavy duty , punching machine dp 280 , punching machine dp 280 , sutli gola , scissors (plastic handle) medium size , white board duster , white board 6*4 , white board 4*3 , white board stand , notice board 6*4 , notice board 4*3 , sticky note pad 1*3 (04 color/pad) , paper weight , computer stationery items (package ii) , antivirus three user with three year free upgradation , pen drive (32 gb capacity), 3.0 usb , hard disk drive, 1tb , cartridge npg 59 black , cartridge 12a black (for laserjet hp 1020) , cartridge 12a black (for laserjet hp 1020) , cartridge 88a black (for hp m128w) , cartridge 88a black (for hp m128w) , cartridge 110a black (for laser hp 108w) , cartridge 110a black (for laser hp 108w) , cartridge samsung xpress m2060 black , cartridge samsung xpress m2060 black , mouse with wire , mouse pad , keyboard with wire , hdmi cable c pin , extension cord size name: 2.5 x 13 , usb hub...

Rural Development - Jharkhand

39266505 tender for supply of aajeevika pasu sakhi kits 1 small castrator (burdizo) 26 2 thermometer 26 3 surgical scissor 26 4 surgical forceps (tissueforceps) 26 5 teeth cutter (teether) for pigs) 26 6 hoop cutter 26 7 vaccine box 26 8 saree for pashusakhi 26 9 bag for medicine 26 10 measuring tape – 5ft 26 11 identity card holder 26 12 cap 26 13 torch 26 14 electronic weigh balance, hanging type(50kg) 26 15 electronic weigh balance, non hanging type (4 5 kg) 26...

State Livelihood Promotion Society - Jharkhand

39222668 tender for supply of office stationary items 2 xerox paper 3 pencil dark black ( hb ) 4 pencil eraser ( dust free ) 5 pencil sharpner 6 scale 7 ball pen ( blue / black / red ) 8 gel pen ( blue / black ) 9 package ii 10 cobra file 11 fly leaf file with office name printed in four line 12 liver arch file 13 ring file 14 cello tape 15 cello tape 16 packaging tape 17 fevi stick 18 fevicol 19 gum 20 stapler 21 stapler 22 stapler pin 23 stapler pin 24 double punching machine 25 double punching machine 26 single puching machine 27 note sheet pad 28 tag for file 29 calculator 12 digit 30 lrs attendance register 31 white board 32 white board marker pen ( black / blue / green ) 33 white board duster 34 scissor plastic handle ( big. ) 35 letter dispatch ( issue ) register 36 letter receipt register 37 highlighter pen 38 notice board pin 39 binder clip 40 gems clip 41 pen use & throw 42 permanent marker 43 plastic folder 44 writing pad 45 writing pad 46 writing pad 47 liquid eraser pen 48 paper cutter knife 49 stamp pad 50 stick file 51 stock register 52 jetter pen 53 jute file folder 54 register long 55 register long 56 anti virus ( quick heal total security ) 57 copy long size with 100 page...

State Livelihood Promotion Society - Jharkhand

39176588 supply of office stationary items 2 copy long size ( 11.7 x 8.3 ) with 160 pages good quality 3 copy long size ( 11.7 x 8.3 ) with 100 pages good quality 4 copy long size ( 11.7x8.3 ) with 50 pages good quality 5 ball pen ( black / blue ) 6 ball pen ( blue ) use in through 7 cellotape good quality 8 chart paper different colour good quality 9 fevi stick ( 75 gm ) 10 fevicol 100gm good quality 11 gum bottle 12 highlighter pen good quality 13 paper clip good quality 14 pencil dark black ( hb ) good quality 15 pencil eraser good quality 16 pencil sharpener good quality 17 permanent marker pen ( black / blue ) good quality 18 a4 paper ( 70 gsm ) 01 rim of 500 pages good quality 19 a4 paper ( 75 gsm ) 01 rim of 500 pages good quality 20 plastic folder good quality 21 register long ( 38x25 cm ) with 72 pages good quality 22 register long ( 38x25 cm ) with 120 pages good quality 23 register with 200 pages ( 38x25cm ) good quality 24 register with 240 pages ( 38x25cm ) good quality 25 scale 30cm glass good quality 26 stapler ( big ) 27 stapler pin ( big 24 / 6 ) 28 stapler ( 10 no. ) 29 stapler pin ( no 10 ) 30 white board marker pen good quality 31 writing pad ( 25 cm x 18.5 cm with 50 pages ) good quality 32 writing pad ( 25 cm x 18.5 cm with 100 pages ) good quality 33 calculator 12 digit good quality 34 special cloth cobra file ( index ) 35 plastic arch file ( index ) good quality 36 arch file ( index ) good quality 37 spring file good quality 38 double punching ( big ) good quality 39 double punching ( smal ) good quality 40 single punch good quality 41 liquid eraser pen good quality 42 paper cutter knife with blade good quality 43 stamp pad ink ( blue / black / violet ) good quality 44 tag ( long+small ) good quality 45 paper weight good quality 46 notic board pin good quality 47 sketch pen ( pkt. of 12 pcs. ) good quality 48 note sheet ( green sheet a4 size ) 70 gsm, 50 pages good quality 49 paper flag good quality 50 chesal marker good quality 51 double guming tap 52 stamp pad ( small ) good quality 53 stamp pad ( big ) good quality 54 cd marker pen good quality 55 cash book register fullscape size, double column, no 03 good quality 56 envelop ( 10x8 ) inch good quality 57 scissor small good quality 58 scissor big good quality 59 brown tape 2 inch with 65 meter length 60 plastic stick file good quality 61 tag file / leafe file good quality 62 note ped normal rulling good quality 63 note ped spiral rulling good quality 64 safty pin good quality 65 paper pin good quality 66 white board clip big good quality 67 white board clip small good quality 68 envelop a4 size good quality 69 fixed assets register standard good quality 70 stock register standard good quality 71 attendance register normal 72 attendance register standard good quality ( time of arival & time of departure ) 73 pokar good quality...

East Central Railway - Jharkhand

39028276 supply of hydraulic scissor troley model no: ust 1 technical specifications: * capacity : 600 kg * top platform size : 1250 x 750 mm * max. height from ground : 1850 mm * closed height : 400 mm * travelling lift : 1450 mm * number of scissor arms : two * movement :fixed on uhm poly urethane wheel dia 200 mm 2 nos. caster wheels and 2 nos. fixed wheels fitted with sealed double ball bearing. * manual lifting : hydraulic hand pump. * base frame & top frame : c channels, angle & rectangular tube. *top platform : covered with 5mm thick ms sheet reinforced with web construction. *wheel diameter : 10 inch uhmw * hand pump : 2 speed 700 bar, unique make hand pump with suitable hose and end connection. * top platform : anti slippery cover with chequered plate. egronomic t. [ warranty period: 30 months after the date of delivery ] => limited...

Employees State Insurance Corporation - Jharkhand

39009678 bids are invited for staplers (v2) (q3) , stapler pin staples (v2) (q4) , stamp pads (q4) , ink for stamp pads as per is 393 (q4) , self adhesive flags (v2) (q4) , desktop calculator electronics (q4) , black lead pencils as per is 1375 (rev) (q4) , manual pencil sharpener (q3) , scales (steel scale) as per is 1481 (q4) , highlighter pen (q4) , scissors (q4) , paper adhesive, liquid gum and office paste type as per is 2257 (rev) (q3) , tags for files as per is 8499 (rev) (q4) , drawing pin (q4) , binding punch machine (q3) , paper weights (q4) , battery cell as per is 9128, is 8144 (q4) , paper clips as per is 5650 (q4) , diaries printed plain register (q4) , markers white board (q4) , sketch pen (fibre tip) as per is 10562 (q4) , glue stick (v2) (q4) , ball point pens as per is 3705 (q4) total quantity : 1425...

Urban Development And Housing Department - Jharkhand

38999094 bids are invited for chair for patient waiting area 3 seater , office chair movable , office chair , office table , steel almirah , steel rack , stool for attandent , refrigerator 180 ltr , weight adult 125kg , inverter with battery 220 mah , bio metric set , boul medium size , b p apparatus digital , b p apparatus manual , stethoscope , heamoblobin test kit , glucometer test with all accesary equipment , flash light tourch box type pre focuses , clinical thermometer oral , dressing drum with cover point945 liter s s , dressing drum , surgical scissors straight 140 mm total quantity : 39...

Urban Development Department - Jharkhand

38982841 rate contract for supply of basic equipments, furniture, and various items for one year doctor chair standard + normal chairs doctor table size 64 staff nurse table 4 3 staff nurse chair ( medium ) plastic chair patient steel stool ( revolving ) table ( mpw ) size 3*2 chair for mpw ( medium ) four step reck for medicine three seater chair for waiting area patient bed foot step examination table almirah stethoscope bp instrument weight machine child+adult h.b meter h.b meter strip digital thermometer kidney tray dressing tray needle holder vision chart oxygen cylinder with trolly torch pencil battery remote battery iv stand glucometer glucometer strip medicine tray opd register thermometer nebulizer foetal doppler needle cutter r.s. scissors dressing drum 9x9 dressing tray 10x12 vaginal speculum inside cath 18 intra cath 22 intra cath 24 iv set saline rl saline dns saline ns saline d5% pillow cover pillow bed sheet medicine rack ( 8*6 ) register 8 no. register 10 no. pen scale stapler whitener punch machine scissors file a4 size paper gum big size paper weight dustbin blue dustbin black dustbin red broom mops duster doormat lock and key attendance register stapler pin bucket mug fire extinguisher hand towel bed sheet curtain lock and key link bucket plastic mug hand wash floor mop by matt dustpan harpic large towel hand towel curtain small curtain big green sheet colin phenyl 5 ltr. dusting cloth detergent powder soap toilet cleaning brush full jhadu nariyal jhadu plastic jhadu basin dhone wala ( scrubber ) room freshener hand sanitizer table cloth wall clock dust bin scale big admission register carbon stock register highlight pen sketch pen xerox paper a4 size air conditioner fridge water purifier inverter battery 150a battery 200a battery 220a battery 250a tv 21...

Health Department - Jharkhand

38869880 rate contract for supply of laboratory consumables for 24 months , group 1 chemicals, drugs, and disinfectants , phenol crystals (carbolic acid) , sulphuric acid , sodium hypochlorite , methylene blue , potassium dichromate , basic fuchsin , immersion oil liquid paraffin (heavy grade) , sodium hydroxide , tri sodium citrate , disodium hydrogen phosphate , potassium dihydrogen phosphate (anhydrous) , n acetyl l cystein , potassium permanganate(kmno4) , formalin/ formaldehyde , magnesium sulphate , magnesium citrate (tribasic) , asparagine , malachite green , glycerol , para nitro benzoic acid , sodium chloride , middle brook 7h9 broth base , middle brook oadc enrichment media , brain heart infusion agar , silver nitrate , dimethyl sulfoxide , bovine serum albumin , sodium carbonate , oxalic acid , tween 80 , tween 20 , hydrogen peroxide , niacin strips , auramine o , zinc dust , hydrochloric acid , immunochromatographic test (rapid identificationtest) for mtb , group 2 drugs for dst , rifampicin , isoniazid , ethambutol di hydrochloride , dihydro streptomycin sulphate , ofloxacin , ethioniamide , kanamycin sulfate , amikacin disulphate , capreomycin sulfate , levofloxacin , moxifloxacin , para amino salycylic acid (pas) , linezolid , clofazamine , group 3 personal protective equipment (ppe) , latex gloves (size small) , latex gloves (size medium) , latex gloves (size large) , nitrile gloves (size small) , nitrile gloves (size medium) , nitrile gloves (size large) , laboratory coats (size small) , laboratory coats (size medium) , laboratory coats (size large) , respirators (n95 mask) , surgical gowns (size small) , surgical gowns (size medium) , surgical gowns (size large) , head cover , shoe cover , group 4a pipettes tips for phenotypic use , 1 200 ?l pipette tips , 20 200 ?l pipette tips , 100 1000 ?l pipette tips , 100 1000 ?l pipette tips (long tip) , pasteur pipettes (sterile individually packed) , group 4b pipette tips for molecular lab use , 1 10 ?l pipette tips , 1 20 ?l pipette tips , 1 200 ?l pipette tips , 20 200 ?l pipette tips , 10 100 ?l pipette tips , 100 1000 ?l pipette tips , pasteur pipettes , group 5 glasswares , culture tubes or universal glass bottles (mccartney bottles) , slides , glass ware round flat bottom flask 1 lit , glass ware for stain preparation measuring cylinder graduated 100 ml , measuring cylinder graduated 500 ml , measuring cylinder graduated 1000 ml , glass stoppered bottles 250 ml , container for stain 250 ml polyethylene , flat bottom flask 3 lit , flat bottom flask 1 lit , pipette glass graduated 1ml , pipette glass graduated 2ml , pipette glass graduated 5ml , pipette glass graduated 10ml , glass beaker 500ml , glass beaker 250ml , bijou bottles , glass beads (3 mm) , glass beads (5 mm) , beaker 250 ml , beaker 100 ml , beaker 500 ml , beaker 1000 ml , glass test tubes , funnels 5 cm diameter , funnels 10cm diameter , funnels 18cm diameter , volumetric flask 50 ml , volumetric flask 100 ml , volumetric flask 1000 ml , 1 lit bottle amber colour , 2 lit bottle amber colour , 1 lit reagent bottle transparent , 2 lit reagent bottle transparent , 500 ml reagent bottle transparent , 250 ml. reagent bottle transparent , petri dishes (glass) , group 6 disposable items , 50 ml polypropylene (pp) tubes for centrifuge (sterile) , 15 ml polypropylene (pp) tubes for centrifuge (sterile) , micro centrifuge tube, sterile with cap, 1.5 ml , cryo vial, sterile with cap, 2 ml (for long term storage) , cryo vial storage boxes , cryotag , bags for waste bin 60 litres , bags for waste bin 30 litres , bags for waste bin 2 litres , single use syringes, sterile 10 ml , single use syringes, sterile 20 ml , syringe filter (0.22um) for single use, sterile , filter paper sheets (for work benches) , single use paper towels , 2 ml standard reaction tube , pcr tubes (0.2 ml) , forceps, sterile,individually wrap, , petri dishes (plastic) , disposable loops 10 ?l , group 7 general lab items , bunsen burner , safety gas tubing , test tube rack , loop holders , loop wire , loop wire , inoculation loops 4mm , inoculation loops 3mm , diamond marker pencil , grease marking pencil , cotton , filter paper (for sputum microscopy reagents) , stainless steel tray , perforated baskets , wire rack , plastic bucket with lid foot operated (60l) , discard bucket with lid (10l) , discard bins (2l) , forceps (stainless steel) , stainless steel scissors , spatula , clips (50mm) , clips (70mm) , knives , cork borer , boxes (for holding petri dishes) , stainless steel trays , stainless steel bowl , stainless steel funnel , drying racks , bucket with lid (4 gallon) , mug , brown paper , rubber bands , cotton thread , wire racks to hold mccartney bottles , wire gauge with non asbestos pad , tripod stands , stainless steel rods for staining , industrial gloves , lens paper , rubber teats , rubber bulbs , retort stand base , retort ring plain rod , clamps , boss heads , test tube brushes , cylinder brushes , nylon brush large , brush for flask , mortar pestles , boxes for slides , spare caps for bijou bottles , racks suitable for pipettes offered, at least 4 positions , racks with lid for cryovial , rack for pp tubes (15 ml tube or universal test tube rack 17 mm diameter tube) , racks for pp tube (50 ml) , rack 15 ml / 50 ml 4 way microtube rack , pcr tube rack (0.2 ml) , storage box with lid for 0.2ml pcr tubes , sterile indicator tape, autoclave , sterile indicator tape, hot air oven , biological indicator for monitoring steam sterilization , parafilm (sealing film) , hand lens , digital stop watch , paper towel box , spray head with bottle , marker pens (0.8 to 1 mm) permanent , marker pen for pcr tubes (0.6 mm) , group 8 proprietary items , bd bbl™ calibrators kit (for 1 drawer) (1 each) , bactec mgit 960 ast transport rack 445942. , bbl mgit tubes for use in bactec mgit 960 (7ml) 100 tubes/pkg catalogue no:245122 , bactec mgit 960 supplement kit (100 tests, panta and oadc combined) catalogue no: 245124 , bactec™ mgit™ 960 sire kit, one kit is sufficient for 40 test catalogue no: 245123 , bactec mgit pantatm kit for manual mgit catalogue no: 245114 , bactec mgit pantatm kit for manual mgit catalogue no: 245114 , bactec mgit oadc kit for manual mgit catalogue no: 245116 , bactec mgit s.i.r.e. kit for manual mgit catalogue no: 245119 , bactec™ mgit™ 960 pza kit catalogue no: 245128 , genotype mtbdr plus v2 30496am test kit composed of: 30496a genotype mtbdr plus version 2.0 and 51610 genolyse , genotype mtbdr plus v2 30496am test kit composed of: 30496a genotype mtbdr plus version 2.0 and 51610 genolyse , genotype mtbdr sl v2.0 96 test, 31796am, test kits composed of 31796 a genotype mtbdr sl v2.0 , gt blot 48 tray for 96 strips (black) , gt blot 48 reagent kits , xpert® mtb/rif (pack of 50 for hbdc) , xpert check kit each kit allows to check 4 modules , genolyse 96 test: 51610...

State Livelihood Promotion Society - Jharkhand

38849818 tender for supply of office stationery , package i , lever arch file (laminated cover ) , folder file cloth patti (size – 14x10 inch, 400 gsm ) , register ruled (1 quire (96 pages, size – 34x21 cm approx, 58 gsm) , register ruled (2 quire (192 pages, size – 34x21 cm approx, 58 gsm) , ball pen with box , ball pen , ball pen (use and throw ) , pencil , sharpner , eraser , scale 30 cm , sticky note pad (coloured flag paper) size – 1x3 inch, set of 3 4 colours, 150 sheets , both side adhesive tape (approx 1 inch, length 1 mtr) , xerox paper (a4 75 gsm, 500 sheets in per pkt) , gum bottle (50 ml) , gum bottle (100 ml) , cd marker , broad marker , white board marker , writing pad ruled (size – 18x22 cm approx, 58 gsm, 60 sheets approx ) , writing pad ruled (size – 15x21 cm approx, 58 gsm, 60 sheets approx ) , writing pad ruled (size – 11x18 cm approx, 58 gsm, 60 sheets approx ) , conference pad ruled (size – 15x21 cm approx, 58 gsm, 20 sheets approx ) , stamp pad (size 88x54 mm (blue/red) ) , stapler small (no 10) , stapler pin (no 10) , cotton tag (50 tag in a bunch ) , calculator (12 digit with check and correct ) , envelop (laminated 11x5 inch) , scissors (stainless steel, size – 6 inch approx ) , chart paper (90 gsm, size – 55x70 cm approx, white and coloured) , long copy (approx 100 125 pages, 58 gsm) , plastic button folder (transparent) , package ii , cello tape (size 2 inch transparent) , gum stick (22 gm) , sketch pen set (12 pcs set) , cobra file hard cover , register ruled (3 quire (288 pages, size – 34x21 cm approx, 58 gsm) , binder clip (32 mm) , binder clip (41 mm) , colour xerox paper (a4 75 gsm, 500 sheets in a pkt) , permanent marker , spiral note book (24x18 cm, 58 gsm, 60 pages) , punch single hole full steel colour , punch double hole , stamp pad (size – 16x10 approx) , stapler big size (45 sheets staples, steel body) , stapler pin (45 sheets staples, 24/6 ) , envelop laminated (size – a4) , highlighter , white board duster , ring binder file (paper board, size – a4) , stick file , spiral note book (approx 100 125 pages) , plastic rassi (length – 100 mtr approx) , package iii , cover file , dak dispatch register 1 quire , dak dispatch register 2 quire , dak receipt register1 quire , dak receipt register2 quire , cash book 2 quire , cash book 3 quire , index/alphabetic register 1 quire , index/alphabetic register 2 quire , attendance register no 1 , attendance register no 2 , ball pen , gel pen , gems clip (steel) , binder clip 51 mm , heavy double hole punch machine blade set of 2 pcs , heavy duty stapler pin , scissors large (stainless steel, size – 9 inch) , paper cutter (blade 0.5 mm thick) , notice board (size 6x4 feet) , notice board (size 4x3 feet) , notice board pin , cloth duster yellow (size 18x20 inch) , stock register 2 quire , stock register 3 quire , stock register 4 quire , bond paper a4 100 gsm, 100 sheets in a pkt , paper weight , stamp pad ink 60 ml (blue/red) , paper pin , envelop laminated size – fs , refill...

Private Company - Jharkhand

38810275 tender for supply of aps kits for various pgs under mjpgl 1 small castrator (burdizo) 2 thermometer 3 surgical scissor 4 surgical forceps (tissue forceps) 6 teeth cutter (teether) for pigs) hoop cutter o vaccine box 8 saree for pashusakhi y bag for medicine 10 measuring tape 5ft 11 ldentity card holder 12 cap 13 torch 14 electronic weigh balance, hanging type(s0k9) 15 electronic weigh balance, non hanging type (4 5 kg)...

State Livelihood Promotion Society - Jharkhand

38808105 tender for supply of stationary items , name of the items : ( package i ) , xerox paper , pencil dark black ( hb ) , pencil eraser ( dust free ) , pencil sharpner , scale , ball pen ( blue / black / red ) , gel pen ( blue / black ) , package ii , cobra file , fly leaf file with office name printed in four line , liver arch file , ring file , cello tape , cello tape , packaging tape , fevi stick , fevicol , gum , stapler , stapler , stapler pin , stapler pin , double punching machine , double punching machine , single puching machine , note sheet pad , tag for file , calculator 12 digit , lrs attendance register , white board , white board marker pen ( black / blue / green ) , white board duster , scissor plastic handle ( big. ) , letter dispatch ( issue ) register , letter receipt register , highlighter pen , notice board pin , binder clip , gems clip , pen use & throw , permanent marker , plastic folder , writing pad , writing pad , writing pad , liquid eraser pen , paper cutter knife , stamp pad , stick file , stock register , jetter pen , jute file folder , register long , register long...

Bharat Coking Coal Limited - Jharkhand

38607913 bids are invited for gynae department ot items 7inch , dissecting forcep 8inch , bonney dissecting forcep 7inch , dissecting forcep tooth 6inch , allis tissue forcep 6inch , babcock tissue forcep 6inch , b.p handle no 3inch , b.p handle no 4inch , langenbeck retractor small size , backhus towel clip 5inch , foerster sponge holding forcep 9.5inch , mayo safety pin forcep holder 4.5inch , yankauer suction tube 12inch , doyen s retractor 3inch , baby allis tissue 4inch , metzenbaum scissor 4inch cvd , hysterectomy clamp autramatic jaw 8inch cvd , sponge holder 10inch , dissecting forcep 6inch plain , artery force cvd 8inch , episiotomy scissor 4inch , stitch cutting scissor 6inch , kocher s artery forcep cvd 8inch , mayo scissor 6inch , kidney dish big , gallipot , sim s speculum extra large , tray with cover 10 by 8 , bulldog clamp , sims speculum xl , doyens retracor 3inch , langenback retractor 2 by 0.5inch and 2by 0.75inch , needle holder t.c 08inch 2 st and 2 cvd , london retractor , sims speculum single ended total quantity : 162...

Health Department - Jharkhand

38521980 purchase of equipment and consumable , rvg sensor with laptop (e2 sensor classic) , manual scalar set , amalgam carrier (metal 2.00 mm) , glass slab(rectangular 100 x 60 x 20 mm) , extraction forcep for maxilla and mandible (adult) , extraction forcep for maxilla and mandible (pedodontic) , cowhorn forcep (molar/ maxillary right and left) , dental elevator ( periosteal) , dental elevator ( straight) , dental elevator ( coupland’s) (root) , dental elevator ( apex ) (right & left) , dental elevator ( cryer’s) ( cross bar tooth) , dental elevator ( warmwick james) (straight) , dental elevator ( millers) (alexo right) , linocaine solution with adrenaline for local anasthesia , linocaine spray , linocaine gel , dycal (calcium hydroxide) conservative use , suture material ( ethical silk 3.0 with half circle needle) , composite curing light , examination gloves (6.5 no.) good quality , examination gloves (7 no.) good quality , disposable gloves (6.5 no.) good quality , broaches 22/25mm 0 6 assorted , k files 15 to 40 number in (20 mm) (6 colour set) , k files 15 to 40 number in (25 mm) (6 colour set) (1 set of 6 pcs) , protaper file (speed 350 rpm, 21mm/ 25mm) (1 set of 6 pcs) , formecerol 20% bottle , edta gel (17% with 10% carbamide peroxide for rct) , paper point 2%, 4%, 6% (2 x 100 sticks) , size 15 no , size 20 no , size 25 no , size 30 no , size 35 no , gp cones for k files and protaper files (25mm asorted size) , calcium hydroxide for endodonic use (diapex) , pulp devitaliser (caustinerf septodent) (without aersonic) , hydrogen perioxide 400 ml. bottle , root canal sealer (zinc oxide, silican based, calcium silicate, phosphate) tube , flame torch with refilling gas can (superstone butane gas) , gp cutting scissors 4.5” curved , mouth mirror (rear & curved) , surgical gloves (6.5 no.) (pair) good quality , needle dispensing machine (electronic) , surgical gloves (7 no.)(pair) good quality , surgical mouth mask good quality , head cap , temporary filling material (zinc oxide eugenol) resin modified , dental instrument container (312/313 x190x 46/65 mm – 3 layer) , vaseline 200gm. , plastic condenser for gic filling ( two side) , hand wash 250 gm. bottle , towel (16” x 24”) , normal saline 500 ml bottle , x ray viewer , 5 ml syringe , disposable gloves (7 no.)(pair) good quality , eugenol liquid (septodent) bottle , iopar x ray flim ( size 2) , lead apron with lead color , f1 gp set ( dpi/meta) , f2 gp set ( dpi/meta) , dappen dish (acrylic/ glass) , 3 ml syringe , endomotor with apex locator , rotary files , 8/025 25mm , 4/17 25mm , 4/20 25mm , 6/20 25mm , 6/30 25mm , gp cones , 4/20 , 6/20 , 6/30 , zinc oxide eugenol (liquid+poweder) , glass inomer cement (liquid+poweder) , type 1 , type 2 , type 9 , tweeze , straight probe , matrix band type 8 , matrix retainer type 8 , cement spatula metal , cement spatula plastic , airtor burs (diamond) , straight , round , flatend taper , needle , composite syringes , a1 shade , a2 shade , b2 shade , composite etchant + bonding agents , mylar strip , composite finishing and polishing kit , applicator tip for bonding agent , silver amalgam(poweder + mercury) , cotton rolls for dental use , 3 ply mask , n 95 mask , tips for ultrasonic scaler , (capple dental series w1 edition v1.0) , betadine , sodium hypochlorite , conservative hypochlorite , conservative instruments kit , spreader for endodontic use , torch , suction tip , air rotor , lubrication oil (spray) , micromotor with straight hand piece , surgical bur (703 no) , x ray film (snap x ray) holder...

Indian Army - Jharkhand

38438542 bids are invited for gel pen (v2) (q4) , ink refills (q4) , roller ball pen (v2) (q4) , paper clips as per is 5650 (q4) , self adhesive flags (v2) (q4) , permanent marker pen (q4) , black lead pencils as per is 1375 (rev) (q4) , transparent tape (v2) (q4) , packaging tape (q4) , tags for files as per is 8499 (rev) (q4) , glue stick (v2) (q4) , markers white board (q4) , stapler pin staples (v2) (q4) , compact disk cases cd dvd case (q4) , battery cell as per is 9128, is 8144 (q4) , desktop calculator electronics (q4) , eraser (q4) , correspondence envelopes (v2) (q4) , paper adhesive, liquid gum and office paste type as per is 2257 (rev) (q3) , stamp pads (q4) , ink for stamp pads as per is 393 (q4) , glossy photo paper (q4) , highlighter pen (q4) , manual pencil sharpener (q3) , stamp paper or bond paper as per is 1848 (q4) , knife blades (q4) , staplers (v2) (q3) , desk pads writing (q4) , scissors (q4) , spiral and comb ring (q3) , fluid correction pen (v2) (q4) , scales (steel scale) as per is 1481 (q4) , binder clips (q3) total quantity : 2431...

Kendriya Vidyalaya Sangathan - Jharkhand

38366250 bids are invited for ball pen ballpen , inkstamp , ink stamp big , cell , cello tep , cell tape , cello tepbr , cello tape , carban paper , color flag , correcting pen , drawing pin , fevicol , fevi stick , highliter , register , pencilhb , waterpad , stapler , stapler pin , sutli dori , tag , eraser , sharpner , gum bottle , transparent , rubber band , thread dhaga , plastic file , white board , hand made , indian political , indian physical , world outline , cloth bags , gift packing , envelope whit , chart paper , drawing sheet , graph papers , sketch pen , wax colour , oil pastel , ribbon pack , paper cutter knife , canon car , brown roll , scissor total quantity : 7774...

Bharat Coking Coal Limited - Jharkhand

38352550 bids are invited for operative mini hysteroscopy set model: mini gynoscope a ) full hd hysteroscope 2.9mm 30°, full hd premium quality compact construction of optics optimizes quality and brilliant images, length 301mm, with rod lenses optical system, autoclavable, with fiber optic light transmission incorporated. 01 d ) 4.8 mm continuous flow operative hysteroscopy sheath ( inner sheath & outer sheath ) for 2.9 mm forward oblique telescope 30, 201mm working length, with a working channel for instruments of 5 fr., auto lock system, discrete inflow / outflow channel provides superior continuous irrigation & a crystal clear operating view. separate instrument channel allows operative intervention whilst maintaining distention pressure semi rigid scissors 5fr. double action jaws semi rigid alligator grasping forceps double action jaw5fr monopolar hook electrode5frand bipolar cutting electrode warranty 01 02 03 01 04 01 05 01 each 01 year...

State Livelihood Promotion Society - Jharkhand

38352074 supply of office stationery , stationery items : , envelop yellow cloth ( 10x4.5) , envelop yellow cloth (size 11x5) , envelop yellow cloth (size a4) , cover file , letter dispatch , board/guard file , stick file (plastic) , cobra file , index file /level arch file , note sheet , rulling register , rulling register , rulling register , rulling register , rulling register , attendace register , stock register , copy , plastic folder single pocket , white envelop , photocopier paper , photocopier paper , cloured flag paper , ball pen , chart paper marker pen , white board marker pen , ball point pen , gel pen , pen , pen1 , beta pen , use & throw pen , ball point pen , calculator 12 digit , cello tape(2) , cello tape(3) , double punching , double punching , glue stic 15 gm,fevistic , gum tube 20ml , fevicol tube (25gm) , highlighter pen , liquid correction pen , ohp /cd marker pen , binder clip, , binder clip, , binder clip, tin/steel 51mm , pencil , single hole punching machine , sketch pen (pack of 12 pcs) , scale 30 cm , stapler , stepler hs10en , stapler pinbig , stapler pin small , stamp pad , cotton tag (50 pcs bunch) , white board3x4, dry erase board, white board with board with almunium frame , notice board size (inch 24x18) blue /greeen , scissor stainless steel , scissor stainless steel 1 , paper cutter knifewith blade , pencil eraser (dust free) , pencil shapner , visiting card holder (capicity 250 300) , yellow dustingcloth size 24x24 , white board duster (magnet) , design board pin (plastic in top) , chart pepar , double side foam tape (24mm length 5 mtr approx) , plastic folder double pocket , plastic folder double pocket , spiral writingpad 1 , spiral writingpad 2 , permanent marker pen , calculator2 , writing pad 1/8 size , writing pad , writing pad 1 , l folder a4 size with single colour printing kea , folder file with cloth binding , computer stationery items , antivirus three user with three year free upgradation , antivirus multy user(5 user) with three year free upgradation , computer cartridge 1 , computer cartridge2 , computer cartridge3 , computer cartridge4 , cartridge hp (56x)/hp orginal , cartride1 , cartridge2 , cartridge3 , dongle(4g universal connect user/devices through wifi 4g lte and 3g bands supported,micro sd card slot , led bulb , legal size xerox paper , meta card , mouse , keyboard , mouse pad , pen drive 1 , pen drive 2 , pen drive 3 , pen drive 4 , jute folders file cloth patti with good quaility , yellow dusting cloths , generator logbook , fixed asset register 1 quire , cloth (sallu) , hdmi cable c pin , cloth (markin) , 1 tb ssd/hdd , watch (wall)/...

Patliputra Medical College - Jharkhand

38165451 purchase of miscellaneous item purchase of miscellaneous item as per tender documents list , laying and jointing pvc pipe. heading , abir /kg (best quality) , alluminiun utensils in kg. (best quality) , baby receiving tray 18”x12” – steel / pc (standard quality) , battery big no. 1050 leak proof / pc (everyday/ nippo/duracell) , battery medium 1035 leak proof/ pc (everyday/ nippo/duracell) , battery small 1015 leak proof / pc (everyday/ nippo/duracell) , battery small 1012 r03 (aaa) leak proof / pc (everyday/ nippo/duracell) , biodegradable bags for120 ltr. bins (pack of 100 pcs) – different colour. / pkt. (standard quality) , biodegradable bags for70 ltr. bins (pack of 100 pcs) – different colour. / pkt. (standard quality) , biodegradable bags for 60 ltr.bins (pack of 100 pcs) – different colour. / pkt. (standard quality) , blade shaving/ pkt of 05 pc. (willkingson /topaz/7o’clock) , bleaching powder / 25kg bag. isi marka , candle 200 gm (6 pc. packet) (standard quality) , coloured paper thin / zista (standard quality) , cup plate set bone china / set of 06 , detecto wall mounted / ft (standard quality) , display white board / sft. (standard quality) , display bord digital electric running/sft , door closer automatic standard– godrej / dorset/ pc , door matt 36”x18”coir / pc (standard quality) , door matt 36”x18”pvc grass type / pc (standard quality) , door matt 36”x18”rubber / pc (standard quality) , door matt 4’x2’ coir/ pc (standard quality) , door matt 4’x2’ pvc grass type (standard quality) , door matt 4’x2’ rubber / pc (standard quality) , four bins set 60 ltr. different colour with trolley / set (standard quality) , french chalk / pkt. of 400gms (isi marka) , glass (water) set / set of 06 pc. (brocil/trew/xera) , hammer/pc (standard quality) , hawai chappal p.vc. front cut/ pair (standard quality) rubber sole , hawai chappel different size / pair (relaxo/lakhni/bata/ajanta) rubber sole , hight scale big size/pc. (standard quality) , hindalium utensil / kg (standard quality) , induction kettle for warm water and tea – 2 ltr. / pc. (standard quality) , induction suspen with cover – 2 ltr. capacity (standard quality) , iron utensils in kg. (standard quality) , kelly pad/pc (standard quality) , lifebouy soap 125gm / pc , liquid handwash 200 ml. (detol/lifeboy/savlon) , lock 50 mm / pc (linkatoot/link round , lock 65 mm/ pc (linkatoot/ link round , match box / pkt of 10 pcs. (home light/ aim) , measuring cup steel 200ml / pc (standard quality) , measuring cup steel 250 ml / pc (standard quality) , measuring cup steel 400ml / pc (standard quality) , mechanical height rod / ft (standard mark) , mixer grinder heavy duty 700 wt./ pc (bajaj/ havels/sumeet) , mosquito coil / pkt.(good night/maxo/mortein) , mosquito repellent machine / pc. good night, maxo, mortien, allout , naphtahline ball / 100 gm pkt. (bengal chemical) , needle cum syringe destroyer 3 ltr./ pc. , nil blue / 900 gms pkt. (robin) , oxygen key / pc. , p.v.c. dustbin25 ltrs. in different colour / pc , plastic stool , donor questionnaire and consent form (new format double page double side printed , plastic chair witharm , plastic chair withoutarm , p.v.c. plastic water drum 100ltr. capacity with cover / pc. cello, milton , p.v.c. plastic water drum 50ltr. capacity with cover / pc. cello, milton , plastic bucket 20 ltr. capacity(cello, milton) / pc. , plastic dustbin with cover 60 ltrs./ pc cello, milton , plastic mug – standard size 1000ml (cello, milton) / pc. , plastic tub 20” diameter best quality (cello, milton) / pc. , plastic waste bins 120 ltr. – different colour / pc. (neelkamal/ supreme ) , pressure cooker 10 ltr. – united, hawkins , prestige / pc , pressure cooker 5 ltr. – united, hawkins, prestige / pc , refill liquid for mosquito repellant / pc good night, maxo, mortien, allout , rice keeping box – g.i. sheets 24g , 35”x20”x12” with cover / pc. (standard quality) , rice keeping box steel 26g , 35”x20”x12” with cover / pc. (standard quality) , salai wrench for opening oxygen cylinder 10 inch / pc. (taparia ) , shoe boots different size/pc.(standard make) , shoe plastic/pc. , shoe rack steel big size/pc three self/pvc size 36”x36”x15” , soda tata / 50 kg. bag (tata) , steel utensils / kg. (standard quality) , sutri / kg. (standard quality) , tea container – 10 ltr.capacity / pc. (maharaja/anapurna) , tools kit (speners, screw drivers set, slyrinch, pliers set + electric tester) / set (toparia) , torch 3 cell bras body (l.e.d.) / pc. (eveready/nippo) , urinal male /female / steel /pc. (standard make) adult , vimpowder 1000 gm for washing utensil / kg , wall mounting measuring scale / pc (standard make) , washing powder best quality 1000gm / kg. (ghari/panki/wheel active) , whiting / kg. (standard quality) , antivirus total security compatible for win7, win 8, win 10 with installation. quick heal, bit defender, kaspersky , aphaeresis consent from , aphaeresis register , arch file / pc , attendance register 24 page per pc (bhakka) , blank c.d per pc (sony) , cartidges for toshiba e studio 3518 a per pc , cartidges for workcentre pe 220 per pc , cartidges for xerox phaser 3260 , cartidges for xerox phaser 3020 , cartidges h.p 88a per pc (h.p) , cartidges h.p. 12a per pc (h.p) , cartidges toshiba 457per pc , cartidges for xerox versa link b 7035 per pc , cartidges h.p. laser mfp 1200 a per pc (h.p) , cartidges h.p. laser 108 a per pc (h.p) , cartidgesnpg 76 black canon xerox machine. , cartidgeslaser shot lbp 2900b , cartidges pantum m660n , toner for work centre xerox machine model 415 per pc , toner for work centre xerox workcentre 5020 per pc , drum cartidges of xerox machine , drum of xerox machine with blade , clip file pvc per pc (standard quality) , cover file folding per pc (standard quality) , carbon paper –koresblue/ black , rubber stamp different size per pcs. , marking ink 30ml per pcs. , diet calculation register – 400pages. (standard quality) , dot pen cello griper per pc. (cello/ montex) , envelopbest quality 16”x12” per pc (best paper) , envelopbest quality brown paper 10”x4 ” per pc (best paper) , envelopbest quality brown paper with inside laminated 10”x4” per pc (best paper) , envelop best quality 11”x5 ½” per pc (best paper) , envelop coated with cloth 10”x12” per pc. (best paper) , envelop coated with cloth 12”x15” per pc (best paper) , file guard + file folding withprinted hospital name & monogram on cover long thread (best paper) , flat file standard size per pc. (best paper) , fly leaf cloth binding with monogram – as per our sample per pc. (best paper) , guard file 100 stick per pc. (best paper) , gum700 ml per bottle (camel) , marker pen – different color per pc. , office – t.pin per pkt , online ups 4 kva2 hour backupwith complete installation – exide, microtech, sukam , online ups with inductive load with ½ hour battery backup. exide, microtech, sukam , p.v.c. cover file bag per pc (best quality) , paper weight standard per pc. , pen drive for computer – 32 gb per pc. (h.p/sony/sandisk) , pen for white board per pc , pen whitener eraser per pc , pin bell per pkt. (bell/ kisan) , plastic scale 12” , steel scale 12” , registerleather bond printed hospital name & monogram on cover & 1st page with numbering 06 no. per pc(as per our sample) , registerleather bond printed hospital name & monogram on cover & 1st page with numbering 08 no. per pc (as per our sample) , registerleather bond printed hospital name & monogram on cover & 1st page with numbering 12 no. per pc (as per our sample) , registerleather bond printed hospital name & monogram on cover & 1st page with numbering 20 no. per pc (as per our sample) , registerleather bond printed hospital name & monogram on cover & 1st page with numbering 30 no. per pc (as per our sample) , register component preparation 20 no.(as per our sample) , register component storage 20 no.(as per our sample) , register binding , patient’s cross matching register 20 no. , thalassemia pts. register 20 no. , donor defferal register 20 no. , whole blood stock register 20 no. , blood donor register 20 no. , patient’s grouping register 20 no. , donor gruping register 20 no. , master record register wb 20 no. , blood component stock register 20 no. , tti record register 20 no. , issue record register 20 no. , blood component discard register 20 no. , challan/cross match 100x100 for page printing original and duplicate 8’x6” per book , donor consent form both side printing 100 pcs per book , human whole blood/blood component single side printing book of 100 pcs. , color plastic coated labal crad with adhesive paper size 4”x3” , humen whole blood ip 4”x3” (group ayellow/group b pink/ group o blue/ group ab white) per 100 pcs , packed red blood cell concentrated ip 4”x3” (group ayellow/group b pink/ group o blue/ group ab white) per 100 pcs , random donor platelet concentrated ip 4”x3” (group ayellow/group b pink/ group o blue/ group ab white) per 100 pcs , fresh frozenplasma ip 4”x3” (group ayellow/group b pink/ group o blue/ group ab white) per 100 pcs , good weight machine digital 50gm to 150 kg avove with stand havy duty brand make per pcs. , stamp ink best quality 700ml per bottle , stamp pad self inking big per pc , stamp pad self inking medium per pc , stamp pad self inking small per pc , staplerbig24/10 per pc (kangaroo) , staplerbig24/6 per pc (kangaroo). , staplerbig24/8 per pc (kangaroo) , stapler pin big24/10 per pkt (kangaroo) , stapler pin big24/6 per pkt (kangaroo) , stapler pin big24/8 per pkt (kangaroo) , tag best quality per bundle , tape cutter per pc machine , white paper d.f.s. best quality per rim(500 sheets) (hanuman/ agro) , white paper s.f.s. best quality per rim (500 sheets)(hanuman /agro) , xerox paper white – a3 75 gsm per pkt (500 sheets) (century star/j.k) , xerox paper white – a4 75 gsm per pkt (500 sheets) (centurystar/j.k.) , xerox paper white – u 1 75 gsm per pkt (500 sheets) (century star/ j.k.) , anaesthetics note form single side printing century white paper– 11 ½” x 8” (book of 100 pc) (century 75gsm) , application cum consent form for sterilization operation book of 2 pages both side b/w (century 75gsm) , bed head ticket form double page both side printing century white paper – size a3 (book of 100 pcs) (century 75gsm) , blood doner card for blood bank size – 5”x4” (100 pcs) (century 75gsm) , blood doner certificate card – multicolour printing for blood bank size 6”x6” plastic coated paper (100 pcs) (century 75gsm) , blood donor card with printing, best quality paper size 4”x6”(100 pcs) (century 75gsm) , blood donor questionnaire and consent form both side printing for blood bank size 11 ½” x 8”. (book of 100 pc)(century 75gsm) , blood grouping label card group a, b, o,ab – size 5”x4”with adhesive sticker paper colour (100 pcs) (century 75gsm) , blood report form for blood bank 13”x8” .(book of 100 pcs) (century 75gsm) , born certificate form century white paper size 210mm x 297mm / (book of 100 pcs) (century 75gsm) , client dose sheets (o.s.t.) century white paper size 210mm x 297mm / (book of 100 pcs) (century 75gsm) , colour paper for blood bag 6”x6” (100 pcs) (century 75gsm) , cross match receipt book with duplicate copy for blood bank (100 original + 100 duplicate) per book (century 75gsm) , death certificate form century white paper size 210mm x 297mm / (book of 100 pcs) (century 75gsm) , department of pathology , obs.& gynae (bedside) – report form size a4 (book of 100pcs) (century 75gsm) , diet chart form a4. (book of 100 pc) (century 75gsm) , discharge ticket in best paper a4 general. (book of 100 pcs) (century 75gsm) , e.o.p.d. slip form century white paper 210mm x 297mm. (book of 100 pc) (century 75gsm) , flex banner multicolor with iron frame per sft. with fitting (standard make) , flex banner multicolor without iron frame per sft. with fitting (standard make) , for maternity facility case sheet of multiple coloured book of 11 pages both side as per sample/book (century 75gsm) , haemodialysisbook for patient plastic coated front & back page with 12 page 134mmx210mm (per book) (century 75gsm) , indoor continuation sheets form single side printing century white paper – 11 ½” x 8” (book of 100 pc) (century 75gsm) , injury report form best paper size 12”x7” with triplicate copy printing and winding and triplicate numberingfor surgery (book of 50 pcs) (century 75gsm) , investigation report form century white paper 210mm x 297mm. (book of 100 pc) (century 75gsm) , investigation report form for pathology both side printing – 11 ½” x 8” (book of 100 pc) (century 75gsm) , labor room register book of 100 pages as per sample/book (standard size & make) , medical record & check list for female /male sterilization book of 3 pages both side b/w (century 75gsm) , medico legal form single side printing century white paper for pathology& others departments11 ½”x 8” (book of 100 pc) (century 75gsm) , money receipt book of radiology, pathology, medicine,blood bank, office & others department(100 original + 100 duplicate) (century 75gsm) , monthly diet calculation register chart kitchen (book of 100 pcs) (century 75gsm) , name plate rewriting with materials per inch. stand with fitting (standard quality) , number writing of bed/roomper pcround/sq (standard quality & size 6”) , opd ticket in best paper a4 (book of 100 pcs) (century 75gsm) , p.v.c. folder files inside pocket & clip with printing & monogram (per pc) (standard quality) , partograph chart form century white paper size 210mm x 297mm / (book of 100 pcs) (century 75gsm) , patient satisfaction survey laqshya book of 100 pages b/w (century 75gsm) , pre anaesthetic record form both side printing on yellow paper (book of 100 pc) (century 75gsm) , radiology report form century white paper 210mm x 297mm. (book of 100 pc) (century 75gsm) , blood requisition form for whole human blood i.p. single side printing 11 ½ ”x8” for blood bank. (book of 100 pc) (century 75gsm) , risk bond form both side printing – century white paper – 11 ½” x 8” (book of 100 pc) (century 75gsm) , a4 size paper single side printing with paper , a4 size paper both side printing with paper , sign board painting & rewriting with material,iron & wood per sft. (standard quality & paints) , sncu bht format – set of 19 page (per set) black & white (century 75gsm) , sncu bht format colour with pocket plastic coated paper – set of 9 page (per set) (century 75gsm) , stock ledger for store printing & binding as per sample 450 page per pc.(as per our sample) , treatment chart form both side printing century white paper – 11 ½” x 8” (book of 100 pc) (century 75gsm) , urine report form 9”x5 ½” (book of 100 pcs) (century 75gsm) , wall painting and writing with materials per sft. (standard quality & paints) , wall painting with materials per sft. (standard quality & paints) , x ray film envelops printed best paper 10 ½”x8 ½” (per 100pc) (standard quality) , x ray film envelops printed best paper 9”x7” (per 100pc) (standard quality) , x ray film envelops printed best paper 12 ½”x10 ½” (per 100pc) (standard quality) , x ray film envelops printed best paper 12 ½”x12 ½” (per 100pc) (standard quality) , x ray film envelops printed best paper 15 ½”x12 ½”. (per 100pc) (standard quality) , bed sheet 100”x60” exclusive cotton / pc (best quality) , blanket red (weight 2 kg) / pc (best quality) , door for curtain synthetic/cotton printed best quality 48” / 6’x4’ stitching +ring +complete fitting(best quality) , door curtain fancy double layer with stitching +ring +complete fitting– per/ pc. (best quality) , donor questionnaire and consent form (new format double page double side printed , cotton clothes green cashment (dosuti) 46” permtr. (best quality) , markin cloth 48 / permtr. (best quality) , mosquito net cotton full bed size 7’x5’x3’ / pc (best quality) , pillow cover 17”x26” excl. cotton c flap / pc (best quality) , pillow with rubber foam standard size 16”x24” / pc (best quality) , tericot cloth white / per mtr (best quality) , towel big size 29”x 58” / pc (best quality) , towel hand 15”x25” / pc (best quality) , eye towel green cloth material reusable per/pc. , leggins reusable green cloth material standard size – per/pc. , surgeon cap reusable green cloth material– per/pc. , waste lillen bag standard size – per/pc. , connection pipe for wash besin /pc (standard make & quality) , drain pipe for wash basin/pc (standard make & quality) , plastic angle cock for bathroom /pc (standard make & quality) , plastic bib/piller cock for bathroom /pc (standard make & quality) , supply & fixing of overhead water tank capacity 2000 ltr. & making a platform with masonry enclosures / pc. , supply fixing & connection of necessary water pipe line including all required accessories size ½” p/feet, , supply fixing & connection of necessarycpvc water pipe line including all required accessories size ¾ ” p/feet, , supply fixing & connection of necessarycpvc water pipe line including all required accessories size 1 ¼ ” p/feet, , supply fixing & connection of necessarycpvc water pipe line including all required accessories size 1 ½” p/feet, , supply fixing & connection of necessary water pipe line including all required accessories size 1 p/feet, , supply fixing & connection of necessary water pipe line including all required accessories size 2 p/feet, , supply fixing & connection of c.p. bib cock/c.p angle cockfor bathroom , supply fixing & connection of doctor c.p. bib cock/c.p angle cockfor bathroom , supply fixing & connection of halfa set , supply fixing & connection of fta/mta size ½” , supply fixing & connection of fta/mta size 1” , supply fixing & connection of fta/mta size1 ½” , supply fixing and connecting of valve – ½” complete set , supply fixing and connecting of valve – ¾” complete set , supply fixing and connecting of valve – 1” complete set , supply fixing and connecting of valve – 2” complete set , supply fixing and connecting of valve – 3” complete set , supply fixing and connecting of valve – 4” complete set , supply fixing installation & connection of wash basine / pc. , supply, fixing & connection of cistern for bathroom / pc. , frame work of anodized material per sqft. , bookcase four door book case,rigid knock down construction, prime quality crca steel – panels & frame. . each door is provided with transparent glass for clear inside vision secured in a metal frame through rubber gasket inside the top of respective compartment & ensures parallel and smooth movement. each door has a scissor mechanism for receding inside the tip of respective compartments. each door has plastic side end caps as handle which is easy to grip epoxy polyester powder coated.(catalogue must be attached with tender) (authorization required) , filling cabinet: four drawer filling cabinet – rigid knock down constructions easy to grip full length handle recess integrated into metal drawer having centralized locking and anti tipping arrangement to ensure that when one drawer is opened for use, it does not allow other drawers to be opened. high quality precision ball slide.(catalogue must be attached with tender) (authorization required) , high back chair cushioned high back revolving chair, pu moulded cushion seat and back with arm .(catalogue must be attached) (authorization required) , high back executive chair: high back executive chair – torsion bar mechanism, single seat & back, high density foam. (catalogue must be attached with tender) (authorization required) , medium back chair cushioned medium back revolving chair, pu moulded cushion seat and back with arm.(catalogue must be attached with tender) (authorization required) , executive office table size in mm : 1800(w) x 900(d)x 750 (h) material ; block board (19mm) |(make: green ply/century ply/kit ply), is 1659:2004 and termite proof, covered with wood finish laminate thickness i mm (is 2046), set of one side drawers with anti rust telescopic slider and anti rust monolithic handle, and central locking facility. other side should have the storage box with two self and have a door with anti rust handle and lock. all edges to be surrounded by teak bead and polished. (authorization required) , office table office steel tablemade of pre laminated particle board with one side drawer unit , size 4’x2’ approx. (catalogue must be attached with tender) (authorization required) , steel plain almirah steel almirah. size – 78”x34”x19”x22g with locking systems apoxy coated colour.(catalogue must be attached with tender) (authorization required) , steel rack steel rack of 6shelves, size –height 6’ and panelsize – 72”x36”18” , 4+2 base and head, adjustable with sloted angle.(catalogue must be attached with tender) (authorization required) , three seater chair –black: three seater perforated steel chair, powder coated , chrome plated.(catalogue must be attached with tender) (authorization required) , three seater chair –silver: three seater perforated steel chair, powder coated,chrome plated base. (catalogue must be attached with tender) (authorization required) , training chairs withgood quality and finish : student chair, fixed back, hd foam; prelaminated particle writing board, round crc pipe (catalogue must be attached with tender) (authorization required) , visitors chair with handle: full arm visitors chair, fb/capsule pipe mechanism, pu moulded cushion seat and back, capsule pipe crc base. white terycot cloth full back cover. (catalogue must be attached with tender) (authorization required) , revoling bar stool long size , aluminium partition with acp sheets (standard quality & make) , aluminium partition with glass/particle/jali (standard quality & make) , aluminium sliding for window & doors / sq. ft. (standard quality & make) , bht frame – standard steel / pc (12”x 15” standard make & quality) , carpet material with laying labour charges/sqft. (p.v.c. 1.5 mm standard quality & make) , collapsible gate grill with fitting and fixing/ kg(standard quality) , goods carrying trolley/ pc (standard quality & make) , waste segregation trolley 15 ltrs. foot operated double bucket in different colour / pc , baby cradle m.s. 36”x15”x39” with mattress / pc (authorization required) , back rest / pc (authorization required) , basin stand steel / pc (authorization required) , bed pan – steel / pc (standard size & make) , bed side bowl – steel / pc(22 g 18” standard size & make) , wheel chair (authorization required) , bed side screen fourfold with curtains. (authorization required) , bed side locker (authorization required) , wash basin stand (single)(authorization required) , obestetric delivery table (3 section) (authorization required) , emergency trolley (authorization required) , dispenser stand with foot pedal (operated by pressing the foot pedal) (authorization required) (22 g 18” standard size & make) , dressing drum seamless15”x12” / pc (authorization required) (22 g 18” standard size & make) , dressing drum seamless 11”x15 / pc (authorization required) (22 g 18” standard size & make) , dressing drum seamless 9”x9” / pc (authorization required) (22 g 18” standard size & make) , duch cain / anema cain / pc.(22 g 18” standard size & make) , eclamptiabed / pc (authorization required)(22 g 18” standard size & make) , examination couch with three upper box, three sliding drawers ,sliding footstep,b.p. apparatus tray & mattress standard size / pc (authorization required) (22 g 18” standard size & make) , foot rest standard sizem.s. / pc. (authorization required) (22 g 18” standard size & make) , foot step standard double m.s. /pc (authorization required) (22 g 18” standard size & make) , gadda for labour table thickness 3” / pc. (neelkamal/ sleepwel, kaulon) , gynae examination couch. (authorization required) , high end fibrebed semifowler (abs pannel) with mattress , i.v. rodand over bed table / pc. (authorization required) , high end fibrebed semifowler (abs pannel) with mattress , i.v. rod / pc (authorization required) , i.v. stand s.s. with plastic base / pc. (authorization required) , instrument tray ss6”x8” with cover / pc (authorization required) , instrument tray ss 10”x12” with cover / pc (authorization required) , instrument tray ss 8”x10”with cover / pc (authorization required) , kidney tray s.s different size / pc. (authorization required) , labour table s.s. telescopic hydraulic height adjustable with mattress / pc. (authorization required) , mattress high density foam (40 density) – 4” for semifowler bed / pc (neelkamal/ sleepwel) , oxygen cylinder stand cum trolley standard / pc. (authorization required) , p.v.c. dustbin trolley with two wheel standard size 120 ltr. branded in different colour / pc (authorization required) , patient stool m.s. powder coated / pc. (authorization required) , pediatric bed with four sides railing & mattress / pc. (authorization required) , revolving stool with s.s. top. / pc (authorization required) , stretcher trolley approx. dimension 2010mm 1 x570mm w x 810 mm. h trolley made of s.s. tubular frame mounted on 200 mm dia four swivels castors. heavy duty with side railing s.s. , o2 cylinder carriage with mattress. / pc. (authorization required) , trolley instrument s.s. / pc. (authorization required) , trolley instrument s.s./ pc.(authorization required) , trolley medicine s.s. / pc. (authorization required) , trolley waste lilen standard size / pc. (authorization required) , ultra low volume fogger – 4 ltr. – 25000 rpm / pc. (authorization required) , verical blind with fixtures & installation/sqft. (standard quality & make) , weighing machine –paediatrics / pc , weighing machine – adult / pc , x ray view box led / pc , 1.5 ton inverter split ac copper condenserwith installation/ pc. ( with standard warranty ) (catalogue must be attached with tender) (authorization required) , 2 ton inverter split ac copper condenserwith installation/ pc. ( with standard warranty ) (catalogue must be attached with tender) (authorization required) , d s l r camera – 24 mega pixel or more with high speed usb minimum shutter speed 1/4000 per second storage types sd/sdhc8/sdxc8 memory cards./ pc( with standard warranty ) (catalogue must be attached with tender) (authorization required) , geyser – copper –25 ltr / pc( with standard warranty ) (catalogue must be attached with tender) (authorization required). havells, bajaj, voltas , geyser – copper – 15 ltr / pc ( with standard warranty ) (catalogue must be attached with tender) (authorization required) . havells, bajaj, voltas , inverter sinewave 1500 va/24 volt with double tubular battery 200 ah complete set–with installation & connection / pc. (authorization required). microtech exide , led t.v. – 32 inch / pcbrand sony, samsung, l.g.( with standard warranty ) (catalogue must be attached with tender) (authorization required) , photo copier machine – copy speed 20 copy / min or above, display – 4line lcd display, warm up time approx 31 seconds or less, paper size – a3, a4, a5 (by pass tray a3,a4,a5,a6), memory – 256 mb ram, networking features – yes, resolution 600dpi ( with standard warranty )/pc.(catalogue must be attached with tender) (authorization required) , photo copier machine – copy speed 35 copy / min or above, display – 9” colour touch screen, warm up time approx 20 seconds or less, paper size – a3, a4, a5 (by pass tray a3,a4,a5,a6) memory –4 gb ram, networking features – yes, secure hdd – 320 gb, cpu – dual core ( with standard warranty ) / pc (catalogue must be attached with tender) (authorization required) , refrigerator – 175 ltr / pc( with standard warranty ) (catalogue must be attached with tender) (authorization required). l.g. samsung, voltas , refrigerator – 220 ltr. / pc( with standard warranty ) (catalogue must be attached with tender) (authorization required). l.g. samsung, voltas , refrigerator340 to 350 ltr. / pc( with standard warranty ) (catalogue must be attached with tender) (authorization required). l.g. samsung, voltas , freezer500 ltr and above /pc (authorization required) voltas , deep freezer 500 ltr / pc (authorization required) voltas , supply & fixing of tubular battery for inverter 200 ah, exide , ups set for computer2kva / pc. microtech , ups set for computer 1kva / pc. microtech , ups set for computer 650 va / pc. microtech , fully automatic washing machine 6 kg –pc( with standard warranty ) (catalogue must be attached with tender) (authorization required) l.g., sumsang , water purifier (r.o.) – 50 lph, 7 stage of purification and water recovery more than 55%. the manufacturer company should have iso 9001 , 14001 certified and service centre in dhanbad ( with standard warranty )/ pc (catalogue must be attached with tender) (authorization required) , water purifier (u.v.) – technical specification of water storage cooler cum inbuilt purifier : water storage tank capacity – 120 ltr., no of faucets – 03. (two for cold & one for normal), storage tank material and body material stainless steel 304, provision of last point purification (uv based), refrigerant r134a, water recovery – 90 100% , manufacturer should be certified by iso 9001 certification for sales & service and 14001 for manufacturing., certificate of endorsement from indian medical association for manufacturer, and service centre in dhanbad (with standard warranty )/ pc (catalogue must be attached with tender) (authorization required) , water purifier r.o. + uv/ess with inbuilt cooling system with grilling , 60 lph, storage capacity – 80 ltr. with 08 stages of purification and water recovery more than 55% . the manufacturer company should have iso 9001 , 14001 certified and service centre in dhanbad ( with standard warranty )/ pc (catalogue must be attached with tender) (authorization required) , bulb led – 14/15 watt/ pc. brand havells, bajaj, surya. , chemical earthing installation for machine equipment per pc , copper strip for earthing connection per mtr. , curtain pipe with steel clamp, ring supply & installation / rft. , fan capacitor (condenser) brand usha/ universal. , glow sine board complete set with all fitting & fixing with material / sft. , hot air blower – electric – 2000 wt. / pc. brand havells/ roxy/ bajaj/ crompton. , led tube light20 wt. / pc. brand havells/ bajaj/ surya/great white , led tube light24 wt. / pc. brand havells/ bajaj/ surya/ great white , led tube light complete set 20 wt. / set brand havells/ wipro/ bajaj/ great white surya , led tube light complete set 24 wt. / set. brand havells/ bajaj/ surya/ great white , mcb box double pole – 32a with installation / pc. , mcb 32 a with installation / pc. , mcb 15a combind with installation / pc. , 6 a switch with installation / pc. , 6a socket with installation / pc. , 15 a top with installation / pc. , ordinary wire / coil , pedestal fan / pc. brand havells/usha/khaitan/ bajaj/ polar. , slim led tube light36wt / pc. brand havells/wipro/ bajaj/ surya/ great white , slim tube light complete set 36wt / set brand havells/ wipro/ bajaj/ surya , supply & fixing of battery for u.p.s. 12 volt / 650 va single / pc. microtech, exide , supply & fixing of wall mounting fan/ pc. brand havells/usha/khaitan/bajaj/ polar. , supply & fixing of wall mounting stabilizer double phase input to single phase output– 4 kva 90 /volte. microtech, exide , supply & fixing of wall mounting stabilizer double phase input to single phase output– 5 kva.90 volte. microtech, exide , supply & fixing of wall mounting stabilizer for a.c. digital 4 kva 90v suitable for 1.5 ton a.c. microtech, exide , supply & fixing of wall mounting stabilizer for a.c. digital 5 kva 90v suitable for 2 ton a.c. microtech, exide , supply fixing commissioning with necessary electrical connection of change over 100a /pc. , supply fixing commissioning with necessary electrical connection of change over 200a /pc. , supply fixing commissioning with necessary electrical connection of change over 500a /pc. , supply, fixing & necessary connections of ac box (metal body) complete set with mcb , supply, fixing, commissioning with necessary electrical connection ofbus bar – 100a /pc , supply, fixing, commissioning with necessary electrical connection ofbus bar – 200a /pc , supply, fixing, commissioning with necessary electrical connection ofinsulator / tpn – 100a/ pc , supply, fixing, commissioning with necessary electrical connection ofinsulator / tpn – 32a/ pc , supply, fixing, commissioning with necessary electrical connection ofinsulator / tpn – 63a/ pc , supply, fixing, commissioning with necessary electrical connection ofmain switch – 200a / pc , supply, fixing, commissioning with necessary electrical connection ofmain switch 400apc. , supply, fixing, commissioning withnecessary electrical connection ofmain switch 500a per pc. , supply, fixing, commissioning with necessary electrical connection ofmain switch –– 32 a / pc , supply, fixing, commissioning with necessary electrical connection ofmain switch – 63 a / pc , supply, fixing, commissioning with necessary electrical connection ofmain switch –100 a / pc , supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar 100a/ pc , supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar 200 a / pc , supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar400a , supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar500a , supply, fixing, electrical connection & wall cutting with masonry enclosure ofheavy duty exhaust fan with installation and connection / pc , supply, installation & connection of isolation transformer 10 kva , supply, installation & connection of isolation transformer 5 kva , supply, fixing, commissioning with necessary electrical connection ofisulator /itpn200a/pc. , supply, fixing, commissioning with necessary electrical connection ofisulator /itpn400a/pc. , three phase cable wiring for machine equipments cable size 25mmm sqmm. p/mtr. , tube light holder / pc , wire copper 3/20per coil , wire copper 7/20 per coil , computer – intel core i5 11th generation processor, ram: minimum 8gb or above, hdd : 01 terabyte or above, dvd writer, monitor – 19.5”, u.p.s. – full set ( with standard warranty )/ pc (catalogue must be attached with tender) (authorization required) , laptop( core i5 11th gen, 8gb ram or more, 512gb or more ssd) (authorization required) , 2 in 1 laptop – core i5 10th gen, 8gb or more ram/ 128 g ssd/ 12.3 inch with windows 10, display touch screen, sd card reader, 5 mp (1080p) front camera, 8 mp (1080p) autofocus rear camera, quad hd led backlit pixel sense touch screen display 10 point multi touch, 3:2 aspect ratio. (authorization required) , printer laser all in one laser printer (print,scan, copy & fax) , minimum – 33 ppm, memory – 32 mb, processor speed – 266 mhz or above, duty cycle – 10000 or above, paper tray can hold minimum 250 or above, both side copy capacity when both side printed paper inserted to copy, 33.6 kbps fax modem or above ( with standard warranty )/ pc (catalogue must be attached with tender) (authorization required) , printer laser single function, minimum –25 ppm or above, memory – 32 mb, processor speed – 266 mhz or above, duty cycle – 10000 or above, paper tray can hold minimum 250 or above ( with standard warranty )/ pc (catalogue must be attached with tender) (authorization required) , photo copier machine – copy speed 35 copy / min or above, display – 9” colour touch screen, warm up time approx 20 seconds or less, paper size – a3, a4, a5 (by pass tray a3,a4,a5,a6) memory –4 gb ram, networking features – yes, secure hdd – 320 gb, cpu – dual core ( with standard warranty ) / pc. (authorization required) , scanner – a4, legal size( with standard warranty )/ pc (catalogue must be attached with tender) (authorization required) , biometric finger print usb scanner suitable for aadhar based scanning , bio matric device (iris sensor) iris scanner usb for aadhar authentication and ayushmand bharat. great for ayushman bharat yojna. provides faster scanning, larger depth of field, wider scanning angle and zero error rates. single iris scanner – usb. (authorization required) , 4g pocket router all sim supported all 4g sim supported data card. it provides minimum up to 150 mbps speed.plug and play with intuitive web user interface adds to its smooth operation with up to 32 gb memory support. , bar code scanner supported symbologies : ean8, ean13, upca, upce, code 39, code 93, code 128, ean 128, codabar, i, intrleave 2 of 5, matrix 2 of 5, msi and all 1d bar codes. light source: 650 mm laser, scan speed: 300 scans/sec. scan type: single laser , usb mso finger scanner(mini size) all in one solution: superior performance enrollment, verification, and identification. government approved bio metric fingerprint scanner for instant sim activation of all telecom operators. easy plug & play. no prior software installation required. auto detect in your respective application. , multimedia key board for computer / pc , optical mouse for computer (desktop) / pc , almirah / cabinent lock repairing & painting. standard quality paints and materials. , almirah / cabinent lock changing. , bed iron repairing & painting. standard quality paints and materials. , bed iron repairing , bed side locker repairing & painting. standard quality paints and materials. , bed side locker repairing , bed side screen repairing & painting. standard quality paints and materials. , bed side screen – repairing , cardiac bed repairing & painting. standard quality paints and materials. , cardiac bed repairing. , dental chair – repairing & painting. standard quality paints and materials. , dental chair – repairing. , examination table repairing & painting. standard quality paints and materials , examination table repairing. , file cabinet – repairing & painting. standard quality paints and materials. , file cabinet – repairing , food carrying trolley repairing & painting. standard quality paints and materials. , food carrying trolley – repairing , foot step – repairing & painting. standard quality paints and materials. , foot step – repairing , steel almirah – repairing & painting. standard quality paints and materials. , steel almirah – repairing , glass painting . , goods carrying trolley repairing & painting. standard quality paints and materials. , goods carrying trolley – repairing. , installation of steel rod on metal hooks on the doors & windows for parda. , instrument cabinet – repairing & painting. standard quality paints and materials. , instrument cabinet – repairing & painting. standard quality paints and materials. , instrument trolley – repairing & painting. standard quality paints and materials. , instrument trolley repairing , iron chair neted 3 seater – repairing & painting. standard quality paints and materials. , iron chair neted 3 seater repairing , iron chair neted 5 seater – repairing & painting. standard quality paints and materials. , iron chair neted 5 seater repairing , moulded chair 3 seater – repairing & painting. standard quality paints and materials. , moulded chair 3 seater repairing , moulded chair 4 seater repairing & painting. standard quality paints and materials. , moulded chair 4 seater painting , moulded chair 5 seater repairing & painting. standard quality paints and materials. , moulded chair 5 seater repairing , name plate painting , notice board – repairing , o.t. light stand – repairing & painting. standard quality paints and materials. , o.t. light stand repairing , o.t. table – repairing & painting. standard quality paints and materials. , o.t. table repairing , orthopaedic table repairing & painting. standard quality paints and materials. , orthopaedic table repairing , oxygen trolley – repairing & painting. standard quality paints and materials. , oxygen trolley repairing , repair of aluminum door fitting, fixing with all materials . , repair of aluminum windows fitting, fixing with all materials. , repair of collapsible gate grill. , repair of door fitting, fixing with all materials . , repair of window glass – fitting, fixing with all materials. , repair of windows fitting, fixing with all materials. , repairing of damage mattress with rexene cover (foam where required) , revolving chair – repairing & wheel changing with painting , revolving stool steel repairing with painting , saline stand – repairing & painting. standard quality paints and materials. , saline stand repairing , steel chair – repairing & painting. standard quality paints and materials. , steel chair repairing , steel chair with writing pad – repairing & painting. standard quality paints and materials. , steel chair with writing pad repairing , steel table repairing & painting. standard quality paints and materials. , steel table repairing , stretcher trolley / patient trolley repairing & painting. standard quality paints and materials with wheal changing. , stretcher trolley / patient trolley repairing & wheel changing. , twin almirah – repairing & painting. standard quality paints and materials. , twin almirah – repairing , wooden partition – repairing & painting. standard quality paints and materials. , wooden partition repairing , inverter point wiring with all accessories per mtr. , necessary point wiring & others for machine equipments with all accessories size of wire –10 sq.mm / mtr. , necessary point wiring & others for machine equipments with all accessories size of wire – 04 sq.mm / mtr. , necessary point wiring & others for machine equipments with all accessories size of wire – 06 sq.mm / mtr. , necessary point wiring & others for machine equipments with all accessories size of wire – 1.5 sq.mm / mtr. , re installation of a.c. machine including old place wall packing, gas charging etc. complete job , repairing & fitting of ac voltage stabilizer single phase , repairing & fitting of ac voltage stabilizer double phase , three phase cable wiring for machine equipments , cable size – 35 sq.mm per mtr. , three phase cable wiring for machine equipments , cable size – 95 sq.mm per mtr. , three phase cable wiring for machine equipments , cable size – 120 sq.mm per mtr. , three phase cable wiring for machine equipments , cable size – 300 sq.mm per mtr. , three phase cable wiring for machine equipments , cable size – 50 sq.mm per mtr. , necessary point wiring & other, size 2.5 sq. mm , bowl stand repairing & painting. standard quality paints and materials. , repairing of bowl stand , medicine trolley repairing & painting. standard quality paints and materials. , repairing of – medicine trolley , steel rack big. repairing & painting. standard quality paints and materials. , repairing of – steel rack big. , steel rack small. repairing & painting. standard quality paints and materials. , repairing of steel rack small. , labour table. repairing & painting. standard quality paints and materials. , repairing of – labour table. , visitor chair with cusuion. repairing & painting. standard quality paints and materials. , repairing of – visitor chair with cusuion. , revolving chair. repairing & painting. standard quality paints and materials. , repairing of – revolving chair. , book self almirah repairing & painting. standard quality paints and materials. , repairing of – book self almirah , steel stool repairing & painting. standard quality paints and materials. , repairing of – steel stool , over bed table. repairing & painting. standard quality paints and materials. , repairing of – over bed table. , steel chair repairing & painting. standard quality paints and materials. , repairing of – steel chair , repairing of – wheel chair , abspanel i.c.u bed. repairing & painting. standard quality paints and materials. , repairing of – abs i.c.u bed. , abs semi flower bed. repairing & painting. standard quality paints and materials. , repairing of – abs semi flower bed. , abs locker repairing & painting. standard quality paints and materials. , repairing of – abs locker , baby creadle repairing & painting. standard quality paints and materials. , repairing of – baby creadle , repairing of online ups – 1 kva , repairing of online ups – 2 kva , repairing of online ups – 4 kva , false ceiling with suitable lights per/ sq. ft. , ply and sunmika work per/ sq. ft. , floor carpetting – per/ sq.ft. , venyl flooring per/ sq. ft. (p.v.c) , vertical swinds for window – per/ sq. ft. , draw sheet green cloth material reusable standard size – per/pc. , abdominal sheet green cloth material reusable standard size – per/pc. , roof shading waterproof metal asbestos sheet. – per/ sq. ft. , scissors for cloth cutting (shop scissors) , oxygen regulator , humidfier , perineal sheet green cloth material reusable standard size – per/pc. , surgeon apron green cloth material reusable standard size – per/pc. , surgeon kurta reusable standard size – per/pc. , surgeon pajama reusable standard size – per/pc. , surgeon mask green cloth material reusable standard size – per/pc. , surgeon gown impervious green cloth material reusable standard size – per/pc. , surgeon gown green cloth material reusable standard size – per/pc. , bed side screen curtain set of 3 green cloth material reusable standard size – per set , online ups 2 kvawith battery 100 ah 6 pcs.with complete installation (excide/ microtech) , online ups 5 kvawith battery 65 ah 15 pcs.with complete installation (exide, microtech) , online ups battery 100 ah...

Health Medical Education And Family Welfare Department - Jharkhand

38154244 bids are invited for gauze than (q3) , foleys catheter 18 no (q3) , vicryl double needle 1 no (q3) , abjel (q3) , suction pipe (q3) , sidex (q3) , bandage 6 (q3) , gloves 6.5 no (q3) , gloves 7.0 no (q3) , alice forcep (q3) , curved pointed scissor (q3) , tetra (q3) , muccure succure (q3) , syringes 5ml (q3) , chronic catgut 1 no (q3) mse total quantity : 6981...

State Livelihood Promotion Society - Jharkhand

38146771 supply of office stationery , name of the items : (package i) , binder clip 19mm , attendance register (no 2) , binder clip 25mm , binder clip 32mm , binder clip 41mm , binder clip 51mm , both side addehisive tape 2 inch , brown tape (big) , calculator 12 digit , calculator 12 digit , carbon sheet , cash book (2 quire) )laser paper , cash book (3 quire) )laser paper , cello tape white 2 inch , chart paper different colour 90 gsm , chisel marker , cloth envelop (size 33x25cm) good quality , cloth envelop (size 40x30cm) good quality , cobra files , colour photocopier white paper 75 gsm( a4 size, packet of 500 sheets) , coloured flag paper , coloured flag plastic , copy long size with 100 pages 30*20)laser paper , copy long size with 50 pages 30*20 )laser paper , cover file (water proof, good quality) , double punching (big) hdp 2320 , double punching (big) no 480 , double punching (big) no 600 , fevi stick (15gm.) , fevi stick (25gm.) , fevicol 100gm , fevicol 50gm , file tray , fixed assets register 1 quire , flash card (cutting chart paper 15 x9 cm) , flip note (indicator note) , gems clip plastic , gems clip steel , generator logbook , gum bottle 300ml , gum bottle 700ml , highlighter pen , i card cover (goj) size 10.5*15.5 , index/ alphabetic register(1 quire) , index/ alphabetic register(2 quire) , jute thread , leaf files (good quality) , legal size xerox paper , letter dispatch register 2 quire , letter receipt register 2 quire , liver arch file, big size , meta card ( cutting chart paper) , note sheet ( a4 size, packet of 500 sheets) , notebook (spiral) 50 pages , notice board pin , office paper tag | treasury file tag | indexing tag (8 inch) (100 pieces, red & white) , paper cutter knife with blade. , paper pin t shape , paper weight , pen (ball pen mrp rs.10) , pen , pen , pen , pen , pen , pen , pen , pen stand , pencil battery modal aa , pencil battery modal aaa , pencil dark black. (hb) , pencil eraser (dust free) , pencil sharpener , peon book (copy size),pages 100 , permanent marker pen (black/blue) , photocopier white paper 75 gsm( a3 size, packet of 500 sheets) , photocopier white paper 75 gsm( a4 size, packet of 500 sheets) , photocopier white paper 75 gsm( legal size, packet of 500 sheets) , photocopier white paper 80 gsm( a4 size, packet of 500 sheets) , plastic folder button file , plastic folder button file double sided , plastic folder , register ruled (2 quire)laser paper , stock register, rolling, size 20 (good quality) , register ruled (3 quire) )laser paper , register ruled (4 quire) )laser paper , register ruled (5 quire ) laser papper , ribbon , ring file , safety pin , scale 30c. size (glass) , scissors big , scissors medium , scissors small , single hole punching machine , stamp pad ink (black/blue/violet) , staplerhp 45 , stapler (10), , stapler (10d), , stapler pin (big) , stapler pin (small, cupper/steel) , stick file (plastic) , stock register, rolling, size 20 (good quality) , thermocol sheet , visitor register , white board cum green board(4 x 6) , white board cum green board (2 x 3) , white board duster , white board marker pen , white/brown envelop with good quality paper (size: 11” x 5”) address of jslps dmmu hazaribag, to be printed in bi colour. , white/brown envelop with good quality paper (size: 6” x 4”) address of jslps dmmu hazaribag to be printed in bi colour. , writing pad (25 cm. x 18.5 cm. 50 pages) , writing pad (25 cm. x 18.5 cm. approx. with spiral binding) multi colour printing in the cover page., 100 pages) , writing pad (25 cm. x 18.5 cm. approx. with spiral binding) multi colour printing in the cover page., 50 pages) , writing pad (25 cm. x 18.5 cm.50 pages) , writing pad (25 cm. x 18.5 cm.100 pages) , yellow dusting cloths (10 pc. in pkt.) , notice board , paper pin u shape plastic coated , computer stationery items (package ii) , antivirus three user with three year free up gradation , xerox toner cartridge for phaser 3010 , cartridge hp mfp 436nda (56a/56x) , cartridge (canon npg 59 2202n) , cartridge kyocera task alfa 2201(tk 4109) , dongle (4g universal connect users/devices through wi fi 4g lte and 3g bands supported, micro sd card slot) , cd marker , cd , extension cord size name: 2.5 x 13 , computer cartridge for hp laser jet m1005 mfp original , computer cartridge for hp laser jet m1005 mfp original , computer cartridge for laser jet hp printer ( hp p1007) , computer cartridge for laser jet hp printer ( hp p1007) , computer cartridge for laser jet hp printer ( hp p1007) , computer cartridge for laser jet pro mfp m226dw , mouse pad , pen drive ( 64 gb capacity) , pen drive ( 128 gb capacity) , hdmi cable c pin , mouse , hard disk drive, 1tb , keyboard with wire...

Health Department - Jharkhand

38146517 tender for purchase of miscellaneous items, printing items, electrical items etc 1 laying and jointing pvc pipe. heading 2 abir / kg ( best quality ) 3 nepthaline balls 4 baby receiving tray 18”x12” – steel / pc ( standard quality ) 5 battery big no. 1050 leak proof / pc ( everyday / nippo / duracell ) 6 battery medium 1035 leak proof / pc ( everyday / nippo / duracell ) 7 battery small 1015 leak proof / pc ( everyday / nippo / duracell ) 8 battery small 1012 r03 ( aaa ) leak proof / pc ( everyday / nippo / duracell ) 9 biodegradable bags for120 ltr. bins ( pack of 100 pcs ) – different colour. / pkt. ( standard quality ) 10 biodegradable bags for70 ltr. bins ( pack of 100 pcs ) – different colour. / pkt. ( standard quality ) 11 biodegradable bags for 60 ltr.bins ( pack of 100 pcs ) – different colour. / pkt. ( standard quality ) 12 blade shaving / pkt of 05 pc. ( willkingson / topaz / 7o’clock ) 13 bleaching powder / 25kg bag. isi marka 14 candle 200 gm ( 6 pc. packet ) ( standard quality ) 15 coloured paper thin / zista ( standard quality ) 16 cup plate set bone china / set of 06 17 detecto wall mounted / ft ( standard quality ) 18 display white board / sft. ( standard quality ) 19 door closer automatic standard– godrej / dorset / pc 20 door matt 36”x18”coir / pc ( standard quality ) 21 door matt 36”x18”pvc grass type / pc ( standard quality ) 22 door matt 36”x18”rubber / pc ( standard quality ) 23 door matt 4’x2’ coir / pc ( standard quality ) 24 door matt 4’x2’ pvc grass type ( standard quality ) 25 door matt 4’x2’ rubber / pc ( standard quality ) 26 four bins set 60 ltr. different colour with trolley / set ( standard quality ) 27 french chalk / pkt. of 400gms ( isi marka ) 28 glass ( water ) set / set of 06 pc. ( brocil / trew / xera ) 29 hammer / pc ( standard quality ) 30 hawai chappal p.vc. front cut / pair ( standard quality ) 31 hawai chappel different size / pair ( relaxo / lakhni / bata / ajanta ) 32 hight scale big size / pc. ( standard quality ) 33 phenyl liquid 34 induction kettle for warm water and tea – 5 ltr. / pc. ( standard quality ) 35 induction suspen with cover – 5 ltr. capacity ( standard quality ) 36 mops 37 kelly pad / pc ( standard quality ) 38 lifebouy soap 125gm / pc 39 liquid handwash 200 ml. ( detol / lifeboy / savlon ) 40 lock 50 mm ( link, godrej, navtal ) / pc ( link / atoot / godrej / navtal ) 41 lock 65 mm ( link, godrej, navtal ) / pc ( link / atoot / godrej / navtal ) 42 match box / pkt of 10 pcs. ( home light / aim ) 43 measuring cup steel 200ml / pc ( standard quality ) 44 measuring cup steel 250 ml / pc ( standard quality ) 45 measuring cup steel 400ml / pc ( standard quality ) 46 mechanical height rod / ft ( standard mark ) 47 mixer grinder heavy duty 700 wt. / pc ( bajaj / havels / sumeet ) 48 mosquito coil / pkt. ( good night / maxo / mortein ) 49 mosquito repellent machine / pc. 50 naphtahline ball / 100 gm pkt. ( bengal chemical ) 51 needle cum syringe destroyer 3 ltr. / pc. 52 needle hub cutter 53 nil blue / 900 gms pkt. ( robin ) 54 oxygen key / pc. 55 p.v.c. dustbin25 ltrs. in different colour / pc 56 p.v.c. plastic water drum 100ltr. capacity with cover / pc. 57 p.v.c. plastic water drum 50ltr. capacity with cover / pc. 58 plastic bucket 20 ltr. capacity ( cello, milton ) / pc. 59 plastic dustbin with cover 60 ltrs. / pc 60 plastic mug – standard size 1000ml ( cello, milton ) / pc. 61 plastic tub 20” diameter best quality ( cello, milton ) / pc. 62 plastic waste bins 120 ltr. – different colour / pc. ( neelkamal / supreme ) 63 pressure cooker 10 ltr. – united, hawkins , prestige / pc 64 pressure cooker 5 ltr. – united, hawkins, prestige / pc 65 refill liquid for mosquito repellant / pc 66 salai wrench for opening oxygen cylinder 10 inch / pc. ( taparia ) 67 shoe boots different size / pc. ( standard make ) 68 shoe plastic / pc. 69 shoe rack steel big size / pc 70 soda tata / 50 kg. bag ( tata ) 71 sutri / kg. ( standard quality ) 72 tea container – 10 ltr.capacity / pc. ( maharaja / anapurna ) 73 tools kit ( speners, screw drivers set, slyrinch, pliers set + electric tester ) / set ( toparia ) 74 torch 3 cell ( l.e.d. ) / pc. ( eveready / nippon ) 75 urinal male / female / steel / pc. ( standard make ) 76 vim powder 1000 gm for washing utensil / kg 77 wall mounting measuring scale / pc ( standard make ) 78 washing powder best quality 1000gm / kg. ( ghari / panki / wheel active ) 79 whiting / kg. ( standard quality ) 80 antivirus total security compatible for win7, win 8, win 10 with installation. 81 aphaeresis consent from 82 aphaeresis register 83 arch file / pc 84 attendance register 24 page per pc ( bhakka ) 85 epson printer ( inkjet ) model no l3110original ink 86 cartridges h.p. laser jet pro mfpm329dw per pc ( h.p ) 87 hp laser jet pro mfpm126a cartridge ( original ) 88 clip file pvc per pc ( standard quality ) 89 cover file folding per pc ( standard quality ) 90 diet calculation register – 400pages. ( standard quality ) 91 dot pen cello griper per pc. ( cello / montex ) 92 envelopbest quality 16”x12” per pc ( best paper ) 93 envelopbest quality brown paper 10”x4 ” per pc ( best paper ) 94 envelopbest quality brown paper with inside laminated 10”x4” per pc ( best paper ) 95 envelop best quality 11”x5 ½” per pc ( best paper ) 96 envelop coated with cloth 10”x12” per pc. ( best paper ) 97 envelop coated with cloth 12”x15” per pc ( best paper ) 98 file guard + file folding withprinted hospital name & monogram on cover long thread ( best paper ) 99 flat file standard size per pc. ( best paper ) 100 fly leaf cloth binding with monogram – as per our sample per pc. ( best paper ) 101 guard file 100 stick per pc. ( best paper ) 102 gum700 ml per bottle ( camel ) 103 marker pen – different color per pc. 104 punch machine ( big ) 105 office – t.pin per pkt 106 online ups 4 kva2 hour backupwith complete installation 107 online ups with inductive load with ½ hour battery backup. 108 p.v.c. cover file bag per pc ( best quality ) 109 paper weight standard per pc. 110 pen drive for computer – 32 gb per pc. ( h.p / sony / sandisk ) 111 pen for white board per pc 112 pen whitener eraser per pc 113 pin bell per pkt. ( bell / kisan ) 114 registerleather bond printed hospital name & monogram on cover & 1st page with numbering 06 no. per pc 115 registerleather bond printed hospital name & monogram on cover & 1st page with numbering 08 no. per pc 116 registerleather bond printed hospital name & monogram on cover & 1st page with numbering 12 no. per pc 117 registerleather bond printed hospital name & monogram on cover & 1st page with numbering 16 no. per pc ( as per sample ) 118 registerleather bond printed hospital name & monogram on cover & 1st page with numbering 20 no. per pc 119 register component preparation 120 register component storage 121 stamp ink best quality 700ml per bottle 122 stamp pad self inking big per pc 123 stamp pad self inking medium per pc 124 stamp pad self inking small per pc 125 staplerbig24 / 10 per pc ( kangaroo ) 126 staplerbig24 / 6 per pc ( kangaroo ) 127 staplerbig24 / 8 per pc ( kangaroo ) 128 stapler pin big24 / 10 per pkt ( kangaroo ) 129 stapler pin big24 / 6 per pkt ( kangaroo ) 130 stapler pin big24 / 8 per pkt ( kangaroo ) 131 tag best quality per bundle 132 tape cutter per pc 133 white paper d.f.s. best quality per rim ( hanuman / agro ) 134 white paper s.f.s. best quality per rim ( hanuman / agro ) 135 xerox paper white – a3 75 gsm per pkt ( century star / j.k ) 136 xerox paper white – a4 75 gsm per pkt ( centurystar / j.k. ) 137 anaesthetics note form single side printing century white paper– 11 ½” x 8” ( book of 100 pc ) ( century 75gsm ) 138 application cum consent form for sterilization operation book of 2 pages both side b / w ( century 75gsm ) 139 bed head ticket form double page both side printing century white paper – size a3 ( book of 100 pcs ) ( century 75gsm ) 140 blood doner card for blood bank size – 5”x4” ( 100 pcs ) ( century 75gsm ) 141 blood doner certificate card – multicolour printing for blood bank size 6”x6” plastic coated paper ( 100 pcs ) ( century 75gsm ) 142 blood donor card with printing, best quality paper size 4”x6” ( 100 pcs ) ( century 75gsm ) 143 blood donor questionnaire and consent form both side printing for blood bank size 11 ½” x 8”. ( book of 100 pc ) ( century 75gsm ) 144 blood grouping label card group a, b, o, ab – size 5”x4”with adhesive sticker paper colour ( 100 pcs ) ( century 75gsm ) 145 blood report form for blood bank 13”x8” . ( book of 100 pcs ) ( century 75gsm ) 146 disability certificate form in best paper a4 general. ( 100 pcs ) ( century 75gsm ) 147 client dose sheets ( o.s.t. ) century white paper size 210mm x 297mm / ( book of 100 pcs ) ( century 75gsm ) 148 colour paper for blood bag 6”x6” ( 100 pcs ) ( century 75gsm ) 149 cross match receipt book with duplicate copy for blood bank ( 100 original + 100 duplicate ) per book ( century 75gsm ) 150 disability application form in best paper a4 general. ( 100 pcs ) ( century 75gsm ) 151 department of pathology , obs.& gynae ( bedside ) – report form size a4 ( book of 100pcs ) ( century 75gsm ) 152 discharge ticket in best paper a4 general. ( book of 100 pcs ) ( century 75gsm ) 153 e.o.p.d. slip form century white paper 210mm x 297mm. ( book of 100 pc ) ( century 75gsm ) 154 flex banner multicolor with iron frame per sft. ( standard make ) 155 flex banner multicolor without iron frame per sft. ( standard make ) 156 for maternity facility case sheet of multiple coloured book of 11 pages both side as per sample / book ( century 75gsm ) 157 haemodialysisbook for patient plastic coated front & back page with 12 page 134mmx210mm ( per book ) ( century 75gsm ) 158 indoor continuation sheets form single side printing century white paper – 11 ½” x 8” ( book of 100 pc ) ( century 75gsm ) 159 injury report form best paper size 12”x7” with triplicate copy printing and winding and triplicate numberingfor surgery ( book of 50 pcs ) ( century 75gsm ) 160 investigation report form century white paper 210mm x 297mm. ( book of 100 pc ) ( century 75gsm ) 161 investigation report form for pathology both side printing – 11 ½” x 8” ( book of 100 pc ) ( century 75gsm ) 162 labor room register book of 100 pages as per sample / book ( standard size & make ) 163 medical record & check list for female / male sterilization book of 3 pages both side b / w ( century 75gsm ) 164 medico legal form single side printing century white paper for pathology& others departments11 ½”x 8” ( book of 100 pc ) ( century 75gsm ) 165 money receipt book of radiology, pathology, medicine, blood bank, office & others department ( 100 original + 100 duplicate ) ( century 75gsm ) 166 name plate rewriting with materials per pc. ( standard quality ) 167 number writing of bed / roomper pc ( standard quality & size 6” ) 168 p.v.c. folder files inside pocket & clip with printing & monogram ( per pc ) ( standard quality ) 169 partograph chart form century white paper size 210mm x 297mm / ( book of 100 pcs ) ( century 75gsm ) 170 patient satisfaction survey laqshya book of 100 pages b / w ( century 75gsm ) 171 pre anaesthetic record form both side printing on yellow paper ( book of 100 pc ) ( century 75gsm ) 172 radiology report form century white paper 210mm x 297mm. ( book of 100 pc ) ( century 75gsm ) 173 requisition form for whole human blood i.p. single side printing 11 ½ ”x8” for blood bank. ( book of 100 pc ) ( century 75gsm ) 174 risk bond form both side printing – century white paper – 11 ½” x 8” ( book of 100 pc ) ( century 75gsm ) 175 sign board painting & rewriting with material, iron & wood per sft. ( standard quality & paints ) 176 stock ledger for store printing & binding as per sample 450 page per pc. ( as per our sample ) 177 treatment chart form both side printing century white paper – 11 ½” x 8” ( book of 100 pc ) ( century 75gsm ) 178 urine report form 9”x5 ½” ( book of 100 pcs ) ( century 75gsm ) 179 wall painting and writing with materials per sft. ( standard quality & paints ) 180 wall painting with materials per sft. ( standard quality & paints ) 181 x ray film envelops printed best paper 10 ½”x8 ½” ( per 100pc ) ( standard quality ) 182 x ray film envelops printed best paper 9”x7” ( per 100pc ) ( standard quality ) 183 bed sheet 100”x60” exclusive cotton / pc ( best quality ) 184 blanket red ( weight 2 kg ) / pc ( best quality ) 185 hydrochloric acid for cleaning 186 door curtain fancy double layer with fixing – per / pc. ( best quality ) 187 cotton clothes green cashment ( dosuti ) 46” / 20 mtr. than ( best quality ) 188 markin cloth 60” / 20 mtr. than ( best quality ) 189 mosquito net cotton full bed size / pc ( best quality ) 190 pillow cover 17”x26” excl. cotton c flap / pc ( best quality ) 191 pillow with rubber foam standard size 16”x24” / pc ( best quality ) 192 tericot cloth white / 20 mtr. than ( best quality ) 193 towel big size 29”x 58” / pc ( best quality ) 194 towel hand 15”x25” / pc ( best quality ) 195 eye towel green cloth material reusable per / pc. 196 leggins reusable green cloth material standard size – per / pc. 197 surgeon cap reusable green cloth material– per / pc. 198 waste lillen bag standard size – per / pc. 199 connection pipe for wash besin / pc ( standard make & quality ) 200 drain pipe for wash basin / pc ( standard make & quality ) 201 plastic angle cock for bathroom / pc ( standard make & quality ) 202 plastic bib / piller cock for bathroom / pc ( standard make & quality ) 203 supply & fixing of overhead water tank capacity 2000 ltr. & making a platform with masonry enclosures / pc. 204 supply fixing & connection of necessary water pipe line including all required accessories size ½” p / feet, 205 supply fixing & connection of necessarycpvc water pipe line including all required accessories size ¾ ” p / feet, 206 supply fixing & connection of necessarycpvc water pipe line including all required accessories size 1 ¼ ” p / feet, 207 supply fixing & connection of necessarycpvc water pipe line including all required accessories size 1 ½” p / feet, 208 supply fixing & connection of necessary water pipe line including all required accessories size 1 p / feet, 209 supply fixing & connection of necessary water pipe line including all required accessories size 2 p / feet, 210 supply fixing & connection of c.p. bib cock / c.p angle cockfor bathroom 211 supply fixing & connection of doctor c.p. bib cock / c.p angle cockfor bathroom 212 3 bucket mopping system per pc. 213 karnataka model liquid waste management. per pc. 214 elbow tap per pc. 215 food carrying trolley per pc. 216 white puncture proof container 217 bio medical waste carrying trolley. 218 supply fixing & connection of fta / mta size ½” 219 supply fixing & connection of fta / mta size 1” 220 supply fixing & connection of fta / mta size1 ½” 221 supply fixing and connecting of valve – ½” complete set 222 supply fixing and connecting of valve – ¾” complete set 223 supply fixing and connecting of valve – 1” complete set 224 supply fixing and connecting of valve – 2” complete set 225 supply fixing and connecting of valve – 3” complete set 226 supply fixing and connecting of valve – 4” complete set 227 supply fixing installation & connection of wash basine / pc. 228 supply, fixing & connection of cistern for bathroom / pc. 229 frame work of anodized material 230 bookcase four door book case, rigid knock down construction, prime quality crca steel – panels & frame. . each door is provided with transparent glass for clear inside vision secured in a metal frame through rubber gasket inside the top of respective compartment & ensures parallel and smooth movement. each door has a scissor mechanism for receding inside the tip of respective compartments. each door has plastic side end caps as handle which is easy to grip epoxy polyester powder coated. ( catalogue must be attached with tender ) ( authorization required ) 231 filling cabinet: four drawer filling cabinet – rigid knock down constructions easy to grip full length handle recess integrated into metal drawer having centralized locking and anti tipping arrangement to ensure that when one drawer is opened for use, it does not allow other drawers to be opened. high quality precision ball slide. ( catalogue must be attached with tender ) ( authorization required ) 232 high back chair cushioned high back revolving chair, pu moulded cushion seat and back with arm . ( catalogue must be attached ) ( authorization required ) 233 high back executive chair: high back executive chair – torsion bar mechanism, single seat & back, high density foam. ( catalogue must be attached with tender ) ( authorization required ) 234 medium back chair cushioned medium back revolving chair, pu moulded cushion seat and back with arm. ( catalogue must be attached with tender ) ( authorization required ) 235 executive office table size in mm : 1800 ( w ) x 900 ( d ) x 750 ( h ) material ; block board ( 19mm ) | ( make: green ply / century ply / kit ply ) , is 1659:2004 and termite proof, covered with wood finish laminate thickness i mm ( is 2046 ) , set of one side drawers with anti rust telescopic slider and anti rust monolithic handle, and central locking facility. other side should have the storage box with two self and have a door with anti rust handle and lock. all edges to be surrounded by teak bead and polished. ( authorization required ) 236 office table office steel tablemade of pre laminated particle board with one side drawer unit , size 4’x2’ approx. ( catalogue must be attached with tender ) ( authorization required ) 237 steel plain almirah steel almirah. size – 78”x34”x19” with locking systems apoxy coated colour. ( catalogue must be attached with tender ) ( authorization required ) 238 steel rack steel rack of 6shelves, size –height 6’ and panelsize – 72”x36”18” , 4+2 base and head, adjustable with sloted angle. ( catalogue must be attached with tender ) ( authorization required ) 239 three seater chair –black: three seater perforated steel chair, powder coated , chrome plated. ( catalogue must be attached with tender ) ( authorization required ) 240 three seater chair –silver: three seater perforated steel chair, powder coated, chrome plated base. ( catalogue must be attached with tender ) ( authorization required ) 241 plane register 8 no. 242 visitors chair with handle: full arm visitors chair, fb / capsule pipe mechanism, pu moulded cushion seat and back, capsule pipe crc base. white terycot cloth full back cover. ( catalogue must be attached with tender ) ( authorization required ) 243 aluminium partition with acp sheets ( standard quality & make ) 244 aluminium partition with glass / particle / jali ( standard quality & make ) 245 aluminium sliding for window & doors / sq. ft. ( standard quality & make ) 246 bht frame – standard steel / pc ( 12”x 15” standard make & quality ) 247 carpet material with laying labour charges / sqft. ( p.v.c. 1.5 mm standard quality & make ) 248 collapsible gate grill with fitting and fixing / kg ( standard quality ) 249 goods carrying trolley / pc ( standard quality & make ) 250 waste segregation trolley 15 ltrs. foot operated double bucket in different colour / pc 251 baby cradle m.s. 36”x15”x39” with mattress / pc ( authorization required ) 252 mirror for wash besin 253 basin stand steel / pc ( authorization required ) 254 bed pan – steel / pc ( standard size & make ) 255 bed side bowl – steel / pc ( 22 g 18” standard size & make ) 256 bed side screen fourfold with curtains 66”h x 96” l or above. ( authorization required ) ( 22 g 18” standard size & make ) 257 dispenser stand with foot pedal ( operated by pressing the foot pedal ) ( authorization required ) ( 22 g 18” standard size & make ) 258 dressing drum seamless15”x12” / pc ( authorization required ) ( 22 g 18” standard size & make ) 259 dressing drum seamless 11”x15 / pc ( authorization required ) ( 22 g 18” standard size & make ) 260 dressing drum seamless 9”x9” / pc ( authorization required ) 261 duch cain / anema cain / pc. ( 22 g 18” standard size & make ) 262 eclamptiabed / pc ( authorization required ) 263 examination couch with three upper box, three sliding drawers , sliding footstep, b.p. apparatus tray & mattress standard size / pc ( authorization required ) ( 22 g 18” standard size & make ) 264 foot rest standard sizem.s. / pc. ( authorization required ) 265 ( 22 g 18” standard size & make ) 266 foot step standard double m.s. / pc ( authorization required ) 267 ( 22 g 18” standard size & make ) 268 gadda for labour table thickness 3” / pc. ( neelkamal / sleepwel ) 269 gynae examination couch with three upper box, three sliding drawers , sliding footstep, b.p. apparatus tray & mattress standard size / pc. ( authorization required ) 270 instrument tray ss6”x8” with cover / pc ( authorization required ) 271 instrument tray ss 10”x12” with cover / pc ( authorization required ) 272 instrument tray ss 8”x10”with cover / pc ( authorization required ) 273 kidney tray s.s different size / pc. ( authorization required ) 274 labour table s.s. telescopic hydraulic height adjustable with mattress / pc. ( authorization required ) 275 calculator medium size 276 oxygen cylinder stand cum trolley standard / pc. ( authorization required ) 277 p.v.c. dustbin trolley with two wheel standard size 120 ltr. branded in different colour / pc ( authorization required ) 278 patient stool m.s. powder coated / pc. ( authorization required ) 279 pediatric bed with four sides railing & mattress / pc. ( authorization required ) 280 revolving stool with s.s. top. / pc 281 stretcher trolley approx. dimension 2010mm 1 x570mm w x 810 mm. h trolley made of s.s. tubular frame mounted on 200 mm dia four swivels castors. heavy duty with side railing s.s. , o2 cylinder carriage with mattress. / pc. ( authorization required ) 282 trolley instrument s.s. – 30”x18”x32” / pc. ( authorization required ) 283 trolley instrument s.s. – 36”x24”x32” / pc. ( authorization required ) 284 trolley medicine s.s.30”x18”x32” / pc. ( authorization required ) 285 trolley waste lilen standard size / pc. ( authorization required ) 286 ultra low volume fogger – 4 ltr. – 25000 rpm / pc. ( authorization required ) 287 verical blind with fixtures & installation / sqft. ( standard quality & make ) 288 weighing machine –paediatrics / pc 289 weighing machine – adult / pc 290 x ray view box led / pc 291 1.5 ton inverter split ac copper condenserwith installation / pc. ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 292 2 ton inverter split ac copper condenserwith installation / pc. ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 293 geyser – copper –25 ltr / pc ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 294 geyser – copper – 15 ltr / pc ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 295 photo copier machine – copy speed 35 copy / min or above, display – 9” colour touch screen, warm up time approx 20 seconds or less, paper size – a3, a4, a5 ( by pass tray a3, a4, a5, a6 ) memory –4 gb ram, networking features – yes, secure hdd – 320 gb, cpu – dual core ( with standard warranty ) / pc ( catalogue must be attached with tender ) ( authorization required ) 296 refrigerator – 175 ltr / pc ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 297 refrigerator – 220 ltr. / pc ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 298 refrigerator340 to 350 ltr. / pc ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 299 freezer500 ltr and above / pc ( authorization required ) 300 deep freezer 500 ltr / pc ( authorization required ) 301 supply & fixing of tubular battery for inverter 200 ah 302 ups set for computer2kva / pc. 303 ups set for computer 1kva / pc. 304 ups set for computer 650 va / pc. 305 washing machine 6 kg – manually / pc ( with standard warranty ) ( catalogue must be attached with tender ) ( authorization required ) 306 water purifier ( r.o. ) – 50 lph, 7 stage of purification and water recovery more than 55%. the manufacturer company should have iso 9001 , 14001 certified and service centre in dhanbad ( with standard warranty ) / pc ( catalogue must be attached with tender ) ( authorization required ) 307 water purifier ( u.v. ) – technical specification of water storage cooler cum inbuilt purifier : model pure chill 120pss. water storage tank capacity – 120 ltr., no of faucets – 03. ( two for cold & one for normal ) , storage tank material and body material stainless steel 304, provision of last point purification ( uv based ) , refrigerant r134a, water recovery – 90 100% , manufacturer should be certified by iso 9001 certification for sales & service and 14001 for manufacturing., certificate of endorsement from indian medical association for manufacturer, and service centre in dhanbad ( with standard warranty ) / pc ( catalogue must be attached with tender ) ( authorization required ) 308 water purifier r.o. + uv / ess with inbuilt cooling system with grilling , 60 lph, storage capacity – 80 ltr. with 08 stages of purification and water recovery more than 55% . the manufacturer company should have iso 9001 , 14001 certified and service centre in dhanbad ( with standard warranty ) / pc ( catalogue must be attached with tender ) ( authorization required ) 309 bulb led – 14 / 15 watt / pc. brand helonix, havells, bajaj, wipro, surya. 310 chemical earthing installation for machine equipment per pc 311 copper strip for earthing connection per mtr. 312 curtain pipe with steel clamp, ring supply & installation / sft. 313 fan capacitor ( condenser ) brand usha / universal. 314 glow sine board complete set with all fitting & fixing with material / sft. 315 hot air blower – electric – 2000 wt. / pc. brand havells / roxy / bajaj / crompton. 316 led tube light20 wt. / pc. brand havells / wipro / bajaj / surya / great white 317 led tube light24 wt. / pc. brand havells / wipro / bajaj / surya / great white 318 led tube light complete set 20 wt. / set brand havells / wipro / bajaj / great white surya 319 led tube light complete set 24 wt. / set. brand havells / wipro / bajaj / surya / great white 320 mcb box double pole – 32a with installation / pc. 321 mcb 32 a with installation / pc. 322 mcb 15a combind with installation / pc. 323 6 a switch with installation / pc. 324 6a socket with installation / pc. 325 15 a top with installation / pc. 326 ordinary wire / coil 327 pedestal fan / pc. brand havells / usha / khaitan / bajaj / polar. 328 slim led tube light28wt / pc. brand havells / wipro / bajaj / surya / great white 329 slim tube light complete set 28wt / set brand havells / wipro / bajaj / surya 330 supply & fixing of battery for u.p.s. 12 volt / 650 va single / pc. 331 supply & fixing of wall mounting fan / pc. brand havells / usha / khaitan / bajaj / polar. 332 supply & fixing of wall mounting stabilizer double phase input to single phase output– 4 kva 90 / volte. 333 supply & fixing of wall mounting stabilizer double phase input to single phase output– 5 kva.90 volte. 334 supply & fixing of wall mounting stabilizer for a.c. digital 4 kva 90v suitable for 1.5 ton a.c. 335 supply & fixing of wall mounting stabilizer for a.c. digital 5 kva 90v suitable for 2 ton a.c. 336 supply fixing commissioning with necessary electrical connection of change over 100a / pc. 337 supply fixing commissioning with necessary electrical connection of change over 200a / pc. 338 supply fixing commissioning with necessary electrical connection of change over 500a / pc. 339 supply, fixing & necessary connections of ac box ( metal body ) complete set with mcb 340 supply, fixing, commissioning with necessary electrical connection ofbus bar – 100a / pc 341 supply, fixing, commissioning with necessary electrical connection ofbus bar – 200a / pc 342 supply, fixing, commissioning with necessary electrical connection ofinsulator / tpn – 100a / pc 343 supply, fixing, commissioning with necessary electrical connection ofinsulator / tpn – 32a / pc 344 supply, fixing, commissioning with necessary electrical connection ofinsulator / tpn – 63a / pc 345 supply, fixing, commissioning with necessary electrical connection ofmain switch – 200a / pc 346 supply, fixing, commissioning with necessary electrical connection ofmain switch 400apc. 347 supply, fixing, commissioning withnecessary electrical connection ofmain switch 500a per pc. 348 supply, fixing, commissioning with necessary electrical connection ofmain switch –– 32 a / pc 349 supply, fixing, commissioning with necessary electrical connection ofmain switch – 63 a / pc 350 supply, fixing, commissioning with necessary electrical connection ofmain switch –100 a / pc 351 supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar 100a / pc 352 supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar 200 a / pc 353 supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar400a 354 supply, fixing, commissioning with necessary electrical connection ofopen area shaded bus bar500a 355 supply, fixing, electrical connection & wall cutting with masonry enclosure ofheavy duty exhaust fan with installation and connection / pc 356 supply, installation & connection of isolation transformer 10 kva 357 supply, installation & connection of isolation transformer 5 kva 358 supply, fixing, commissioning with necessary electrical connection ofisulator / itpn200a / pc. 359 supply, fixing, commissioning with necessary electrical connection ofisulator / itpn400a / pc. 360 three phase cable wiring for machine equipments cable size 25mmm sqmm. p / mtr. 361 tube light holder / pc 362 wire copper 3 / 20per coil 363 wire copper 7 / 20 per coil 364 computer – intel core i5 12th generation processor, ram: minimum 8gb or above, hdd : 01 terabyte or above, monitor – 19.5”, u.p.s. – full set ( with standard warranty ) / pc ( catalogue must be attached with tender ) ( authorization required ) 365 laptop ( core i5 12th gen, 8gb ram or more, 512gb or more ssd ) ( authorization required ) 366 printer laser single function, minimum –25 ppm or above, memory – 32 mb, processor speed – 266 mhz or above, duty cycle – 10000 or above, paper tray can hold minimum 250 or above ( with standard warranty ) / pc ( catalogue must be attached with tender ) ( authorization required ) 367 photo copier machine – copy speed 35 copy / min or above, display – 9” colour touch screen, warm up time approx 20 seconds or less, paper size – a3, a4, a5 ( by pass tray a3, a4, a5, a6 ) memory –4 gb ram, networking features – yes, secure hdd – 320 gb, cpu – dual core ( with standard warranty ) / pc. ( authorization required ) 368 scanner – a4, legal size ( with standard warranty ) / pc ( catalogue must be attached with tender ) ( authorization required ) 369 biometric finger print usb scanner suitable for aadhar based scanning 370 bio matric device ( iris sensor ) iris scanner usb for aadhar authentication and ayushmand bharat. great for ayushman bharat yojna. provides faster scanning, larger depth of field, wider scanning angle and zero error rates. single iris scanner – usb. ( authorization required ) 371 multimedia key board for computer / pc 372 optical mouse for computer ( desktop ) / pc 373 almirah / cabinent lock repairing & painting. standard quality paints and materials. 374 almirah / cabinent lock repairing 375 installation of steel rod on metal hooks on the doors & windows for parda 376 iron chair neted 3 seater – repairing & painting. standard quality paints and materials. 377 iron chair neted 3 seater repairing 378 iron chair neted 5 seater – repairing & painting. standard quality paints and materials. 379 iron chair neted 5 seater repairing 380 moulded chair 3 seater – repairing & painting. standard quality paints and materials. 381 moulded chair 3 seater repairing 382 moulded chair 4 seater repairing & painting. standard quality paints and materials. 383 moulded chair 4 seater painting 384 moulded chair 5 seater repairing & painting. standard quality paints and materials. 385 moulded chair 5 seater repairing 386 name plate painting 387 repair of windows fitting, fixing with all materials. 388 repairing of damage mattress with rexene cover ( foam where required ) 389 revolving chair – repairing & wheel changing. 390 revolving stool steel repairing 391 inverter point wiring with all accessories per mtr. 392 necessary point wiring & others for machine equipments with all accessories size of wire –10 sq.mm / mtr. 393 necessary point wiring & others for machine equipments with all accessories size of wire – 04 sq.mm / mtr. 394 necessary point wiring & others for machine equipments with all accessories size of wire – 06 sq.mm / mtr. 395 necessary point wiring & others for machine equipments with all accessories size of wire – 1.5 sq.mm / mtr. 396 re installation of a.c. machine including old place wall packing, gas charging etc. complete job 397 repairing & fitting of ac voltage stabilizer single phase 398 repairing & fitting of ac voltage stabilizer double phase 399 three phase cable wiring for machine equipments , cable size – 35 sq.mm per mtr. 400 three phase cable wiring for machine equipments , cable size – 95 sq.mm per mtr. 401 three phase cable wiring for machine equipments , cable size – 120 sq.mm per mtr. 402 three phase cable wiring for machine equipments , cable size – 300 sq.mm per mtr. 403 necessary point wiring & other, size 2.5 sq. mm 404 false ceiling with suitable lights per / sq. ft. 405 ply and sunmika work per / sq. ft. 406 floor carpetting – per / sq.ft. 407 venyl flooring per / sq. ft. 408 vertical swinds for window – per / sq. ft. 409 draw sheet green cloth material reusable standard size – per / pc. 410 abdominal sheet green cloth material reusable standard size – per / pc. 411 perineal sheet green cloth material reusable standard size – per / pc. 412 surgeon apron green cloth material reusable standard size – per / pc. 413 surgeon kurta reusable standard size – per / pc. 414 surgeon pajama reusable standard size – per / pc. 415 surgeon mask green cloth material reusable standard size – per / pc. 416 surgeon gown impervious green cloth material reusable standard size – per / pc. 417 surgeon gown green cloth material reusable standard size – per / pc. 418 bed side screen curtain set of 3 green cloth material reusable standard size – per set 419 takuaa ( for hole in bunch of paper ) ...

Health Department - Jharkhand

38091924 tender for supply of equipments and consumables for nohp 1.1 rvg sensor with laptop ( e2 sensor classic ) 2 manual scalar set 3 amalgam carrier ( metal 2.00 mm ) 4 glass slab ( rectangular 100 x 60 x 20 mm ) 5 extraction forcep for maxilla and mandible ( adult ) 6 extraction forcep for maxilla and mandible ( pedodontic ) 7 cowhorn forcep ( molar / maxillary right and left ) 8 dental elevator ( periosteal ) 9 dental elevator ( straight ) 10 dental elevator ( coupland’s ) ( root ) 11 dental elevator ( apex ) ( right & left ) 12 dental elevator ( cryer’s ) ( cross bar tooth ) 13 dental elevator ( warmwick james ) ( straight ) 14 dental elevator ( millers ) ( alexo right ) 15 linocaine solution with adrenaline for local anasthesia 16 linocaine spray 17 linocaine gel 18 dycal ( calcium hydroxide ) conservative use 19 suture material ( ethical silk 3.0 with half circle needle ) 20 composite curing light 21 examination gloves ( 6.5 no. ) good quality 22 examination gloves ( 7 no. ) good quality 23 disposable gloves ( 6.5 no. ) good quality 24 broaches 22 / 25mm 0 6 assorted 25 k files 15 to 40 number in ( 20 mm ) ( 6 colour set ) 26 k files 15 to 40 number in ( 25 mm ) ( 6 colour set ) ( 1 set of 6 pcs ) 27 protaper file ( speed 350 rpm, 21mm / 25mm ) ( 1 set of 6 pcs ) 28 formecerol 20% bottle 29 edta gel ( 17% with 10% carbamide peroxide for rct ) 30 paper point 2%, 4%, 6% ( 2 x 100 sticks ) 31 size 15 no 32 size 20 no 33 size 25 no 34 size 30 no 35 size 35 no 36 gp cones for k files and protaper files ( 25mm asorted size ) 37 calcium hydroxide for endodonic use ( diapex ) 38 pulp devitaliser ( caustinerf septodent ) ( without aersonic ) 39 hydrogen perioxide 400 ml. bottle 40 root canal sealer ( zinc oxide, silican based, calcium silicate, phosphate ) tube 41 flame torch with refilling gas can ( superstone butane gas ) 42 gp cutting scissors 4.5” curved 43 mouth mirror ( rear & curved ) 44 surgical gloves ( 6.5 no. ) ( pair ) good quality 45 needle dispensing machine ( electronic ) 46 surgical gloves ( 7 no. ) ( pair ) good quality 47 surgical mouth mask good quality 48 head cap 49 temporary filling material ( zinc oxide eugenol ) resin modified 50 dental instrument container ( 312 / 313 x190x 46 / 65 mm – 3 layer ) 51 vaseline 200gm. 52 plastic condenser for gic filling ( two side ) 53 hand wash 250 gm. bottle 54 towel ( 16” x 24” ) 55 normal saline 500 ml bottle 56 x ray viewer 57 5 ml syringe 58 disposable gloves ( 7 no. ) ( pair ) good quality 59 eugenol liquid ( septodent ) bottle 60 iopar x ray flim ( size 2 ) 61 lead apron with lead color 62 f1 gp set ( dpi / meta ) 63 f2 gp set ( dpi / meta ) 64 dappen dish ( acrylic / glass ) 65 3 ml syringe 66 endomotor with apex locator 67 rotary files 68 8 / 025 25mm 69 4 / 17 25mm 70 4 / 20 25mm 71 6 / 20 25mm 72 6 / 30 25mm 73 gp cones 74 4 / 20 75 6 / 20 76 6 / 30 77 zinc oxide eugenol ( liquid+poweder ) 78 glass inomer cement ( liquid+poweder ) 79 type 1 80 type 2 81 type 9 82 tweeze 83 straight probe 84 matrix band type 8 85 matrix retainer type 8 86 cement spatula metal 87 cement spatula plastic 88 airtor burs ( diamond ) 89 straight 90 round 91 flatend taper 92 needle 93 composite syringes 94 a1 shade 95 a2 shade 96 b2 shade 97 composite etchant + bonding agents 98 mylar strip 99 composite finishing and polishing kit 100 applicator tip for bonding agent 101 silver amalgam ( poweder + mercury ) 102 cotton rolls for dental use 103 3 ply mask 104 n 95 mask 105 tips for ultrasonic scaler 106 ( capple dental series w1 edition v1.0 ) 107 betadine 108 sodium hypochlorite 109 conservative hypochlorite 110 conservative instruments kit 111 spreader for endodontic use 112 torch 113 suction tip 114 air rotor 115 lubrication oil ( spray ) 116 micromotor with straight hand piece 117 surgical bur ( 703 no ) 118.00 x ray film ( snap x ray ) holder...

Department of Medical Health and Family Welfare - Jharkhand

38082513 bids are invited for diagnostic instruments ( mouth mirror, probe, twizzer ) ( q3 ) , kidney tray ( q3 ) , cotton holder ( q3 ) , sphygmanometer and stethoscope ( q3 ) , maxillary anterior extraction forceps ( q3 ) , maxillary posterior extraction forceps ( q3 ) , mandibular anterior extraction forceps ( q3 ) , mandibular posterior extraction forceps ( q3 ) , decidous teeth extraction forceps ( q3 ) , straight elevators ( q3 ) , coupland elevators ( q3 ) , periosteal elevators ( q3 ) , cross bar ( q3 ) , james warwicks elevator ( q3 ) , apexo elevator ( q3 ) , cryer ( q3 ) , bone file ( q3 ) , chiesel, mallate ( q3 ) , needle holder, scissor ( q3 ) , suture material ( 3 0, 4 0 ) ( q3 ) , myo scissor ( q3 ) , stich cutting scissor ( q3 ) , b p handle ( no. 03, 04, 07 ) ( q3 ) , b p blade ( no. 11, 12, 15 ) ( q3 ) , currete ( q3 ) , suction machine ( q3 ) , micromotor with surgical straight hand piece ( q3 ) , surgical bur ( q3 ) , autoclave sterlizer boiler ( q3 ) , ultrasonic scaler ( q3 ) , straight & contrangle hand piece ( q3 ) , composite curing light ( q3 ) , composite ( q3 ) , calcium hydroxide dressing ( q3 ) , spoon excavator ( q3 ) , glass inomer cement ( type 1 ) ( q3 ) , glass inomer cement ( type 2 ) ( q3 ) , matrix band ( q3 ) , k file ( 15 40 ) ( q3 ) , k file ( 45 80 ) ( q3 ) , gutta percha ( 15 40 ) ( q3 ) , gutta percha ( 45 80 ) ( q3 ) , ed ta ( q3 ) , ball burnisher ( q3 ) , plugger ( q3 ) , temporary filling material ( q3 ) , root canal sealer ( q3 ) , ultra voilet cabinet ( q3 ) , sodium hypo chloride 3% 500ml ( q3 ) , suction tip ( q3 ) , formocresol ( q3 ) , airoter ( q3 ) , lignocaine 2% ( la ) ( q3 ) , straight bur ( q3 ) , round bur ( q3 ) , inverted cone ( q3 ) , tapered fissure ( q3 ) , pear shaped ( q3 ) , composite finishing bur ( q3 ) , plastic filling instruments ( q3 ) 1 35 total quantity : 1339...

Indian Army - Jharkhand

38043713 bids are invited for stationary items a4 paper century 75gsm , fs paper century 75gsm , reynolds trimax pen 70 x blue, red x 10 , reynolds refill trimax pen 85 x blue 15 x red , pilot pen 30 x v7 blue 05 x v5 green and 05 x v5 black , paper clip oddy , flag color tri colour oddy , luxor cd dvd permanent marker blue and black , pencil soft natraj , t p cello tape 1 inch , t p cello tape 2 inch , cello tape green , tag small white superior qlty , reynolds pen 50 x blue 25 x red 25 x black , glue stick large , white bd marker pen all blue black green and red , cloth lined envelope 12 inch x10 inch yellow file size , cloth lined envelope 10 inch x 08inch yellow a4 , register 200 pages , register 300 pages , stapler pin no 10 , cd envelope , sutli , pencil cell small , calculator , erasers , fevicol , ink pad , ink for pad , photopaper , highlighter , sharpener , pencil cell medium , bond paper for acr and discharge book , do pads , blade for cutter , heavy duty stapler for folder binding alongwith pins , clipboard , scissors , uniball pen ub 157 red and green , stapler small , spiral binding small and large , whitener or correction pen , binder clip 19mm , binder clip 25mm , binder clip 41mm , binder clip 32mm , scale , envelope small size total quantity : 5509...

South Eastern Railways - Jharkhand

38023058 procurement of scissors lift table for use of c&w / adtp under renovation of sickline for wagon component rehabilitation facilities.technical specification as per annexure 1. [ warranty period: 30 months after the date of delivery ] ...

Health Medical Education And Family Welfare Department - Jharkhand

38019979 bids are invited for supply of products for h. w. c ( q3 ) dressing drum with lid n mattress 72335x zp digital blp machini near vision chart foot step double rubier top powder coated 45x45x45cm pillow pillow cover adult hospital blanket baby fursoft blanket disposable mask 3ply caps disposable floor moping stick hand towel kelly sapo weight machine iniant pocket fetal doppler sterilised gloves size 4&7 wall clock adult stethoscope digital thermkineter gauze cutting scissors wexht machine adult glass hwc stregth ening measuring tap metal snellens vision chart stadiometer cheatle forceps dressing tray with lid xo ss tray with cover 12xxx2 inch artery forceps sims specullum medium cord cutting scissor l bowl for antiseptic loton 4 kidney trays mall 6 kidney tray big 1...

South Eastern Railways - Jharkhand

37968297 supply of self propelled scissor lift, supply, installation, testing and commissioning of self propelled scissor lift as per specification attached in annexure a1.make : godrej, mt&t or equivalent. [ warranty period: 30 months after the date of delivery ] ...

State Livelihood Promotion Society - Jharkhand

37951780 supply of office stationary items , name of the ststioneryitems : , copy long size (11.7 x 8.3) with 160 pages good quality , copy long size (11.7 x 8.3) with 100 pages good quality , copy long size (11.7x8.3) with 50 pages good quality , ball pen (black/blue) , ball pen (blue) use in through , cellotape good quality , chart paper different colour good quality , fevi stick (75 gm) , fevicol 100gm good quality , gum bottle , highlighter pen good quality , paper clip good quality , pencil dark black (hb) good quality , pencil eraser good quality , pencil sharpener good quality , permanent marker pen (black/blue) good quality , a4 paper (70 gsm) 01 rim of 500 pages good quality , a4 paper (75 gsm) 01 rim of 500 pages good quality , plastic folder good quality , register long (38x25 cm)with 72 pages good quality , register long (38x25 cm)with 120 pages good quality , register with 200 pages (38x25cm) good quality , register with 240 pages (38x25cm) good quality , scale 30cm glass good quality , stapler (big) , stapler pin (big 24/6) , stapler (10 no.) , stapler pin (no 10) , white board marker pen good quality , writing pad (25 cm x 18.5 cm with 50 pages) good quality , writing pad (25 cm x 18.5 cm with 100 pages) good quality , calculator 12 digit good quality , special cloth cobra file (index) , plastic arch file (index) good quality , arch file (index) good quality , spring file good quality , double punching (big) good quality , double punching (smal) good quality , single punch good quality , liquid eraser pen good quality , paper cutter knife with blade good quality , stamp pad ink(blue/black/violet) good quality , tag (long+small) good quality , paper weight good quality , notic board pin good quality , sketch pen (pkt. of 12 pcs.) good quality , note sheet (green sheet a4 size) 70 gsm, 50 pages good quality , paper flag good quality , chesal marker good quality , double guming tap , stamp pad (small) good quality , stamp pad (big) good quality , cd marker pen good quality , cash book register fullscape size, double column, no 03 good quality , envelop (10x8) inch good quality , scissor small good quality , scissor big good quality , brown tape 2 inch with 65 meter length , plastic stick file good quality , tag file/leafe file good quality , note ped normal rulling good quality , note ped spiral rulling good quality , safty pin good quality , paper pin good quality , white board clip big good quality , white board clip small good quality , envelop a4 size good quality , fixed assets register standard good quality , stock register standard good quality , attendance register normal , attendance register standard good quality (time of arival & time of departure) , pokar good quality...

Airports Authority Of India - Jharkhand

37919395 bids are invited for general stores items 1 58 add gel pen , index file , ball pen black , ball pen red , ball pen blue , battery aa , battery aa a , black board duster , board marker pen blue , board marker pen black , board marker pen red , board file , board pin , both side pen , brown packing tap 2 inch , calculator , carbon blue , cello gel alpha refill , cello tape medium 1 inch , cello tape medium 2 inch , collin spray 500 ml , correction pen erase x , cup and plate set , hand wash , dustbin , detergent powder , duster white 24inch by 24 inch , duster yellow 24inch by 24 inch , file folder plastic with clip , punching machine double , punching machine single , file tray sample , four folder dak file , gel pen blue , gel pen black , gems clip , bottle , paper weight , glass tumbler , glue stick , good night liquidator , good night machine , gum bottle 300 ml , highlighter pen , cockroach, mosquito killer spray 310 ml , key purse lather , knife paper cutter , lock small 6 liver 60 no , lock small 6 liver 45 no , permanent marker black , permanent marker cd pen , permanent marker blue , odonil , paper flap stick file , paper clip big , paper clip small , pencil cutter , pencil eraser , pencil , pen stand , pen drive 64 gb , plastic stick file , pin cousin , poker , refill black 1500 , refill blue 1500 , refill red 1500 , register no 10 lp , register no 12 lp , register no 4 lp , register no 6 lp , register no8 lp , room freshener , scale steel 12 inch , scale plastic 12 inch , serving tray , scissor medium , soap bath 100 gm , stamp pad , stamp pad ink 500 ml , stapler big , stapler pin big , stapler pin small , stapler small , tag 8 inch , tea coaster , vim liquid 250 ml , water jug , water sponge , wall clock modem size total quantity : 12440...

South Eastern Railways - Jharkhand

37915512 auction sale of 21 (a) u/s & scrap 60 kg cms crossing (1 12), (b) u/s & scrap 60 kg cms croxxing (1 8.5), (c) u/s & scrap 60 kg ht crossing (1 12), (d) u/s & scrap scissors crossing obtuse 90r, (e) u/s & scrap 52 kg cms xing (1 12)...

Department Of Revenue - Jharkhand

37900613 bids are invited for stationery items proucrement xerox paper jk red , legal size jk red xerox paper , gel pen blue , pen , pencil , paper flag , stepler small , stepler pin small , stepler big , stepler pin big , file binder , file facing , celo tape , conferance pad , favi stick , buttom file , stick file , scissors file , note pad , marker pen , pen gel balck , pen trimax , pen gel red total quantity : 8290...

Health Department - Jharkhand

37890677 rate contract for instruments at sadar hospital deoghar , items : , baby warmer machine , stainless steel abdominal hysterectomy set , n.s.v set(s.s) , g.v set , self abdominal detractor , m.t.p set. , vaccine carrier (small size) , x ray digitalisation with high end cr system (with installation & 1 yers. warrenty) console software with mulitmodality work station the cr system should have advances workstation provided with 17 high resolution monitor, keyboard & ouse, with the fol. , digital ultrasound machine colour dopler(high resolution ) with 4 probe , eye checkup machine , auto analyzer , hotair oven , binocular microscope , centri fuge machin , micropipette (0 50 microliter) , micropipette (0 500 microliter) , micropipette (0 1000 microliter) , microtips(0 50 microliter) , microtips(0 1000 microliter) , bed side screen with cloth1round pipe with wheel , sponge holding 8 , sponge holding 6 , artery forceps 6 curved , artery forceps 6straight. , artery forceps 8 curved , artery forceps 8straight. , artery forceps 4straight. , alliys tissue forcep 8 , mosquito forcep 6 , scissor 6 curved , scissor 6 straight , scissor mosquito straight. 5 straight , diatheromy (machine) , laparoscopic instrument , needle holder 8 curved , needle holder 8 straight , needle holder 6 curved , needle holder 6 straight , needle holder 4 curved , needle holder 4 straight , doner couch (3 motor) , blood weighting mechine , digital bp mechine , blood band refrigerator (300 bag) temp.display outside , elisa mechne e printer. , blood collection monitor (with battery backup) , boyls appratus , gas pipe line n2o , gas pipe line o2 , electral dental chair 1.should be electricly operated with zero programme. 2. should have a switch operated operating light with minimum 2 steps of intensity control. 3. should have a auto water connection for spitoon, and tumbler with auto filling senssor. , detal forcep set , detal cortraie machine , infusion pam machine , bed side trolly table , patient table , ecg machine 12 leading , dressing table with instrument , alice tooth forcep , alice plane forcep , plane forcep , sponge holding forcep , b.p blade. , artery forcep curved , artery forcep plane , stitch cutting night. , scissor curved , scissor plane , multiparamoniter , table sterilazation machine , pulse oximeter (table top) bulit in rechargeable li polymer battery for uniterrupted monitorig compact and flexible appearance, easy and be suitable fo indoor and outdoor(in ambulnce monitoringwith user friendly interface disply , syringe pump , foetal doppler , refrigerater 290 ltr. , blood warmer machine , airpurifier , allis tissue , artery forcep (long) , tooth forcep , needle holder , sponge holder , bp handle , scissor straight , allies tissue forceps 6 (tungston carbide coated) german. , ambu bag (adult) , ambu bag (baby) , artery forceps 4 curved (tungston carbide coated) german. , artery forceps 5 curved (tungston carbide coated) german. , artery forceps 7 curved (tungston carbide coated) german. , artery forceps curve 140 mm 180 mm(german) , artery forceps straight 140 mm 180 mm(german) , auto reflectometer with table , doyens retractor , b.p. holder , bad pan plastic , bauel 10 , bed side locker , bed side screen with curtain. , boils appratus with gas clinder , boul stand. , bowl, metal, sponge, 600 ml. , bp instrument (diamond) , bp instrument dial , bp instrument digital , bp instrument stand(diamond) , cardiac monitor , cord cutting scissor(tungston carbide coated) german. , curved cutting needle (tungston carbide coated) german. , diathermy , dilator utrenne double , dressing table , dressing tray with cover 310* 200* 600 mm ss , drug trolley , drum , steritizing cylindrical 275 mm dies 132 mm (dressing drum) , drum stand clinical , g.v set , electricauto clave big3 drums , electric auto clave medium 1 drum , electric auto clave medium 2 drums , electric hub cutter big , electric instrument strlizer , electric needle cutter , electric sterlizationbig , electric sterlization medium , electric sterlization small , episiotomy or curved scissor , episiotomy scissors 6 (tungston carbide coated) german. , episiotomy scissors 8 (tungston carbide coated) german. , examination table , femaly planning operation scissor set. 01 set. , feotoscope , flower bed 18 mm steel. , foammattress for labour table , food trolly big wheel , foot step , forceps hemostatic, halsteads mosquito strcight, 125mm ss (german) , forceps obstetiric, wrigleys 280 mm, stainless stand (german) , forceps uterine neleton solid tip one eye (german) , forceps vulselium dubty borble carved 280 mm ss (german) , forceps, spongs holding, 228 mm(german) , froceps, bucplaus towel, 130 mm(german) , glucometer , hospital bed 18 mm steel. , hospital bed with adjustable back rest 18 mm steel. , hub cutter big , hub cutter small , hydraulic ottable , hydrocele operation scissor set 01 set. , hysterectomy operationset 01 set. , self abdominal detectorset , auto clave (big. verticle) , eye checkup machine , cbc machine (5 part blood cell counter machine) 1. should have throughput 50 samples/hour 2.system should use cation exchange hplc principle for estimation of stable a1c. 3. system should have built in computer with the system software and must be able to work independent of exte. , m.t.p set. , i.v. stand , ilr medium with stabilizer , infusion pump , ingramometermeasures , kidney tray (big) , kidney tray (medium) , kidney tray (small) , knife blade surgicalsize 11, 15 for minor surgery , knife blade surgicalsize 22 no.for major surgery . , knife handel surgical for minor & major surgery 3 & 4(german) , labour table , larengoscop adult , larengoscop child , ledo.t light single dome dia 22 no. led 48, linght intensity 100000 lux, +10%, cri>90, colour temperature>4300k, life of led minimum 50000 working hours. , no of dome heads 4, fully laminar flow compatible disigned dome. , lifter , matress for examination table , mattress for bed , mayos scissors 5 curved(tungston carbide coated) german. , mayos scissors 5 straight (tungston carbide coated) german. , mayos scissors 7 curved (tungston carbide coated) german.. , mayos scissors 7 straight (tungston carbide coated) german. , mosquito artery forceps curved (tungston carbide coated) german. , mosquito artery forceps straight (tungston carbide coated) german. , multi para monitor , nebuliser , needle holder , needle holder big (tungston carbide coated) german. , needle holder mayo strainght, nagrouthaw, 175 mm ss (german) , needle holder small (tungston carbide coated) german. , needle suture round body 3/8 circle no. 12 , needle suture triangular point size 7.3 , o.t light mutible double dome72 led, 130000 lux, central focusing focus point 15cm, penentrapion depth 8 10 intensity controlar. , oxygen concentrator , oxygen cylinder regulator , oxygen cylinder , oxygen trolley , oxygen key , oxygen maskadult , oxygen mask child , plain forceps 7 (tungston carbide coated) german. , pump sunction , radient warmer , revolving sitting stool , round body needle , rubber sheat , sahlis hemolglobinometer. , scissor big(gauge+ bandag cutting) , scissor opreting curved mayo blunt pointed 17 mm german. , semi follower bed 18 mm steel. , shadowless lamp led , souce pan with lid. , sound uterine simpson 300 mm (german) , sound uterine simpson blunt (german) , sponge holder 5straight(tungston carbide coated) german. , sponge holder 5curved (tungston carbide coated) german. , stethoscope diamond(adult) , stethoscope diamond(child) , stitch removal scissors 6 (tungston carbide coated) german. , stitch removal scissors 8 (tungston carbide coated) german. , stretcher folding , stretcher on trolleybig wheel 5.5 , stritch cuttingscissor , stritch removing instrument (eye) , suction machineelectric with pump power supply 230 240 volt, 50hz, vaccum capiity 18 lter./ mini max. depression 75 kpa( 263hg.) vaccum is created by a plastic piston and cylinder system with four vaccum creating modules. , thermometer digital , tooth forcep big , tooth forcep medium (tungston carbide coated) german. , tooth forcep small (tungston carbide coated) german. , towel clips forceps , tray, instruned cover, 310, 200, 600 mm ss , tube sealer (solid statef) , urine pot steel. , utrain sound , weighing machine for adult , weighing machine for child (electronic) , wheel chair , durm, sterilizing cylindrical (275 mm oiax 132 mm ss as per is) , tcdc count apparatus , esr stand with tubes , test tube stand , test tube rack , test tube holders , spirit lamp , sami auto analiser (with installation(specifications attached) , hydrolic stretcher on trolly big wheel...

Health Department - Jharkhand

37890672 rate contract for stationary items at sadar hospital deoghar 1 2 , pepper peen packet 100 grams ( packet ) register per jista ( ajanta ) carbon chorus ( packet ) tag ( bunch ) computer paper ink pad piece blue, black, red century a 4 ( packet ) , fs ( packet ) envelope small ( bundle ) envelope large ( bundle ) flay leaf good quality per piece, office name printed | fly leaf plastic coat per piece with office name printed on it. happened . guard file per piece | file general per piece plain envelope 09x04 plain envelope 07 x03 cloth coated envelope 12x08 , fabric coated envelope 14 x 10 calculator 12 digit calculator 14 digit cover file per piece gound 700, 7.50 ml per piece plastic mug per piece plastic bucket 15 liters per piece call bell electricity per piece call bell general per piece pan stand 4 pieces per piece , takua piece per piece knife piece per piece blades per packet , paper weight glass per piece button file per piece index file per piece steak filet per piece , cello tail 2 inch per piece | cello tail 1 inch per piece , godrej lock small per piece , godrej lock big per piece stapler small per piece , stapler large per piece , punching machine per piece note book per piece sponge per piece 43 44 , fabi cuke per piece , highlighter per piece 45 , plastic mesh tray per piece 46 plastic tray per piece 47 train log book copy 48 umbrella k.c. paul per 49 scissors big per piece 50 scissors small per piece 51 , steel tray big per piece 52 , fiber tray large per piece 53 , steel trunk 3 x 2 x 2 per piece 54 remote call bell per piece 55 issue register per batch 56 , input register per batch all out machine per pics 57 58 all out liquid per pics 59 phenyl pellets per kg 60 | per bathroom brush 61 , odonil big per piece 62 |room freshener per 63 , thermos 1 liter per milton gadi towel big size per piece 64 65 , curtain fabric best quality per piece 66 | quick heal total sequrity 1 year 1 user per pics. 67 68 tvs gold keybord per pics. hp mouse with wire per pics. 69 hp wireless mouse per pics. 70 hp wireless keyboard per pics. hp keyboard with wire per pics. 71 72 |u.p.s ( microtek 1000 va ) for peaks. 73 |u.p.s battery ( microtek 1000 va ) per pics. 74 |u.p.s ( microtek 600 va ) for peaks. 75 |u.p.s battery ( microtek 600 va ) per pics. 76 , cup dis china per packet 77 , coconut flakes per kg 78 79 , eveready torch 2 cells per piece | eveready torch 3 cells per piece 80 , eveready pacil battery per piece 81 life buoy soap big per piece 82 , life buoy soap small per piece 83 84 , red cloth per meter 85 dust bean ( colour coted ) small, per pcs. , bucket iron 12 per piece 86 , plastic wiper small per piece 87 , plastic wiper large per piece 88 , table glass / square feet 4mm , table glass / square feet 8mm | lime 10 kg gammaxine 10kg , acid 1 liter jar , harpic per liter handwash per liter , electrical wire 2.5 mm copper per coil electrical wire 04 mm copper per coil , electrical wire 06mm copper per coil simple dot pen copy , register 01 batch without cover. gel pen ( laser pilot hi tech v 7 ) highlight pen plastic chair armless copy | plastic chair with arm per , wall clock with room temperature , per bag strainer shisha glass four pieces , plasti jar 20 liters per piece , pvc pipe per feet , 20 liters per piece with ro chiller 50 liters per piece with ro chiller , stapler peen small per packet stapler pin large per packet , plain paper full scape per rim ajanta , plain paper double full scape ajanta cott per pen drive 16 gv copy pen drive 32 gv copy | computer blank cd ( sony ) copy , counter size table 5 x 3 per ( godrej ) , table 4 x 3 per ( godrej ) | almirah bada per 18 mm steel ( godrej ) , almirah small per 18 mm steel ( godrej ) inbeater 1.5 k. too. per 180 ah per battery tubular even for inheater 1.0 , plastic 3 seater per chair steel 3 seater chair per ( godrej ) revolving chair per ( godrej ) 129 , computer set all in one 20 inch per , computer table per piece ( godrej ) , halogen light led per piece bed sheet 7 x 4 per piece all colors chadar 6 × 4 per piece all colors per piece with pillow cover lock link large copy lock link short copy , stock register per lot 138 cash book per installment 139 | attendance register copy 140 wall fan copy 142 notice board per sq. feet with net. 143 a.c. 2 ton per pcs. with installation. 144 a.c. 1½ ton per pcs. with installation. 145 led bulb 09 watt per pcs. 146 led bulb 12 watt per pcs. 147 led bulb 15 watt per pcs. 148 led bulb 22 watt per pcs. 149 plastic torch 3 cell per pcs. 150 plastic torch 2 cell per pcs. 151 steel rack6x3 per pcs. heavy ( godrej ) 152 office chairper pcs. ( godrej ) 153 led vapor lighat.per pcs. 154 ceiling fan.per pcs. 155 dustbin 30 liter. color coted all color per pcs. 156 dustbin 60 liter. color coted all colorper pcs. 157 dustbin 40 liter. color coted all colorper pcs. 158 hp laser jet1020 plus toner cartridge 159 8 channel cctv, dvr, screen, with compleate accessories & instalation. 160 garbage all size / per k.g. biowaste all colour. 161 room heater. per pcs. 162 computer scanner. per pcs. 163 rechargebul lamp. per pcs. 164 exhost fan. per pcs. 165 domestic freeze 175 ltr. per pcs. 166 duble door freeze 230 ltr. per pcs. 167 timer stop watch. per pcs. 168 insect killer. machine. per pcs. 169 estabilizer 2kva ( automatic ) per pcs. 170 estabilizer 4kva ( automatic ) per pcs. 171 foging machine per pcs. 172 fooging machine liquide 5 liter jar. 173 gayser 25 liter. per pcs. 174 lcd at waiting hall 42 ( smart ) per pcs. 175 baby balankets. per pcs. 176 blanket. per pcs. 177 drum with tap for storing water 30 liter. per pcs. 178 towel big. per pcs. all colour 179 towel small.per pcs. all colour 180 curtain with rods ( per miter ) 181 tube light. set led per pcs. 182 gown opration cotton. per pcs. 183 eraser 184 printer inkjet with tankepson.l4260 185 odonil small per pcs. 186 room freshner per pcs. 187 bed side screen with curtain per pcs. 188 sleeper no.7, 8, 9 per pcs. pair. 189 rubber shoe no. 7, 8 per pcs. pair. 190 apron alastic per pcs. 191 apron white cloth. per pcs. 192 5 shoket board for computer. per pcs. 193 patient apron. per pcs. 194 a4 size paper printing cost ( 1000 pcs. ) 195 flex benner printing coat per sq. fit. 196 i.card printing cost per. ( with ribbon ) 100 pcs. 197 poster printing costper sq. feet. 1000 pcs. with hanging 198 canon xerox machinecartridge npg 59 199 epson eco tank l4260 printer ink. all colour set. per pic. 200 glue stick big. 201 glue stick small 202 torch battry big per pcs 203 pencile battryper pcs 204 remote battryper pcs...

Rural Works Department - Jharkhand

37816730 bids are invited for requirements for u hwc furniture & fixtures 1 patient bed 2 patient bed mattress 3 pillow 4 pillowcover 5 bedsidelocker 6 blanket 7 revolving stool steel 8 examination table 9 foot step 10 bed sheet 11 wheel stretcher 12 wheel chair 13 officetable 14 plastic chair 15 15 office chair 16 3 seater running chair steel 17 almirah 18 iron self rack 3 fold bedside screen with curtain stand 19 20 1ed tube light 21 led bulb ( t shape ) 22 ceiling fan 23 wall fan 24 2 battery+inverater 25 water purifier 26 refrigerator ( 3 star ) 27 air conditioner 28 stablizer v guard 29 aio desktop computer 2 register 6 3 register 10 4 register 12 sscessior medium 6 scessior small 7 scissor big 8 a4 paper white 9 10 pen fly leaf 11 stapler with pin small 12 stapler with pin big 13 punching machine 14 paper weight 15 wall clock 16 stamp pad medium blue 17 fevi stick big 18 plastic scale 19 link lock 45 20 link lock 50 21 link lock 55 22 opd register 23 opd slip 24 attendance register 25 stock register 26 visitor register / book 1 floor wiper rubber floor wiper jut 2 3 door mat 4 harpic 1 ltr. 5 colin spray 6 7 broom ( phul ) broom ( nariyal ) 8 phenyl 9 phenyle goli 10 dustbin with cover 11 plastic bucket big 12 plastic bucket medium 13 plastic bucket small 14 plastic mug colour coded bin ( waste 15 disposablebuckets ) set of 5 coloured bucket 16 garbage poly bag black ( 10 kg. ) 17 garbage poly bag red ( 10 kg. ) 18 hand wash liquid 19 hand wash soap 20 water bottle 1 ltr. 1 bp machine digital 2 bp machine mercery 3 digital gulocmeter 4 digital hemogobinometer 5 thermometer digital 6 |weight machine adult 7 weight machine infant 8 stethoscope 9 hub cutter 10 medicine tray 12 cotton roll 13 |leukoplast tap 1.25 cm 14 leukoplast tap 5 cm 15 iv stand 16 gloves 6.5...

Health Department - Jharkhand

37751530 group c rate contract for medicine,instrument and consumables items at sadar hospital garhwa rate contract for medicine,instrument and consumables items at sadar hospital garhwa , items : , amitriptylline tab (10 mg) , amitriptylline tab (25 mg) , act kit (adult) , act kit (9 14 years) , act kit (5 8 years) , act kit (1 4 years) , act kit (less than 1 years) , acyclovir tab (200mg) , acyclovir tab (400mg) , acyclovir tab (800mg) , atrovastatin (5 mg) , atrovastatin (10 mg) , atrovastatin (20 mg) , anticold tab , amitryphylin tab (10 mg) , amitryphylin tab (25 mg) , acetyl salicylic acid tab (300 mg) , acetyl salicylic acid mouth dissolving tab (75 mg) , albendazole tablets (400 mg) , alprazolam tablets (0.25 mg) , aluminium hydroxide + magnesium hydroxide tablet (400 mg+400mg) , amlodipine tablets (2.5 mg) , amlodipine tablets (5 mg) , amlodipine tablets (10 mg) , amoxicillin 125 mg dt , amoxicillin 250 mg dt , amoxicillin capsules (250 mg) , amoxicillin capsules (500 mg) , amoxicillin + clavulinic acid tablets (375 mg) , amoxicillin + clavulinic acid tablets (625 mg) , ampicillin, capsules, (250 mg) , ampicillin, capsules, (500 mg) , ascorbic acid chewable tablets, (vitamin c 500 mg) , atenolol tablets (25 mg) , atenolol tablets (50 mg) , atorvastatin tablets (10 mg) , atorvastatin tablets (20 mg) , azithromycin tablets (250mg) , azithromycin tablets (500mg) , aceclofenac + pcm tab (100 mg + 325 mg) , antispasmodic tab (dicyclomine 20 mg + pcm 325 mg) , bupropion tab (150 mg) , betamethasone tab (0.5 mg) , bisacodyl tab (5 mg) , clonazepam (0.5 mg) , captopril tab (25 mg) , captopril tab (50 mg) , calcium carbonate + vitamin d3 tablets (500 mg) , calcium carbonate + vitamin d3 tablets (250 mg) , carbamazepine tab (100mg) , carbamazepine tab (200mg) , carbamazepine tab (400mg) , cefixime 50 mg dt , cefixime 100 mg dt , cefixime 200 mg tab , cetrizine10mg tab , clopidogrel tab (75 mg) , cephalexin125 mg dt , cephalexin capsules (250 mg) , cephalexin capsules (500 mg) , chloroquine phosphate tab (250 mg) , chloramphenicol cap (250 mg) , chloramphenicol cap (500 mg) , ciprofloxacin hcl tab (250mg) , ciprofloxacin hcl tab (500mg) , ciprofloxacin hcl 500mg + tinidizole 600 mg tab , clotrimazole veginal pessary , co trimoxazole pead. tab (trimethoprin 20 mg + sulphamethoxazole 100 mg) , co trimoxazole ss tab (trimethoprin 80 mg + sulphamethoxazole 400 mg) , co trimoxazole ds tab (trimethoprin 160 mg + sulphamethoxazole 800 mg) , chlorthalidone tab (6.25 mg) , chlorthalidone tab (12.5 mg) , cholecalciferol cap (60000 iu) / cap , cpm tab (25mg) , cycloserine tab (250 mg) , carbamazapine tab (200 mg) , dexamethasone tab (0.5 mg) , digoxin tab (0.25mg) , dicyclomine tab (10 mg) , dicyclomine tab (20 mg) , diclofenac sodium + pcm tab (50 mg + 325 mg) , diclofenac 100 sr tab , diclofenac sodium tab (50 mg) , doxylamine succinate 10mg + pyridoxine 10mg tab , di ethylcarbamazine tab (100 mg) , domperidone tab (10 mg) , doxycycline capsule (100 mg) , dizepam tab (2 mg) , dizepam tab (5 mg) , drotavintab (40 mg) , enalapril tab (2.5 mg) , enalapril tab (5 mg) , enalapril tab (10 mg) , escitalopram oxalate tab (10 mg) , erythromycin tab ( 500 mg) , erythromycin tab ( 250 mg) , erythromycin 125 dt , ethamsylate tab (250 mg) , ethamsylate tab (500 mg) , ethiophylin + theophylin tab , ethambutol tab (400 mg) , ethambutol tab (800 mg) , escitalopram tab (10 mg) , fluoxetine tab (2 mg) , famotidine tab (20 mg) , famotidine tab (40 mg) , ifa tab (l), 100 mg elemental iron + 500 mcg folic acid (red & blue) , ifatab (s), 30 mg elemental iron + 250 mcg , ibuprofun tab (200 mg) , ibuprofun tab (400 mg) , ibuprofun + pcm tab , fluconazole cap/ tab (150 mg) , folic acid tab (5 mg) , frusemide tab (40 mg) , glibenclamide tab(5 mg) , glyceryl trinitrate sublingual tab (0.5 mg) , griseofulvin cap/ tab (250 mg) , glimepride tab (1 mg) , glimepride tab (2 mg) , glimepride tab (3 mg) , glimepride tab (4 mg) , haloperidol tab , hydrochlorothiazide tab (12.50 mg) , hydrochlorothiazide tab (25 mg) , isoniaziazid tab (300 mg) , isosorbid mononitrate tab (10 mg) , isosorbid mononitrate tab (20 mg) , isosorbid mononitrate sr tab (60 mg) , levofloxacin tab (500 mg) , levothyroxine tab (0.05mg) , levothyroxine tab (0.1mg) , levocetrizine tab (5 mg) , labetolal tab (100 mg) , lenezolid tab (600 mg) , lorazepam tab (2 mg) , lithium carbonate tab (300 mg) , metoprolol succinate er tab (25 mg) , metoprolol succinate er tab (50 mg) , metoprolol succinate er tab (100 mg) , methyldopa tab (250mg) , moxifloxacine tab (400 mg) , montelucast 5 mg tab , montelucast 10 mg tab , montelucast + levocetrizine tab (10 mg + 5 mg) , metformin tab (500 mg) , metformin sr tab (500 mg) , metformin sr tab (1000 mg) , methylcobalamin tab (1500 mcg) , mifepristone tab (200 mg) , misoprostol tab (200 mg) , mma drug kit (mifepristone 200 mg + misoprostol 200 mg) , mefloquin tab (250 mg) , metronidazole tab 200 mg , metronidazole tab 400 mg , multivitamin cap , multivitamin tab (as per schudle v of f& c)) , n acetyl cysteine effervisent tab (600mg) , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 7 mg , nicotine patch 14 mg , nicotine patch 21 mg , olanzapine tab (10 mg) , omeprazole cap (20 mg) , omeprazole + domeperidon cap (20 + 10) , ondencetron tab (4 mg) , ofloxacin dt (100 mg) , ofloxacin tab (200 mg) , ofloxacin tab (400 mg) , ofloxacin + orinidazole tab (200 + 500 mg) , oseltamarir 75 mg , pyridoxin (100 mg) , pyrazinamide tab (500 mg) , pyrazinamide tab (750 mg) , pioglitazone tab (15 mg) , polyvitamin tab , paracetamol kid dt (125 mg) , paracetamol tab (250 mg) , paracetamol tab (500 mg) , paracetamol tab (650 mg) , paracetamol sr tab (1000 mg) , pantoprazole tab (40 mg) , pantoprazole + domperidone tab / cap , phenobarbitone tab (30 mg) , potassium chloride tab (600 mg) , potassium chloride tab (750 mg) , potassium chloride tab (1500 mg) , primaquine tab (2.5 mg) , primaquine tab (7.5 mg) , primaquine tab (15 mg) , prednisolan tab (5 mg) , prednisolan tab (10 mg) , prednisolan tab (20 mg) , prednisolan tab (30 mg) , prednisolan tab (40 mg) , promethazime tab (25mg) , quinine sulphate tab (300 mg) , risperidone + trihexyphenidy1 (2 mg) , ranitidine tab. (150 mg) , ranitidine tab. (300 mg) , ranitidine + donperidone tab , rabiprazole tab (20 mg) , rabiprazole + domperidom tab / cap , salbutamol sulphate tab (2 mg) , salbutamol sulphate tab (4 mg) , sodium valpourate tab (200 mg) , trihexyphenidy1 tab (2 mg) , telmisartan tab (10mg) , telmisartan tab (20mg) , telmisartan tab (40mg) , telmisartan tab (80mg) , tranexamic acid cap (500 mg) , tranexamic acid + pcm cap , tinidazole tab (500 mg) , tramadol cap (100 mg) , tramadol + pcm cap , verapamil tab (80 mg) , vitamin a cap (200000 iu) , vitamin a&d cap (vit a 5000 iu+vit. d3 400 iu/cap) , vitamin b complex , vitamin d3 satchet (1 gms) , vitamin b 12 , zolpidem tab (10 mg) , zinc tab (20 mg) , zinc tab (50 mg) , amphotericin inj (20 mg) , amlodarone inj(3 ml) 50 mg / ml , avs inj (anti venoum snake) lypholised , anafortan inj (2ml) , anti rabbies inj (multi dose with 5 syringe) , phenermine meleate inj (2ml) 22.75mg / ml , adrenaline bitartrate inj (1ml) 1 mg / ml , amikacin sulphate inj (2ml), 100 mg / 2 ml , amikacin sulphate inj (2ml), 250 mg / 2 ml , amikacin sulphate inj (2ml), 500 mg / 2 ml , amoxicillin + clavulinic acid inj (1,2gm) , ampicillin inj (250 mg) , ampicillin inj (500 mg) , ampicillin inj (1 gm) , atropine inj (1ml) 0.6 mg / ml , alpha beta artither inj (2ml) , artisunate inj (60 mg) , artisunate inj (120 mg) , aminophyline inj (25 mg / ml) , artracurium inj (10 mg / ml) 2.5 ml , azithromycin inj (500mg) , benzathine benzyl penicillin inj (6 lakh) , benzathine benzyl penicillin inj (12 lakh) , betamethasoneinj (2ml) 4 mg / ml , buskopan inj (20 mg / ml) , bupivacine inj (20 ml) , bupivacine inj (heavy) (bupivaccine 5 mg / ml + dextrose 80 mg / ml ) (anawin neon) , budesonide nebuliser suspension (2 ml) 0.5 mg / 2 ml respules , botropase inj (1 ml) , capnia inj (1 ml) , capnia inj (2 ml) , ceftriaxone inj (125 g) , ceftriaxone inj (250 g) , ceftriaxone inj (500 g) , ceftriaxone inj vial 1 g , cefotaxime inj (125 g) , cefotaxime inj (250 g) , cefotaxime inj (500 g) , cefotaxime inj (1 g) , ceftriaxone + salbectum inj (375 mg) , ceftriaxone + salbectum inj (750 mg) , ceftriaxone + salbectum inj (1.5g) , cefoperazone + salbectum inj (500 mg + 500 mg) , cefoperazone + salbectum inj (1000 mg + 500 mg) , cefepime inj (1 g) , calcium gluconate inj (10 ml) , carboprost inj (1 ml) 125 mcg / ml , carboprost inj (1 ml) 250 mcg / ml , chloramphenicol inj (1gm) , digoxin inj (2 ml) 250mcg / ml , clindamycin inj (2 ml) 300 mg / ml , diclofenac sodium inj (3ml)75mg / 3ml , diclofenac sodium inj (1ml)75mg / ml , dexamethasone inj (2ml) 4 mg / ml , doxycycline inj (100mg) , dicyclomine hcl inj ( 2ml) 10 mg / ml , dizepam inj (2 ml) 5 mg / ml , dopamine inj (5 ml) , drotaverine inj (2 ml) 20 mg / ml , dobutamine inj. (5 ml) (1 mg / ml) , erythropoietin inj (4000iu) , enoxaparin inj (0.4 ml pre filled syringe) 40 mg / amp , enoxaparin inj (0.6 ml pre filled syringe) 60 mg / amp , enalaprilat inj (1 ml ) 1.25 /ml , etomidate inj (10 ml) 2 mg / ml , ethamsylate inj (2 ml) 125 mg / ml , ephedrine inj (1ml) 30 mg / ml , ethiophylin + theophylin inj (2 ml) , fentanyl (2 ml) 50 mcg / ml , frusemide inj (2 ml) (10 mg / ml) , gentamicin inj (20 ml) , gentamicin inj (100 ml) , gentamicin inj (2 ml) 40 mg /ml , gentamicin inj (2 ml) 10 mg /ml , gentamicin e/e drop (5ml) , heparin (5 ml) 5000iu/ ml , heparin (5 ml) 25000iu/ ml , human premixed insullin inj 50/50 (40 mg/ml) , human soluble insulin inj (40 iu/ml) , human premixed insullin inj 30/70 (40 units/ml) , human anti d immunoglobuline (300 mcg / 2 ml) , haloperidol inj (2 ml) , halothane inj (30 ml) , hydrocortisone inj (100 mg) , haexatrin inj , haloperidol inj , iorazepam inj , ivig inj , insulin regular (10ml) 40 iu/ml , iron sucrose inj (2.5 ml) 50 mg / 2.5 ml , ketamine hcl inj (10 ml) 10 mg / ml , ketamine hcl inj (10 ml) 50 mg / ml , labetolal inj (2 ml) , levetiracetam inj (5ml) 500mg / vial , livnocain hcl inj (30 ml) 2% w/v , lignocaine + adrenaline inj (30 ml) , lignocaine heavy inj (2 ml) 5% w/v , levofloxacin inj (500 mg) , lorazepam inj (2 ml) 1 mg / ml , levosalbutamol nebulising solution (2.5 ml) 0.63 mg / 2.5 ml , levosalbutamol + ipratropium brominde nebulising solution (2.5 ml) (1.25 mg + 500 mcg) / 2.5 ml , multivatimin inj (10 ml) for infusion , metoclopramide inj (2 ml) 5 mg / ml , menadione sodium inj (0.5 ml) 1 mg / 0.5 ml , magnesium sulphate inj 500 mg/ ml , methylergometrine maleate inj (1 ml) 0.2 mg / ml , meropenam inj (125 mg) , meropenam inj (250 mg) , meropenam inj (1000 mg) , mephentermine inj (10 ml) , midazolam inj (10 ml) 1 mg / ml , methylcobalamine (1500 mcg / amp) , noradren aline inj (1 mg / ml) , neosligmine inj (5 ml)2.5mg / 5ml , oxytocin inj (1 ml) 5 iu/ ml , ondencetron inj (2 ml) 2mg /ml , promethazime inj , pentazocaine lactate inj (30 mg / ml) , potassium chloride inj (10 ml) 15% w/v , phenytoin sodium inj (2 ml) 50 mg / ml , piperacillin + tazobactum (2 gm + 250 mg / vial) , piperacillin + tazobactum (1 gm + 125 mg / vial) , piperacillin + tazobactum (4 gm + 500 mg / vial) , promethazime inj (2 ml) 25 mg / ml , pentazocin inj (1 ml) , paracetamol inj (2 ml) 150 mg / ml , phytomenabione inj (1 ml) (vitamin k1) , phenobarbitone inj (2ml) (200 mg/ml) , pantoprazale inj (40 mg / vial) , propofol 1% (10 mg / ml) , quinine sulphate inj (2ml) , rabeprazole inj (iv) 20 mg / vial , ranitidine inj (2 ml) 25 mg / ml , succinyl cholin chloride inj (50 mg / ml) , sodium bicarbonate inj (10 ml) 7.5% w/v , suxamethonium inj (2 ml) 50 mg / ml , sodium valproate inj (100 mg / ml) , sepsivac inj (0.3 ml) , sepsivac inj (0.6 ml) , toclizumab (400 mg) , thiopentone sodium inj (500 mg / vail) , teicoplanin inj (400 mg / vail) , t.t inj (0.5 ml) , t.t inj (5 ml) , tranexamic acid inj (5 ml) , tramadol inj (2 ml) , streptokinase inj (7.5 laks) / vials , streptokinase inj (15 laks) / vials , vencomycil (500 mg / vail) , vencomycil (1000 mg / vail) , vancorium inj (4 mg / 2 ml) , vancomycin inj (500 mg) , vancomycin inj (1000 mg) , vecuronium inj (2 ml) 4mg / amp , vasopressin inj (1 ml) 5 mg / ml , anticold syp (60 ml) , anticold drop (10 ml) , albendazole suspension (10 ml), 200 mg/ 5 ml , antacid syp. (170ml) , antacid syp. (megaldrate 400 mg + simethecone 20 mg / 5 ml ) , amoxicillin dry syrup (30ml) , amoxicillin dry syrup (60ml) , amoxicillin drop (15 ml) , amoxicillin + clavulinic acid syp (30 ml) , aceclofenac + pcm syp (60 ml) , azithromycin suspension (15ml) 100mg/5ml , azithromycin suspension (15ml) 200mg/5ml , antispasmodic syp (30 ml) (mefanamic acid + pcm) , antispasmodic drop (10 ml) (dicyclomine + activated diamethicone) , bethamethasone drop (10 ml) , carbamazapine syp (100 ml) 100mg / 5ml , carboxymathyle cellulose eye drop (10ml) , calcium syp. (200 ml) , calcium drop (15 ml) , cefixime dry syp. (30 ml) 50 mg / 5 ml , cefixime drop (15 ml) , cetrizinesyrup (30 ml) , cephalexin dry syp (30ml) 125 mg / 5 ml , co trimoxazole syp (trimethoprin 40 mg + sulphamethoxazole 200 mg) , chloroquine syp (60 ml) , chloramphenicol eye drop (5 ml) 0.4% , cough syp 60 ml codeinae + cpm formula , cough syp 100 ml codenae + cpm formula , cough syp(100ml), dmr + cpm formula , cough syp (60ml), dmr + cpm formula , cough expectorant (100ml) , cough expectorant(60ml) , cough syp (brohnchodialetor) (100ml) , cough syp (brohnchodialetor) (60ml) , cough drop (15 ml) , ciprofloxacin eye drop (5 ml) , clotrimazole and lidocain ear drop (10ml) , donperadon syp. (30 ml) , donperadon drop (10 ml) , enzyme syp (100 ml) , erythromycin syp (60 ml) , gentamicin eye drop (5 ml) , levocetrizine syp (30 ml) (2.5 mg / 5 ml) , moxyfloxacine eye drop (10 ml) , moxyfloxacine + dexamethasone eye (10 ml) , metoclopramide syp (30 ml) , montelucast + levocetrizine syp (30 ml) (4 mg + 2.5 mg / 5 ml) , metronidazole syp (60 ml) 100 mg / 5 ml , metronidazole syp (60 ml) 200 mg / 5 ml , multivitamin syp (100 ml) , multivitamin drop (15 ml) , iron & folic acid syp (100 ml) (ferrous salt) , ibuprofun syp (60 ml) , ibuprofun + paracetamol syp (60 ml) , ondemcetrone drop (10 ml) , ofloxacin syp (30 ml) , ofloxacin + metronidazole syp (30 ml) , ofoxacin + ornidazole syp (30 ml) , paracetamol syrup (60ml) 125 mg / 5ml , paracetamol syrup (60ml) 250 mg / 5ml , paracetamol drop (60ml) 100 mg / ml , phenobarbitone syp (100 ml) , povidine iodione gargle (100 ml) , promethagin syp (60ml) 5mg / 5ml , ranatidine syp (30 ml) , salbutamol sulphate syp (100 ml) 2 mg/5 ml , vitamin a syp (100000 iu/ml) , vitamin b complex syp (100 ml) , wax dissolvent ear drop (10ml) , acyclovir 5% cream (10gm) , anti safety lotion (100 ml) , anti safety lotion (1 l) , benzyl benzoate lotion (100 ml) , betamethasone dipropionate cream (10gm) , calamine lotion (100ml) , clotrimazole 1% cream (15gm) , chlorhexidine mouth wash (100ml) , diclofenac oint (30 gm) , diclofenac pain spray (55 gm) , fradiomycin ointment (10 gm) , gama benzine hcl lotion (100 ml) , gemtial violet 0.5% paint (30 ml ) , livenocain gelly (30 gm) , lidocaine oral gel (10 gm) , neomycin + bacitracin ointment 15 g (5 mg + 500 iu / g) , povidone iodine oint (15 gm) 5% w/v , povidone iodine soln. (500 ml) 5% w/v , povidone iodine soln. (2 litre) 5% w/v , povidone iodine surgical scrub (500 ml) , silver sulfadizine oint. (30 gm) , silver sulfadizine oint. (250 gm) , oral gel nexanox , oral gel ornigreat , tooth paste hydent pro 10gm , tooth paste sensodent k 100gm , tooth paste hydent k 100gm , ciprofloxacin i.v. (100 ml) 200 mg / 100 ml , ofloxacin i.v. (100 ml) 200 mg / 100 ml , metronidazole i.v. (100 ml) 500 mg / 100 ml , normal saline, injection, 540ml, 0.9 % , manitol 20% (100 ml) , manitol 20%, (350 ml) , normal saline, injection, 540ml, 0.9 % , paracetamol iv (100 ml) 1000 mg / 100 ml , sodium chloride (100 ml) (3% w/v) , levofloxacin iv (100 ml) , sodium chloride iv (100 ml) 0.9% w/v , dextrose 25% iv (100 ml) 25% w/v , linzolid i v 300 ml (2 mg / ml) , dextrose 5% iv (500 ml) , dextrose 10% iv (500 ml) , dextrose & sodium chloride (500 ml) (5% + 0.9% w/v) (dns) , ringer lactate inj (500 ml) as per ip , sodium chloride (500 ml) (0.9% w/v) , hemacil (500 ml) , n/2. n.s (0.45% sodium chloride) (500 ml) , isolite p (paediatric maintenance fluid) 500 ml / bottle , inj. normal saline (sod chloride) 500ml , inj.ringer lactate 500ml , chomic catgatwith needle no1 , chomic catgatwith needle no2 , chomic catgatwith needle no0 , vickryl no 1(90 cms) , vickryl no 0 (90 cms) , vickryl no 2 0 (90 cms) , vickryl no 1 with 180 cms (doubble niddle) , silk no1 (76 cms) , silk no 2 0 (76 cms) , cotton thred , silk no 3 0 (76 cms) , prolene no1 (76 cms) , prolene no2 0 (76 cms) , nylon no 2 0 (76 cms) , nylon no 3 0 (76 cms) , nylon no 1 (76 cms) , hernia mesh no 6*11cms , hernia mesh no 7*15cms , hernia mesh no 15*15cms , hernia mesh no 10*15cms , skin stapler , 3 ply mask , absorbent cotton roll , bp appratus mannualmachine , bandage than (90 cm x 16 mtr) 32 tpi clothes , b. t. set , b.p. blade no. 10 , b.p. blade no. 11 , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 , b.p. blade no. 21 , b.p. blade no. 22 , b.p. blade no. 23 , b.p. blade no. 24 , cap disposable , crepe bandage 6 , cotton roll (500 gm) net , cotton zig zag (300 gm) net , disposable syring (0.5 ml) , disposable syring with niddle (insulin) (1 ml) , disposable syring with niddle (1 ml) , disposable syring with niddle (2 ml) , disposable syring with niddle (3 ml) , disposable syring with niddle (5 ml) , disposable syring with niddle (10 ml) , disposable syring with niddle (20 ml) , disposable syring with niddle (50 ml) , disposable needle 18, 20, 22, 26 , dr morpean glucometer , electronic sphygnomanometer , elastoplast bandage , examination gloves (all size) , ecg /altura sound gelly (250 ml) , falcon tubes stand , fully digital bp machine , gluco meter with 2 years warrenty , gluco meter strip of same company , gauze than (90 cm x 16 mtr) , k95 mask , iv set , leucoplast , manual sphygnomanometer , microdrip set , nitrile gloves (all size) , plaster of paris 15 kg , plaster of paris 50 kg , pedia drip set , paper tape (size 1/2 inch) length 9 mtr/pcs , paper tape (size 1 inch) length 9 mtr/pcs , paper tape (size 2 inch) length 9 mtr/pcs , plan catheterno 6 , plan catheterno 7 , plan catheterno 8 , plan catheterno 9 , plan catheterno 10 , rylestube no 5 , rylestube no 6 , rylestube no 8 , rylestube no 10 , rylestube no 12 , rylestube no 14 , rylestube no 16 , rylestube no 18 , rylestube no 20 , surgical cap disposable , sline stand (standred quality) , surgical gloves 6 , surgical gloves 6.5 , surgical gloves 7 , surgical gloves 7.5 , surgical gloves 8 , urin bag (adult) , urin bag (pead.) , foleys catheter (2 way) no 6 , foleys catheter (2 way) no 8 , foleys catheter (2 way) no 10 , foleys catheter (2 way) no 12 , foleys catheter (2 way) no 14 , foleys catheter (2 way) no 16 , foleys catheter (2 way) no 18 , foleys catheter (2 way) no 20 , foleys catheter (2 way) no 22 , foleys catheter (2 way) no 24 , forcape size 6’x 8’ , three way cannula , iv cannula (18 no) , iv cannula (20 no) , iv cannula (22 no) , iv cannula (24 no) , iv cannula (26 no) , weighing machine (digital) , weighing machine (mannual) , scissors size 6’x 8’ , bti(for polluted & non polluted water) , covid 19 detection amphification kit ( anqstrom) , jsb stain 1 (500 ml) bottle , jsb stain 2(500 ml) bottle , slide(50 pcs) box , lab wash (1 ltr bottle) , immerssion oil (25 ml) , w.b.c diluting fluid (500ml / bottle) , sodiummeta bisulfate (500 ml bottle) , v.d.r.l.(syphiline rapid test card ) , glassslide (per box) 50pcs , sodium citrate 3.8% (500ml) , uric acid kit (200ml) bottle , microablumin test strip (per test) , crp test kit (turbi) 50ml bottle , aso titre kit , hbsag kit (hepatatis b rapid test card) 1 step , hiv & syphilis combo rapid test kit , fully automated analyser cleanser chemical (100ml) , pregnancy rapid test card , refrigerator 2 8 with glass self , ra test kit (turbi) 50ml bottle , widalkit (10*4 ml) , methenol (500ml) , micro pipelte (100 to 1000ml) , micro pipelte (10 to 100ml) , micro pipette tips (20 to 200 ?l) (himedia) , micro hps (1000ml) , micro hps (100ml) , tissuepaper (per box of 100pcs) , washbottle (500ml bottle) , pricking needle (per box of 100 pcs) , glucose (1000ml bottle) , urea (500ml bottle) , creatnine (500ml bottle) , cholesterol (500ml bottle) , triglyceride (500ml bottle) , temephos , hdlcholesterol (100ml bottle) , bilrubine total (100ml bottle) , bilrubine direct (100ml bottle) , sgpt (500ml bottle) , sgot (500ml bottle) , alkline phosphate (100ml bottle) , total protein (200ml bottle) , albumine (20ml bottle) , urinestrip (2 parametor) per bottle of 100 test , urinestrip (4 parametor) per bottle of 100 test , urinestrip (10 parametor) per bottle of 100 test , edta vial (100 pcs pkd.) non vaccume tube, doubble cap , plain vial (100 pcs pkd.) non vaccume tube, doubble cap , fluride vial (100 pcs pkd.) non vaccume tube, doubble cap , centrifusemachine , blood group abo & rh (3*10ml) , hb pipette , hb tube square , bgem card (blood gas analyzer kit) , dengue ns 1 antigen kit , dnase rnase free water (himedia) , ethanol 100% (himedia) , isopropyl rubbing alcohol (100ml bottle) 68 72% v/v , isopropyl rubbing alcohol (400ml bottle) 68 72% v/v , isopropyl rubbing alcohol (5000ml jar) 68 72% v/v , 3 8% sodium litratt 500ml , fluride vial , leshmain stain , ls instruments bs 2 , ls instruments leminar airflow , ls instruments vertical auto clave (12*20) , ls instruments (80 degree) ultra low temp. freezer , ls instruments pass box , centrifuge machine (fixed angle rotoe hade) (neuation technology) , mini centrifuge machine(with pcr strip rotter) (neuation tcehnology) , n/10 hcl , ecg/ ultrasound jelly 250 ml , filter tips (qiagen) machine only 1000?l , gulcometer strip 25stp.(dr. morphen) , tetra , vtm stand (tarsons) , parafilm 2 , para film , qiagen automated nucleic acid extraction system , test tube stand (48 tubes) , labman drybath incubator , deep freezer ( 20 degree) (100 ltr) (celfrost) , vortex mixture machine (neuation) , rotar adaptor (qiagen) machine only , rtpcr machine (bio rad cfx 96) with computer system , cardboard box for falcon tube sample collection storage , cryochill vial (1.8 ml) (tarsons) , cryo vial (himedia) , mct tube (2 ml) (tarsons) , mct tube (1.5 ml) (tarsons) , qiagen pipette tips (1000 ?l) , qiagen viral rna mini kit , lab apron , micro pipette tips 1/4 universal , mct tube 1.5 ml/2ml , mct tube stand , micro pipette (thermo scientific) 100 1000 ?l , micro pipette (thermo scientific) 02 20 ?l , micro pipette (thermo scientific) 20 200 ?l , micro pipette (thermo scientific) 20 200 ?l , micro pipette (thermo scientific) 100 1000 ?l , multichannel micro pipette (thermo scientific) , micro tips 5 ml , micro pipate (variable) 1 5 ml , water bath (remi) , pyrethrum extract 2% for spare spray , ppe kit (standred size) , sprit lamp 50ml , floride ion meter , abdominal bet (small) , abdominal bet (medium) , abdominal bet (large) , ambu bag (paediatric) , ambu bag (adult) , bucket plastic brand 15 ltr , bleaching powder (25 kg bag), contains not less than 30 % w/w of available chlorine (as per i.p) , baby diaper small size , baby tawels , bio waste basket all four colours (30 ltr) , bio waste troley (set of three) , biohazard bags (red, yellow, black, blue) , c pap , disposal gown , electric cattle , fire extinguisher , five para moniter (12 screen) with peadatric wrist probe , feeding cup with spoon , glucose c or d powder (100 gm) , glucose c or d powder (200 gm) , glucose c or d powder (500 gm) , glucose c or d powder (1 kg) , hemoglobin meter , hemoglobin strip , hand wash (standred quality) 200ml , hand wash (standred quality) 500ml , hand wash (standred quality) 5 ltr. , lifebuoy soap 125gm , mug plastic brand 1 ltr , neonatal eye protector , o2 hood (all size) , ors powder 21.8 g (as per who formula) , ors powder pead 4.2 g (as per who formula) , small dustbin , sanitary pad (deluxe) / pkd of 7 pcs , sugar test strip , sugar test machine (gluco meter) (price of gluco meter & strip most be of same company) , suction machine (electric) , salbutamol sulphate inhalor (200 mdi) , sanitizer 100ml , sanitizer 200ml , sanitizer 500ml , sanitizer 5 ltr. , tub plastic brand20 ltr , towel 1.5x2.0 feet , temphos / ltr. (polluted & non polluted water) , three way cannula , mosquito fogging machine model 180p , mosquito fogging machine small size , pulse oximeter , paediatric nasal prongs (preterm 3mm, 3.5mm) , pyrethrum extract 2% space spary / liter , ventilator (neonatal) , waiting chair (3 in 1) (stainless steel) , x ray film 8x10 (green) 50 pc/ pkt , x ray film 10x12 (green) 50 pc/ pkt , x ray film 12x15 (green) 50 pc/ pkt , x ray film dental (green) 150 pc/ pkt , zeeper bag (plastic) / kg...

Health Department - Jharkhand

37709215 group a medical equipment and others at sadar hospital koderma , items : , tray instrument / dressing with cover , forceps, backhaus towel, ( 130 mm ( tungsten carbide tip anti rust quality ) , forceps, sponge holding, ( 228 mm ( tungsten carbide tip anti rust quality ) , artery forceps ( straight 140 rnrn ( titanium ) , artery forceps ( straight 180 mm ( titanium ) , artery forceps ( curved 140 rnrn ( titanium ) , artery forceps ( curved 180 mm ( titanium ) , forcep mosquito ( titanium ) , forceps, hemostatic, halsteads mosquito, straight, ( 125 mrn ss ( tungsten carbide tip anti rust quality ) , forcep lifting , forcep ppiucd , knife handle ( surgical for minor & major surgery # 3 ( ss anti rust quality ) , knife handle ( surgical for minor & major surgery # 4 ( ss anti rust quality ) , knife blade ( surgical, size 11 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 15 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 22 for major surgery ( ss anti rust quality ) , needles, suture triangular point, ( 7.3 cm ) , cheatles forceps , cuscos speculum ( medium ) , cuscos speculum ( large ) , sharp and blunt curette , ovum forceps , oral airway , needles, suture, round bodied, ( 3 / 8 circle no. 12 ) , plain forceps ( 8 ( tungsten carbide tip anti rust quality ) , tooth forceps ( 8 ( tungsten carbide tip anti rust quality ) , kidney tray ( 8 ) , kidney tray ( 10 ) , cord cutting scissor ( ss ( titanium ) , scissors, operating curved mayo blunt pointed ( 170 mm ( tungsten carbide tip anti rust quality ) , scissor operating straight ( 230 mm ( tungsten carbide tip anti rust quality ) , scissor, gauze, straight ( 230 rnrn, ss ( titanium ) , bowl, metal sponge ( 600 rnl, ref. is: 5782 ) , drum, sterilizing cylindrical ( 275 mm oia x 132 rnrn, ss as per is: ) , foetoscope , kellys pad ( for labour and ot table set ) , thermometers ( para ) , thermometers ( digital ) , b.p. instruments ( portable ) , measuring tape , glucometer , ambu bag ( baby ) ( silicon ) , sahlis haemoglobinometer , airway guedel or berman, autoclavable rubber , endotracheal catheter ( w / cuff, rubber ) , breathing tubes, hoses, connectors for item 1, ( anti static ) , tcdc count apparatus , counting chamber , esr stand with tubes , test tube stands , test tube rack , test tube holders , spirit lamp , forceps obstetric ( wrigleys, 280 mm, stainless steel ( titanium ) , speculum vaginal bi valve ( cusco medium, ( ss anti rust quality ) , speculum, vaginal, sims double ended # 3 ( ss anti rust quality ) , forceps obstetric, wrigleys ( 280 mrn, stainless steel ( tungsten carbide tip ) , forceps, vulselium, duplay double cured, 280 mm ss ( ( tungsten carbide tip ) , sound, uterine, simpson ( 300 mm with 200 mm graduations ( ss anti rust quality ) , dilator, uterine, double ended hegar ( set of 5 ( ss anti rust quality ) , curette, uterine, sims blunts ( titanium ) , anterior vaginal wall retractor stainless ( ( ss anti rust quality ) , clamp intestinal, doyen ( curved 225 mrn, ss ) , clamp intestinal, doyen ( straight 225 rnrn, ss ) , uterine elevator ( ranathlbod ) ( ss ) , bag, reathing, self inflating ( anti static rubber, set of 4 ) , b.p. instruments with stand , timer stop watch , 3 fold reclining bed manually , weighing machine baby electronic ( 5 kg capicity with fiber tray ) , fetal monitor ( ctg monitor ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ecg machine ( 12 chennel ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , semi auto analiser ( with installation ) ( specification should be attached in technical bid turms & condition ) , micro scope binoculor ( with installation ) ( specification should be attached in technical bid turms & condition ) , cardiac monitor with defribillator ( with 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , cardiac table , oxygen cylender stand with trolly , auto clave ( elec. ) dubble drum 6x12 , b.p. instrument digital , electronic strailiser 6x8 , electronic straliser 8x10 , electronic straliser 10x12 , auto clave ( elec. ) dubble drum 4x10 , dressing drum small 9x9 , dressing drum big 12x15 , dressing drum big 9x11 , dressing drum big 12x17 , delivery table ( 72x24x3 ) power coated , ambu bag silicon adult , electric strailiser foot oprated big , fetal doppler machine digital , fetal doppler machine table model , thump forcep with tooth ( titanium ) , thump forcep without tooth ( titanium ) , straight cocker ( titanium ) , curve cocker ( titanium ) , green armittage ( titanium ) , alis forcep 6 ( titanium ) , alis forcep 8 ( titanium ) , outlet forcep ( titanium ) , kocchers forcep ( titanium ) , tissue forcep 6 ( titanium ) , tissue forcep 8 ( titanium ) , stethoscope ( best quality ) , paediatric stethoscope ( best quality ) , baby tray ( ss , ce inbuild ) , x ray film processing tank 9 lit. , x ray film processing tank 13.5 lit. , oxygen flow meter ( best quality ) , mox with yolk assombily , examination table with matress ( 72x24x3 ) ( iron ) , pulse oxymeter ( multi para ) ( with installation & 1 yrs. warrenty ) ( 8.5 tft display with ecg ) , centrifuge machine for blood storeg unit ( with installation & 1 yrs. warrenty ) , vein detector led , besin boul ( with stand ) , foot step ( 2 step ) , bed side screen with cloth ( 1 round pipe with wheel ) , salin stand with wheel with four hook ( ss ) , nsv kit set ( ss ) ( specification acched ) , streture trolly ( 85x22x32 power coated with matress ) , cotton folding strecher for ambulance ( best quality ) , weighing machine adult ( best quality ) , bed side locker ( best quality ) , hospital bed ( best quality ) ( general ) , semi fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , circle absorber with soda lime ( for boyles apparatus ) , portable oxygen cylinder ( best quality ) , baby weighing machine digital , high vaccum suction machine , iucd kit ( specification acched ) , minilap kit ( specification acched ) , water bath ( pathology department ) ( • should have double walled chamber made of stainless steel and outer wall made of thick mild steel sheet duly powder coated. • should have concentric rings are also made of stainless steel. • should have temperature co , hot air sterilizer ( oven ) digital construction: ovens are sturdy, with double walled construction. inner chamber is made of highly polished stainless steel. outer chamber is made of mild steel sheet duly pre treated in seven tanks process for surface , pulse oxymeter baby ( finger tip ) type: blood pressure monitor power supply: battery size: 57 ( l ) * 33 ( w ) * 32 ( h ) mm , pulse oxymeter adult ( table top ) built in rechargeable li polymer battery for uninterrupted monitoring compact and flexible appearance, easy for carrying and be suitable for indoor and outdoor ( in ambulance ) monitoring with user friendly interface displ , nebuliser should be lightweight, portable and compact. should have a dust filter. should be able to deliver a flow rate = 7 lpm should h ave air pressure = 35 psi. should have a check valve to protect the device against contamination due to backward , fumigation machine input power : 220 vac, 3.5 amp, 50hz consistant particle size generation : 5 15 microns vmd reach : 20 30 ft distance & 18 20 ft height. space treatment : up to 7000 cuft & even larger. nozzle assembly : non rotating vortex design , non , otoscope 1. should be a convenient pocket type otoscope. 2. should be provided with a halogen light source. 3. should be able to detach the otoscope head. 4. should provide no reflections and obstructions. 5. should provide detachable accessories of var , straight needle , o.t. table hydrolic ss ( best quality ) , focus light led ( spot light ) , laboratory autoclaves , pulse oxymeter , pulse spo2 , infusion pump , vacuum extractor metal ( best quality ) , head box for oxygen ( best quality ) , tuning fork ( best quality ) , examination instruments set ( speculums, tongue dipressors, mirrors, bulls lamp ) ( best quality ) , cervical biopsy set ( best quality ) , endometrial biopsy set ( best quality ) , vaginal hysterectomy set ( best quality ) , g.i. operation set ( best quality ) , uretheral dilator set ( best quality ) , stomach wash equipment ( best quality ) , emergency resuscitation kit adult ( best quality ) , air way 0, 1, 2, 3, 4 adult , air way peadiartric , tongue depressors , oxygen cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small d type jumbo ) , wheel chair ( ss ) folding , nibulisyer adult with mask , nibulisyer child with mask , nibulisyer mask for adult , nibulisyer mask for child , anaesthesia work station ( include anaesthesia machine with vaporiser, ventilator, monitor ) , boyles machine, brain circuit, jr , magills forceps , blood transfusion set ( best quality ) , back rest , medicine trolley ( ss ) , basin assorted ( ss ) , basin stand assorted ( ss ) ( 2 basin type ) , bed pan ( ss ) , urinal female , urinal male , waste disposal bin / drums , waste disposal trolley ( ss ) , diet trolley stainless steel , doctors overcoat , hospital worker overcoat , patients housecoat for female , patients paiiarna ( for male ) shirt , mouth mirror , waste disposal colour coded buckets swine bing 60 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets swine bing 30 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , tharmometer , nasogastric tube ( 8, 10, 12 fg ) , flow meter with humidifier bottle , bed side locker ( fully ss ) ( best quality ) , instrument trolly ( best quality ) , central patient monitoring station , bronchoscope , adjustable walker , bipap machine , cpap cum hfnc for newnate , paediatric vein circuit , ecg monitor cable , plastic tray bigh heavy , plastic box big heavy with led , x rey hanger 12x15 , x rey hanger 12x12 , x rey hanger 12x10 , x rey hanger 8x10 , x rey grid ( lead ) 12x15 , x rey grid ( lead ) 10x12 , mva aspirator , glass pippette , forceps, uterine nelaton solid tip one eye ( ( tungsten carbide tip ) , suction tube ( 225 rnrn, ss ) , valve inhaler ( chrome plated brass, y shape ) , intravenous ( set in box ) , needle spinal stainless ( set of 4 ) , syringe, anesthetic ( control 5 ml luer mount glass ) , head light ( ordinary ) ( boyle davis ) , beds semi recilining , feeding equipments ( tubes, katoris & spoon ) , channel semi automatic coaglomater with regent , x ray machine 100 ma with dark room assoseries ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , standalone color doppler machine ( specification should be attached in technical bid turms & condition ) , portable ultra sound with pw ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , portable cooling unit ( vaccine / blood bags ) ( specification should be attached in technical bid turms & condition ) , o.t light ( dichroic reflector ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , hospital bed ( ss head & foot side rod ) ( specification should be attached in technical bid turms & condition ) , led light ( single ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ultra high speed laboratary centrifuge ( specifications attached ) , digital incubator ( specifications attached ) , boyles machine ( specifications attached ) , 72 led dome ( double dome ) , lux 1, 30, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , 48 led dome ( single dome ) , lux 1, 00, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , coutery machine ( 400 w ) , coutery machine ( 250 w ) , portable o.t. light ( abs doom 19 single reflecter polycarbonate ) , portable o.t. light led , vaccu suck suction tube ( titanium ) ( for suction machine ) , alis forcep 10 ( titanium ) , tissue forcep 10 ( titanium ) , convex array tranducer c343ua ( for ultra sound machine ) , phototherephy unit single surface ( stand model ) , phototherephy unit single surface led ( with led buld ) , silent genrator 10 kva ( with installation ) ( 10 kva, 3 phase, water cooled ) , silent genrator 15 kva ( with installation ) ( 15 kva, 3 phase, water cooled ) , silent genrator 20 kva ( with installation ) ( 20 kva, 3 phase, water cooled ) , silent genrator 50 kva ( with installation ) ( 50 kva, 3 phase, water cooled ) , silent genrator 82 kva ( with installation ) ( 82 kva, 3 phase, water cooled ) , magil circuit with mask ( for boyles apparatus ) , patho fast test kit ( for patho fast machine ) , blood gas analyser test kit ( for blood gas analyser ) , dossimeter , peak expiritory flow meter ( best quality ) , laryngoscope fibreoptic ent ( best quality ) , p.v. tray ( best quality ) , varicose vein set ( best quality ) , connector set of six for en ( best quality ) , tubes connecting for en ( best quality ) , leqqinqs , explorar , endo explorar , amalgam carrier in sliver , murcury ball burnisher , carver ( dimond ) , compactor , element carrier , gic ( glass ionomer cement ) , zinc phosphate cement , temporary filling material , room thermometer , electric ventouse , radient baby warmer , right angel artry 4 , right angel artry 6 , automated autoref stand ( for ophthalmic ) , 2 mirror cronioscope ( for ophthalmic ) , disposable needle 26 g ( for ophthalmic ) , ppiucd forcep , uterus collection ( sister u and mama u ) , water cooler with purifire ( 120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap , hemoglobinometer ( 1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g / dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd / us fda / isoapproved 6. automatic correction of hb. 7. 20 , digital x rey film ( konika ) 8x10 , digital x rey film ( konika ) 10x12 , digital x rey film ( konika ) 12x12 , digital x rey film ( konika ) 12x15 , x ray digitalisationwith high end cr system ( with installation & 1 yrs. warrenty ) console software with multi modality work station the cr system should have advanced workstation provided with 17” high resolution monitor, keyboard & mouse, with the fol , x ray 500 ma ( with 1 yrs. warrenty ) x ray genera tor: high frequency x ray generator of frequency 40khz should be provided. power output of generator should be of sokw. kv range should be: • radiographic kv: 40 to 12sky. • fluoroscopic kv: 40 to 120k , suction machine foot operated ( powder coated m.s. chassis. noise level of suction apparatus from is 50 db + / 03 db. leakage current of suction units is less than 84 ua. electrical requirement – 220 ~ 230v, 50hz, 1 phase. ideal for mtp / medical / surgic , suction apparatus ( electric ) suction machine with pump: power supply: 230 240v / 50hz vacuum capacity: 18 litres / mim maximum depression: 75kpa ( 563mmhg ) vacuum is created by a plastic piston and cylinder system, with four vacuum creating modules ( , phototherapy unit 1 led phototherapy with intensity upto 6 50microwatts / nm / cumm / mwatt, adjustable intensity. 2 .height adjustable and tiltable light unit. 3 digital time totaller of led usage time. 4 stainless steel tray. 5 –provision for double surf , opthalmoscope 1. should be rechargeable battery with charger / mains operated. 2. should have halogen / led light source 3. should have red free filters 4. should have small and large spot sizes, fixation targets, slit aperture, hemi spot and cobalt blu , wireless indirect ophthalmoscope ( led ) ( compact and light weight, stereo optical system has all pupil features rechargeable battery integrated on headbrilliant white light with uniform and well spread led illumination ( focus distance : 300 800 mm, inter p , dental chair 1. should be electrically operated with zero program. 2. should have a switch operated operating light with minimum two steps of intensity control. 3. should have auto water connection for spittoon and tumbler with auto filling sensor. 4. s , av retractor 1.stainless steel 2.double ended, serrated 3.rust free 4.sturdy construction 5.accurate dimensions , vulcellum stainless steel size: 10 inch colour: silver shape: curved , ppiucd forcep ss , baby forceps ss ( big – straight ) , baby forceps ss ( big – curve ) , baby forceps ss ( big – straight ) , baby forceps ss ( small – curve ) , baby forceps ss ( small – straight ) , folis catheter 24 no , lab incubator 1. should have 4 inch attractive lcd display 2.should have intelligent controller to help maintain temperature incase of sensor failure 3. should have battery backup for temperature controller 4. should have auto tuning of controller , electricentrifuge, table top ( table top electric centrifuge ) 1. should have stepless speed regulator 2. should have safety lid interlock to prevent cover opening during centrifugation. 3. dynamic brake for quick deceleration 4. wide choice of swing out , cbc machine ( 5 part blood cell counter machine ) 1. should have throughput – 50 samples / hour 2.the sample volume should be < 17 ?l 3.should have technology – impedance ( wbc, rbc, plt ) , spectrophotometry ( hcg ) , should have optical laser methodfor 5 , incubator for culture sensitivity , esr stand with tubes , elisa reader cum washer , glycosylated haemoglobinometer , blood collection monitor , intensifying screen x ray , dossimeter , peak expiritory flow meter ( best quality ) , baby incubators ( best quality ) , craniotomy ( best quality ) , static vaccum extractor ( best quality ) , head light ( ordinary ) ( boyle davis ) ( best quality ) , ent operation set including headlight, tonsils , ent nasal set ( smr, septoplasty, nasal endoscopic set ( 00 & 300 ) polypetcomy, dns, rhinoplasty ) ( best quality ) , laryngoscope led ( best quality ) adult , laryngoscope led ( best quality ) pediatric , tracheostomy set ( best quality ) , proctoscopy set adult ( best quality ) , proctoscopy set peadiartric ( best quality ) , p.v. tray ( best quality ) , abdominal hysterectomy set ( best quality ) , laparotomy set ( best quality ) , varicose vein set ( best quality ) , thomas splint ( best quality ) , laproscopy set for cholecystectomy , amputation set ( best quality ) , colposcope ( best quality ) , mouth prop , regional anaesthesia devices, epidural set , vascular clamp set ( best quality ) , steel cup board , case sheet holders with clip ( ss ) , draw sheet , pereneal sheets for ot , explorar , spoon excavator , twizer , endo explorar , amalgam carrier in silver , murcury ball burnisher , carver ( dimond ) , diathermy machine , doyess ( medium ) , gernes retractor , metal catheter , mayo scissor curved , lma ( adult ) , steel galipot small , dressing drum size 9x11 , sims vaginal speculam , epsiotomy scissor , ovum forcep , tailor scissor , doctor & nurse dress with designation ( paijama & kurta ) , doynes retroctor 1.5” ( german steel ) each , doynes retroctor 2” ( german steel ) each , doynes retroctor 2.5” ( german steel ) each , doynes retroctor 3” ( german steel ) each , doynes retroctor 3.5” ( german steel ) each , czernys retractor ( german steel ) each , formalin chamber ( 20x8x8x5 mm ) , formalin chamber ( 26x8x8x5 mm ) , lifter with jar , strraight scissor 5” ( german steel ) each , strraight scissor 6” ( german steel ) each , strraight scissor 7” ( german steel ) each , strraight scissor 8” ( german steel ) each , s.s. bowl30 cm ( super fine quality ) each , s.s. bowl36 cm ( super fine quality ) each , babcock clamp 6” ( german steel ) each , babcock clamp 8” ( german steel ) each , ambu bag adult ( silicorised ) ( super fine quality ) , ambu bag child ( silicorised ) ( super fine quality ) , ambu bag 250 ml , artery forceps 6” curved ( german steel ) , artery forceps 6” straight ( german steel ) , mayo scissor long curved 6.5” each ( german steel ) , mayo scissor long curved 7.5” each ( german steel ) , tooth forceps 6” each ( german steel ) , non tooth forceps 6” each ( german steel ) , tenaculum long each ( german steel ) , myome screw each ( german steel ) , morrisen retractor each ( german steel ) , sim speculum medium each ( german steel ) , sim speculum long each ( german steel ) , waste disposal colour coded buckets swine bing 80 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets ( black, red, yellow, blue ) ( neelkamal, cello, suprem ) , dust bin ( ss ) small ( best quality ) , dust bin ( ss ) big ( best quality ) , sauce pan with lid , chest stand for x rey unit , oropharyngeal airway ( 000 4 guydel size ) , oxygen cylinder 10 ltr. mo2 with valve , bipap machine , elvo gloves – per pair , lyarigoscope set adult with led – each , lyarigoscope set child with led – each , hemoglobino meter digital – each , massiring mug – each , hair tremer branded – each , hot air oven , urino meter , adk drain , concigated drain ( plastic ) , diatharmy plate for vally lab , laryngoscope adult set , laryngoscope ped. set , coutry pencil , crash card with steel drower , digital spirometer , carbonmonoxide monitor , pulse oximeterfor ccu ( specifications attached ) , pulse oximter with nib for ccu ( specifications attached ) , carm for ccu ( specifications attached ) , laryngoscope for ccu ( specifications attached ) , nibulisor adult with mask , nibulisor child with mask , nibulisor mask for adult , nibulisor mask for child , infant weighing scale , lc dcp and dcp basic instrument set ( specifications attached ) , small fragment lc dcp & dcp® instrument set, st. steel ( specifications attached ) , select lcp upgrade instrument set large & small fragment ( specifications attached ) , dhs / dcs instrument set ( specifications attached ) , css 4.5mm instrument set in vario case ( specifications attached ) , css 6.5mm instrument set in vario case , synream ( specifications attached ) , distractor set large ( specifications attached ) , distractor set medium ( specifications attached ) , bone forceps range ( specifications attached ) , general instrument set ( specifications attached ) , instruments for damaged screw removal ( specifications attached ) , chisel and impactor set ( specifications attached ) , tomofix instrumentset in syncase ( specifications attached ) , instrument set for minimally invasive plate insertion osteosynthesis ( mipo ) in vario case ( specifications attached ) , collinear reduction clamp in vario case ( specifications attached ) , reduction handles, toothed and rounded, small & large in modular tray ( specifications attached ) , mipo cerclage passer ( specifications attached ) , hohmann retractor ( specifications attached ) , soft tissue spreader set ( specifications attached ) , periarticular reduction forceps ( specifications attached ) , pelvic basic instruments ( specifications attached ) , pelvic reduction & retraction ( specifications attached ) , pelvic c clamp ( specifications attached ) , wire instrumnents set ( specifications attached ) , shoulder instruments ( specifications attached ) , gili pot ss , weight machine hanging ( for bmw ) , sterlizer indicator , bio west trolly single bin ( ss ) , bio west trolly doubble bin ( ss ) , bio west trolly triple bin ( ss ) , variable pipette ( ce certified ) , variable pipette ( ce certified ) , spirometer , carbon monoxide breath monitor , portable 3 channel ecg recorder , 300ma fixed x ray unit with multi position table , 100 ma, 100 pps line frequency mobile x ray , biphasic defebrillator with aed , ctg nst machine , digital radiography system high frequency ( digital x ray ) , high end premium ultrasound system , syringe pump , ales tissue forceps6 no. , stragiht artery forceps 6 no , curved artery forceps 6no , mayo curved sessior6no , cord clamp forceps , mayo straight sessior 6 no , fomigator macine , tooth forceps , towel clip , bp blade holder 4 no , needleholder 8 no. , drum big size , drum medium size , sucetion pipe , formalin chamber big size , cut sheet , opration gown front with plastic , spinal cover sheet , opration plain seat , opration table cover ( plastic ) , plastic soft sleeper7no , instrument trolly table big size , split ac 1. ton with installation , split ac 1.5 ton with installation , split ac 2 ton with installation , window ac 1. ton with installation , window ac 1.5 ton with installation , window ac 2 ton with installation...

Health Department - Jharkhand

37709206 group b rate contract for medicine at sadar hospital koderma , items : , tab. paracetamol ( 250 mg ) , tab. azithromycin ( 250 mg ) , tab. fluconazole ( 150 mg ) , tab. losartan potassium ( 50 mg ) , tab. ofloxacin ( 100 mg ) , tab. ofloxacin ( 200 mg ) , tab. ofloxacin + ornidazole , tab. calcium carbonate ( 500 mg ) &vitamin d3 , tab. clopidogrel ( 75 mg ) , tab. atorvastatin ( 10 mg ) , tab. erythromycin estolate ( 500 mg ) , tab. metformin ( 500 mg ) , tab. calcium & vit d3 250 mg ( each ) , tab. ciprofloxacin ( 250 mg. ) , tab. domperidone ( 10 mg. ) , tab. paracetamol ( 500 mg ) , tab. prednlsolone ( 5 mg ) , tab. prednlsolone ( 10 mg ) , tab. prednlsolone ( 20 mg ) , tab. azithromycin ( 500 mg ) , tab. famotidine ( 20 mg ) , tab. ibuprofen ( 200 mg ) , tab. ibuprofen ( 400 mg ) , tab. metronidazole ( 200 mg ) , tab. metronidazole ( 400 mg ) , tab. multivitamins ( as per schedule v of drugs and cosmetics rules ) ( 1 tab ) , tab. ciprofaloxacin ip + tinidazole ( 500 mg.+600 mg ) , tab. ciprofloxacin ( 500 mg. ) , tab. co trimoxazole ds ( 160 mg.+800 mg. ) , tab. co trimoxazole ss ( 80 mg.+400 mg. ) , tab. norfloxacin ip + tinidazole ( 400 mg+600 mg. ) , tab. cetirzine ( 10 mg ) , tab. nimesulide + paracitamole ( 100mg+325mg ) , tab. accelofenace+ para ( 100 mg + 325 mg ) , tab. ibuprofen ip+ paracetamol ip ( 400 mg.+325 mg ) , tab. ranitidine ( 150 mg. ) , tab. amoxycillin+ clavulanic acid ( 500+125 mg ) , tab. amoxycillin+ clavulanic acid ( 250+125 mg ) , tab .paracetamol + diclofenac sodium ( 325 mg.+50 mg ) , tab. dicyclomine hydrocloride.+ paracetamol ( 20 mg.+325 mg. ) , tab. misoprostal ( 200 gm ) , tab. salbutamol ( 4 mg ) , tab. folic acid 400 microgram , tab. norfloxacin 400 mg , tab. enalapril maleate 5 mg , tab. phenoxymethylpenicillin potassium 250 mg , tab. zinc sulphate 50 mg , tab. chloroquine 150 mg , tab. albendazole ( 400 mg ) , tab. amlodipine ( 5 mg ) , tab. cephalexin ( 500 mg. ) , tab. ondansetron ( 4 mg ) , tab. tinidazole 600mg , tab. allopurinol 100 mg , tab. rabiprazole 20+ domperidome 10 mg , tab. cefexime 200 mg , tab. doxycycline 100 mg , tab. vitamin c 500 mg , tab. paracetamol ( 650 mg ) , cap. amoxicillin ( 250 mg ) , cap. amoxicillin ( 500 mg ) , cap. tramadol 100 mg , cap. omeprazole ( 20 mg ) , cap. iron folic acid , cap. iron , cap. amoxy 250 + cloxy 250 , cap ampi 250 + cloxy 250 , cap. ampicillin 500 mg , cap tramadole 50 mg , syrup domperidom ( 30 ml ) , syrup ofloxacin ( 30 ml ) , syrup salbutamol sulphate ( 100 ml ) , syrup metoclopramide ( 5mg / 30ml ) , syrup. b complex 100 ml ( each ) , syrup paracetamol ip 125 mg ( 60 ml ) , syrup. cough supressent ( dextromethorphan based ) dextromethorphan hyd, chlophenical maleate&phenylephrine hyd ( 60ml ) , syrup. cough supressent dextromethorphan hyd, chlophenical maleate&phenylephrine hyd. ( 100ml ) , syrup. diphenhydramine hydrochloride ammounium chloride sodium citrate &menthol100 ml , syrup. cotrimoxazole ( 50 ml ) , syrup. amoxicillin 125 mg / 30 ml , syrup. nimesulide + para 60 ml , syrup potassium chloride solution , syrup. azithromycin 200 mg / 15ml , syrup. chlorphenatamin + dhenylephrione 60 ml , syrup. anti allergical cough suppresent 60 ml , syrup. metronidazole 60ml , syrup multivitamin , syrup ondemsetron , syrup hemfer , syrup. carbamazepine , syrup promethazine 60 ml , syrup. norbin power 30ml , syrup. zinc sulphate 100 ml , syrup. erythromycin 60 ml , syrup. ibuprofen 60 ml 100 mg , syrup. ibuprofen & paracetamol 60 ml , syrup do 60ml. , syrup carbamazepinesyrup , syrup. vitamin a 100ml , syrup promethazine 30ml , syrup. glyceryl trinitrate , syrup cetrizine ( 30 ml ) , syrup. carbamazepine , scabe lotion 100 ml , drop flurabifrofen eye5 ml , drop tropicamide with phenylephrine ( eye drop ) , drop homid ( eye drop ) , drop nephafenac ( eye drop ) , drop paracain ( eye drop ) , drop paracetamol 15 ml , drop ondenstron , drop cough 15 ml , drop multivitamin 15 ml , drop oflox oz 30 ml , drop azithromycin 100 mg susp. 30 ml , drop enzyme 15 ml , drop enzyme 100 ml , drop amoxicillin 10 ml , drop cefexime oral susp. 30 ml , drop domperidone , drop butrodol , drop moxifloxcin eye ( 5ml ) , drop lubricant eye ( 5 ml ) , drop. amoxycillin & potassium clavulanate oral 30ml , drop. cefpodoxime proxetil oral 30ml , drop dicyclomine , drop gentamycin eye / ear , drop ciprofloxacin eye ( 5ml ) , drop gentamycin ear ( 5ml ) , drop suspension albendazole ( 200 mg / 15 ml ) , drop suspension albendazole ( 100 mg / 15 ml ) , drop vitamin d3 15 ml , lens power number 21 to 24.5 ( each any number ) , sachet bifilac 0.5 gm , inj. ranitidine ( 25 mg / 2ml ) , inj. amlkacin ( 250 mg / 2 ml ) , inj. gentamicin ( 40 mg / ml ) , inj. ceftriaxone ( 1 gm ) with water , inj. ceftriaxone ( 125 mg. / 5 ml ) with water , inj. ceftriaxone ( 250 mg. ) with water , inj. ceftriaxone ( 500 mg. ) with water , inj. tramadol ( 50 mg ) , inj. gentamicin ( 80 mg / ml ) , inj. paracetamol 10 ml , inj. metoclopramide5mg , inj. amikacin ( 500 mg ) , inj. diclofenac ( 25 mg / 1ml ) , inj. ondansetron ( 4mg ) , inj. dicyclomine ( 10 mg ) , inj. human rabies immunoglobulin ( 300 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 250 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 500 iu ) , inj. human tetanus immunoglobulin ( 1000 iu ) , inj. hepatitis b immunoglobulin ( 200iu / 1ml ) notavl , inj. hepatitis b immunoglobulin ( 100iu / 1ml ) , inj. anti imnuoglobin 250 mg , inj. anti imnuoglobin 1 gm , inj. pentazosin ( amp ) , inj. equine rabies immunoglobulin ( 1500 iu / 5 ml ) , inj. ampicillin 500 mg , inj. ampicillin 250 mg , inj. benzathine penicillin ( 6 lakh units ) 450 mg , inj. benzathine penicillin ( 12 lakh units ) , inj. anti rabies vaccine with 5 syringe ( multi dose intra dermal 1 ml ) , inj. dexamethasone 4 mg , inj. oxytocin 2 ml , inj. anti rabies vaccine withsyringe ( single dose intra muscular 0.5 ml ) , inj. desferal , inj. effcorlin , inj. cefotexime 125 mg , inj. cefotexime 250 mg , inj. amikacin 100 mg , inj. aminofylin 10 ml , inj. meropenum 1000 mg , inj. meropenum 500 mg , inj. meropenum 125 mg , inj. nikethamide each , inj. pipracillin 4000mg + tazobactom 500mg , inj. phenobarbiton , inj. phenytoin 100 mg , inj. caffirate , inj. livipil , inj. doubutamine , inj. xylocain 2% with adrinaline 30ml , inj. efipres each , inj ampicillin 125mg , inj.chromostate , inj. medazolam , inj. propofol 10 ml , inj. phenargan , inj. fentanyle , inj. kcl , inj. heaparin , inj. pethedin , inj. glycopyrolet , inj. butrodol 1 ml , inj. butrodol 2 ml , inj. suceinyle cholene , inj. calmpose , inj. noloxone , inj. butorphanal , inj. vecurouium , inj. adrenaline , inj. lignocaine hydrochloride& adrenaline 30ml vials , inj. triamcinolone acetonide 31ml , inj. defrioxamine 500 mg , inj. calcium gluconateiv 1gm , inj. aminophyline each , inj. mephentine , inj. spasmocare , inj. ketamin 10 mg , inj. streptomycin injection 0.750 grm , inj. streptomycin injection 0.500 grm , inj. streptomycin injection 1.000 grm , inj. capreomycin 01 grm , inj. cepromycin 750 mg , inj. kanamycine 01 grm , inj. kanamycine 500 mg , inj. hydrocortsione 100mg , inj. anawin ( 5% ) 30 ml , inj. insulin 40 units / 10 ml , inj. insulin zinc suspension 40 unit / 10 ml , inj. betamethasone4mg / ml , inj. furosemide 10 mg / ml , inj. diazepam5 mg , inj. etophyllin + theophylline ( deriphyllin ) , inj. cloxacillin 250 mg , inj. prostodine , inj. hydrocortisone 100mg , inj. drotaverin2 ml , inj. atropine 0.6 mg , inj. tranexamic acid , inj. vitamin k ( phytomenadione ) , inj. vitamin k 3 ( menadione ) , inj. xylocain 2%30ml , inj. xylocain 5%30ml , inj. phenylphrine ( 1ml ) , inj. camolol , inj. methergin , inj. sodium chloride ivi.p 0.9% w 1 v 500 ml , inj. aminophiline , inj. prostaglandin 205 mg , inj. prostadine each , inj. pipracillin + tazobactum 4.5 gm , inj. donperidone , inj ondacetron 2ml , inj. azithromycin 500 mg , inj augmentin 1.2 gm , inj paracetamol 1 gm , inj mvi , inj dobutamine , inj lasix , inj termin , inj nitroglycerine , inj esmolol , inj amzodarone 300 mg , inj. anti snake venum , inj. hydrocortisone sucoinate 100mg , inj. promethazine 25 mg / 2 ml , inj. magsulph magnisium sulphate i.p 50% , inj. oxytocin inj. , inj. phenytoin sodium 2 ml , inj. sodium bicarbonat iv 7.5% 10 ml , inj. sodibicarb 10 ml amp ( 7.5% ) , inj. anti d300 mg , inj. labetalol 100 mg , inj. labetalol 50 mg , inj. potassium chloride , inj. prostaglandin 205 mg , inj. dopamine 200 mg 10 ml , inj. betamethasone sodium phosphate , inj. plasma volume expender 500 ml bottle , inj. bupivaccine 0.5% 20 ml , inj. ropin 0.75% ( ropivacain ) ( neon ) , inj. dexmedine 100 ug , inj. atacurium ( atracurium ) , inj. anemol ( paracetamol 1 gm 100 ml ) , inj. midfast ( misazolam ) , inj. iflurane ( isoflrane ) 100 ml , inj. avil each , inj. hydrocortisone succinate ( efcorlin ) each , inj. dopamine each , inj. calcium sandoz each , inj. neostigmine each , inj. iron sukroj amp each , inj. ondacetron 2ml , inj. azithromycin 500 mg , inj. pentoprazole , ini. streptomycin injection 0.500 gram ( per vials ) , inj augementine 1.2gm , inj atracurium , inj noradrenaline , inj. digoxin , inj. insulin regular , inj. insulin intermediate , inj. aminophylline , inj. benzathine benzyl penicillin , inj. lignocaine hydrochloride , inj. streptokinase 7.5 lac vial , inj. streptokinase 15 lac vial , inj.mixed human insulin 30 / 70 , inj. mixed human insulin 50 / 50 , inj. penidure la6, la 12 , inj. pantaprazole 40mg , inj. hepatitis b immunoglobulin 100 iu / 0.5ml. , inj. heaparin 25000iu , inj. heparin sod 5000 iu , inj. heparin sod 10000 iu , inj. heparin sod 1000 iu , inj. hynidase , inj atracurium 2.5ml. , inj. diazepam , inj. promethazine , inj. promethazine , inj.glyceryl trinitrate , inj. tetvac vial 5ml , inj. tetvac vial 1ml , inj. rabis immunoglobin 1500 iu , inj. methylcobalamin , nicotinamind, pyridoxine hcl&d panthenol.2ml , inj. hydroxyprogesterone caproate 250 mg , inj. hydroxyprogesterone caproate 500 mg , inj. amikacine 100mg , ors powder ( 21.8 gm. pkt. ) , 2% xylocain jelly 30 gm , luliconazole cream 10gm , luliconazole lotion 15gm , diclofenac spry , ketokonazole soap , enteroglemina , oint. povidine iodine oint15 gm , oint. clotrimazole 15 gm , cream. clobetasol propionate, neomycin sulphate&miconazole nitrate , oint. clotrimazole + gentamycin + beclometasone ointment 15gm , oint. silverex ( 250 gm ) jar , drops. ciprofloxacine & betamethasone sodium phasphate e / e , drops. gentamicin & betamethasone sodium phasphate e / e , drops. ofloxacine & betamethasone sodium phasphate e / e , drops. moxifloxacine & dexamethasone sodium phasphate e / e , gamma benzene hexachhloride &cetrimide lotion 100ml , oint. clotrimezole oint. 15 gm , tab.glyceryl trinitrate , tab.alprazolam 0.25 mg , tab.alprazolam 0.50 mg , tab.cephalexine 250 mg , tab.drotavarin , tab.defrijet 250 ( each uncoted tab. for oral suspension contains deferarirox 250 mg ) , tab.defrijet 500 ( deferasirox 500 mg ) , tab.darcolex 500 mg , tab.digoxin 0.5 mg , tab. metoprolol 25 xl mg , tab. metoprolol 50 xl mg , tab. aspirin 75mg , tab. hydrochlorthiazide 12.5 mg , tab. hydrochlorthiazide 25 mg , tab. enalapril 2.5 mg , tab. enalapril 5 mg , tab. captopril , tab. clopidogrel , tab. isosorbidedinitrate ( sorbitrate ) , tab. glyceryl trinitrat , tab. verapamil ( isoptin ) , tab. potasium ip ( pencylin v ) , tab. carbamazepine , hiv rti / sti kit kit 1 grey a ) tab. azithromycin 1 gm tab. b ) tab. cefixime 400gm. 1 tab. , hiv rti / sti kit kit 2 green a ) tab. secnidazole 1 gm 2 tabs. b ) tab. fluconazole 150 mg1 tab. , hiv rti / sti kit ( kit 3 white a ) inj. benzathine penicillin 2.4 mu 1 no. b ) tab azithromycin 1gm. 1 tab. c ) sterile disposable syringe 10ml.21 g needle 1 no. d ) sterile water 10 ml. 1 no. ) , hiv rti / sti kit kit 4 blue a ) cap. doxyccline 100 mg. 30 caps. b ) tab. azithromycin 1gm. 1 no. , hiv rti / sti kit kit 5 red a ) tab. acyclovir 400 mg. 21 tab. , hiv rti / sti kit kit 6 yellow a ) tab. cefixime 400 mg 1 tab b ) tab metronidazole 400 mg. 28 tabs c ) cap. doxycycline 100 mg 2 tab , hiv rti / sti kit kit 7 black a ) cap. doxycycline 100mg 42 caps b ) tab. azithromycin 1 gm 1 no. , tab. azithromycin 100mg , tab. atenol 100 mg , tab. glimepride 5 mg , tab. premaquine 2.5 mg , tab. misoprostol 200 mg , tab. isoniazid 100 mg. , tab. isoniazid 300 mg. , tab. pyridoxine 100 mg , tab. pyrazinamide 750 mg , tab. pyridoxine 50 mg , tab. pyridoxine 25 mg. , mma drugs for safe abortion services ( in combi pack 1 tab mifepristone 200 mg and 2 tab misoprostol 200 mcg each tab ) , respule salbutamol + iprapropiun , respule budenocide , tab. methyldopa 250 mg , tab. pan 40 ( pantotrazole ) , tab. methyl dopa each , tab linezolid 600 mg , tab amlodeepine at , tab deriphyllin 50 mg , tab dexamethasone , tab enzyme , tab hcqs 200 mg , tab hcqs 400 mg , tab wysolone 10 mg , tab. glimepride 1 mg , tab. chlroquine 250 mg , tab. premaquine 7.5 mg , tab. erythromycin 250 mg , tab. trimethoprim 80mg & sulphamethoxazole 400 mg ( adults ) , tab. atenolol ( 25 mg ) , tab. atenolol ( 50 mg ) , tab. cefexime 100 mg , tab. pentoprazole 40mg , tab. favi piravir , tab. ivermectin , tab. asprin ( 75 mg ) , tab. captopril 2.5 mg , tab. methyldopa 500 mg , tab.atorvastatin 10 mg , tab. digoxin , tab. potasium ip ( penicillin v ) , tab. nifedipine 5 mg , tab. nifedipine 10 mg , tab.folic acid , tab. carbamazepine , tab prednisolone , tab promethazine , tab atenolol 25 , tab. metoprolol 25 , tab methyldopa 250 mg , tab. frusemide 40 mg , tab. issorbide dinitrate ( sorbitrate ) 10 mg , tab. issorbide dinitrate ( sorbitrate ) 5 mg , tab pioglitazone ( 15mg ) , tab. vildagliptin ( 50 ) , tab b complex , tab. methylcobalamine 1500 &alpha lupic acid &pyridoxine&folic acid , tab. telmisatan 40 mg , tab. escitelopam 5 mg , tab. pantaprazole ( 400 ) , tab. pantaprazole + domeperidone , tab. ondacetron ( ondem ) , tab atorvastatin 10 mg+ecosprin 75 ( combined ) , tab. epselin ( 100 mg ) . , tab. amlodipine2.5 mg, , tab. amlodipine 5mg , tab. amlodipine 10mg , tab ondencetron 4 mg , tab. nifedipine ( 5mg ) , tab. telmisartan 20 mg , tab. telmisartan 40 mg , tab metron 500mg , caps promethazine , cap hydroxyurea 500 mg , cap. rifampicin 150 mg , cap. rifabutine 150 mg , cap. clofazimine 100 mg. , cap. ampicillin 250 mg , cap depin 5 mg , cap depin 10 mg , cap chloramphenicol eye ointment 250 mg , cap vitamin bcomplex , cap. clofazimine 100mg , formalin500ml , oxygen nesal set paed , oxygen nesal set adult , oxygen nesal set ( neonetal ) , oxygen hood , corogated drain disposable , corogated drain rubber , vac set ( closewoundsuction ) size size 14 18 , adk set ( abdominal drain ) size 20 32 , cautery pencil , cotery pad disposable , pmo line ( 100 / 150 / 200 cm ) , 3 way line connector , senitizer 5 liter jar , pedia set 110 ml , pedia mask 0, 1 , feeding tube no. 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 , foleys catheter no. 14, 16 , ryles tube adult no. 6, 8, 10, 12, 14, 16, 18 , permethrin lotion 30 ml , plain catheter no. 10 , plain rubber urinary catheter each , hernia kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , mva / eva for safe aboration sevice kit , ec lotion 100 ml , crepe bandage 4x 4mtr , crepe bandage 6x 4mtr , french chalk powder 1 kg , viscoelastic hypersole , bitadin hand scrab , sprit 1 ltr. , soft cotton 4x 3mtr , soft cotton 6x 3mtr , roller bandege 2”x 3mtr , roller bandege 3”x 3mtr , roller bandage 4x 3mtr , roller bandage 6x 3mtr , gypsona 6x 2.7mtr , gypsona 4x 2.7mtr , leucoplastroll 4 x 6mtr , leucoplast roll 2x 6mtr , bandage than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , needle 26g , needle 24g , vicryl no:1 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no:1 0 ( 1 / 2 rc , 90 cm lenth ) , vicryl no. 2 0 curved round body needle ( 90 cm lenth ) , vicryl no. 3 0 curved round body needle ( 90 cm lenth ) , vicryl no. 4 0 curved round body needle ( 90 cm lenth ) , vicryl no. 6 0 curved round body needle ( 90 cm lenth ) , vicryl no:1 0 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no: 1 ( 40 mm1 / 2 rb tc 180 cm double needle ) , chromic catgut no:1 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:1 0 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:2 ( 45 mm1 / 2 rb, 100 cm lenth ) , chromic catgut no: 2 0 ( 30 mm 1 / 2 rb 76 cm lenth ) , prolene 1 0 curved round body , prolene 2 0 curved round body , prolene 3 0 curved round body , prolene 3 0 curved cutting needle , pds 5 0 curved round body , pds 6 0 curved round body , ethilon 3 0 curved cutting needle , ethilon 4 0 curved cutting needle , silk thred 3 0 curved round body , silk thred 4 0 curved round body , suture 10.0 , cresent knife 2.5 mm , keratome knife 2.8 mm , respirometer ( 3 ball ) disposable , prolene mesh size 6 x 11 cm , prolene mesh size 8 x 15 cm , prolene mesh size15 x 15 cm , trimmer ( per pcs ) , deshnet 1 ltr. jar , bt set ( sigle chamber ) disposable , tamophose 50 ec ( 5 ltr. jar ) , distil water 7.4 5 ltr. jar , perineal sheet , sodium metabisulfate 500 gm , gentian violet 500 ml , glass slide ( per box ) 100 pcs , saving blade , ecg gel 1 kg , usg gel 1 kg , ab gel , sticking plaster ( surgical tape ) 2.5 cm x 9.10 m , cotton thred no. 10 , surgical uncals utility gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves ( non sterile ) all size ( no. 6.5, 7, 7.5 ) pair , gloves ( nitrile ) all size ( 100 pc / 50 pair ) , shoe covers. ( disposable ) , service gloves 400 mm , mask surgical 3 lyer ( with nose clip ) , mask surgical 3 lyer ( without nose clip ) , n95 mask ( with nose clip ) , n95 mask ( without nose clip ) , mask cotton cloth , duoline repsules , umbilical cathether ( 100 pc ) , nenaton cathether no. ( 6 to 18 any each no. ) , iv set ( disposable ) , povidine iodine solution ( 500 ml ) 5% , povidine iodine solution ( 100 ml ) 5% , povidine iodine gargile ( 100 ml ) , gouze than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , plaster of paris 5 kg jar , surgical sprit 100 ml , urobag disposable 2000 ml , endotracheal tube 2.5 4.5 plain , endotracheal tube couved5 to 12 , hydrogan pyroxide 100 ml , priking needle len set , sanitizer 500ml litre , i v canula size no: 18, 20 & 22 , i v canula no: 24 , savlon ( 100 ml ) each , band aid , malaria kit , bleaching powder ( 25 kg beg ) , kelleys pad each , blood bag , sodium hypochloride , umbilical cord clamp , suction tube plain size no:6 16 , mersilk 2.0, 1.0 cutting needle 90 cm lenth , n / g tube 5, 6 no. , silk thred ( reel ) no: 0 1, 0 2 , pregency kit , spinal needle no: 23 , 24, 25, 26, 27 , ryles tube infant size all , microdrip set , nosogastric tube no. 6 , spirit ( 100% ) ( per 5 ltrs ) , surgical spirit ( 100% ) 5 ltrs jar , nosogastric tube no. 6 feeding tube , plain rubber urinary catheter , curved cutting needle each , gentian violet 30 ml 0.5% , ecg paper ( schller ) ( per pkt. ) , sodium hypo chloride ( 5 ltr jar ) , disposable syring 1 ml , disposable syring 2 ml , disposable syring 3 ml , disposable syring 5 ml , disposable syring10 ml , disposable syringe 20 ml , disposable syringe 50 ml , insuline syringe 40 u , cotton400 gm , micropore 2x9mtr , mucus exatractor , bp blade all size , lysol 400 ml , oxygen mask set ( complete set ) , infusion set with hypodermic needle 21g 1.5 , disposable delivery kit ( ddk kit ) ( content of the kit2 pair of glove blade 1 pc carbolic soap 1 cord clamp 1 plastic sheets 2x2 mtr. ) , intera kit, size 18 / 20 / 22 ( infusion therapy kit ) iv canulla 1 pc, canulla fixatar 1pc, syringe 5 ml 1pc, sterile alcohol swab 1pc, infusion set 1 pc , micro scalp veinset no. 26 ( buterfly ) , formalin ( 5 ltr. jar ) , plain rubber urinary catheter each , mosquito repellent each , curved cutting needle each , cidex 5 ltr. jar , nsv kit , casete with inensifying screen 12x15 ( konica ) , casete with inensifying screen 12x12 ( konica ) , casete with inensifying screen 12x10 ( konica ) , casete with inensifying screen 8x10 ( konica ) , developing tank ( 13.5 ltr. ) , appendectomy bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , developer13.5 ltr , fixture13.5 kg , chest stand flour model , safe flight 8x10 , clip big , half flim bloker 12x15 , half flim bloker 12x12 , half flim bloker 12x10 , half flim bloker 8x10 , x ray film 8x10 ( blue ) ( 50 pc pkt. ) , x ray film 10x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x15 ( blue ) ( 50 pc pkt. ) , cr x ray film 8x10 ( 125 sheet ) make konika , crx ray film 10x12 ( 125 sheet ) make konika , dve x ray film 8x10 ( 125 sheet ) make carestream , dve x ray film 10x12 ( 125 sheet ) make carestream , halothen i.p 0.01%ww , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , ambubag with zero size ( infant ) , triple dye lotion , lead apron , inj. metronidazole iv 100 ml , iv amninovein 10% ( 500 ml ) , iv dextrose 10% 500 ml , iv dextrose 25% 100 ml , iv isolyte p 500 ml , iv n / 4 ns 500 ml , iv dns 0.45% , iv dns 10% , iv dns ( 500 ml ) , iv ns ( 500 ml ) , iv 5% dextrose ( 500 ml ) , iv rl 500 ml , iv rl glass 500 ml , inj. ciprofloxacine iv 100 ml , inj. mannitol 20% 300 ml , hydrocele operation kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalne , cold box with ice pack 6 ltr , cvc catheter uno4, 5, 6 fr lenth 15 / 16, 20 cm , cvc catheter duo7 fr lenth 15 / 16, 20 cm , cvc catheter trio 7 fr lenth 15 / 16, 20 cm , cvc catheter trio 5 fr lenth8 cm , epidural minipacksize no: 16 g, 18g , av fistula needle size no: 15g, 16g, 17g , av fistula needle size no: 15g, 16g, 17g pair , three way stop cock with extention 10, 25, 50 cm , heamodilysis kitdouble size :12fr x13 cm , heamodilysis kittriplesize :12fr x13 cm , sample cup , allicote ( bullete tube ) , liga clip lt 300 , liga clip lt 400 , tube ciller , refrigertor graph paper , calpol suppository , duphalac suppository , ecg lead neonate , paraffin wax , xylene 5 ltr. jar , 100% absolute alcohol 5 ltr. jar , hematoxylene stain , scotts tap water , eosin tap water , hcl 1% , dpx mount 250 ml , scalpel for hpe , blades for scalpel , water bath ( small ) 2 ltr. , staining jar ( coplin jar ) 250 ml , glycerine ( 500 ml ) , glass marker ) , hmf sachet 1 gm , sodium choride ( nacl ) 500 grmper pkt. ) n / 1o , disodium hydrogen phosphgate ( na2hpo4 ) , 500 gm per pkt. , sodium dihydogen phosphate ( nah2po4, 2h2o ) 500 gm pkt. , anthydrous ( k2 hp04 ) 500 gm pkt. ( potassium phosphate dibasci anhydrous , sponin 1000 gm per pkt. , micropippet 200 1000 ul. , micropippet 5 50 ul. , variant ii control ( for hplc machine ) , variant ii sample ( 100x1.5 ml ) vial ( for hplc machine ) , cal a and cal b ( for electrolyte machine ) ( tulip ) , sodium fluoride vail ( non vacuum ) 2 ml ( 100 pc ) , citrate 3.2% vail ( non vacuum ) ( 100 pc pkt ) , urineanalyzer strip ( 10 para ) ( urit 50 biogeny ) , hi aid ( medicated dressing ) 22 mm diameter , vidas t3 1x60 t ( mini vidas ) , vidas t4 1x60 t ( mini vidas ) , vidas tsh 1x60 t ( mini vidas ) , vidas fsh 1x60 t ( mini vidas ) , vidas lh 1x60 t ( mini vidas ) , prolactin 1x60 t ( mini vidas ) , vit d 1x60 t ( mini vidas ) , d dimer 1x60 t ( mini vidas ) , ns troponin i ( mini vidas ) , covid ig g ( mini vidas ) , covid ig m ( mini vidas ) , p.t. vail 1x100 ( mini vidas ) , urine analyzer print paper roll ( urit 50 biogeny ) , cuvette ( for coagulation analyzer ) ( make sysmex ) , p.t. test kit ( for coagulation analyzer ) ( make sysmex ) , control kit ( for coagulation analyzer ) ( make sysmex ) , p.m. kit elx 640 ( erba ) , caliberator kit ( erba ) ( cbc 5 part ) , elite h clean ( erba ) ( cbc 5 part ) , nutrient agar ( 100 ml bottle ) , mackoney agar ( 100 ml bottle ) , grams iodine 250 ml , suffranine 250 ml , ethyle alchohal 95% 250 ml , crystal voilet 250 ml , antibviotic sensitivity dises, amikacine , antibviotic sensitivity dises, cotrimoxazole , antibviotic sensitivity dises, ciprofloxacin , antibviotic sensitivity dises, gentamycin , antibviotic sensitivity dises, bentamycin , antibviotic sensitivity dises, lomefloxacin , antibviotic sensitivity dises, levofloxacin , antibviotic sensitivity dises, norfloxacin , antibviotic sensitivity dises, ofloxacin , antibviotic sensitivity dises, cephalixin , antibviotic sensitivity dises, tobramycine , antibviotic sensitivity dises, moxifloxacin , antibviotic sensitivity dises, ceftodoxime , antibviotic sensitivity dises, nitrofurantion , antibviotic sensitivity dises, clindamycin , antibviotic sensitivity dises, sefeazidime / clavulanic acid , antibviotic sensitivity dises, cefuroxine , antibviotic sensitivity dises, imipenem , turniquat , syrup phenobarbitone , cutting and round body needle medium size each , ctg paper ( per pkt. ) , carbolic lotion 2% , esr tube disposable , cover slip small ( 100x1 pkt ) , rh view box , vial rack , bovine albumin 20% 100 ml , anti h , immerssion oil ( bottle ) , hemosafe sls 1 ltr , test tube 12x75 mm , test tube rack , triglyeerides kit 2x150 ml , esr tube disposable with cap , tri sodium citrate 3.8% ( 500ml ) , a.b.d. ( 3x10ml ) , micro tips yellow ( 1000 pcs ) , micro tips blue ( 1000 pcs ) , widal antigen slide methed ( 4x5ml ) , urea kit 300 ml , tips ( 100 1000ul ) , petridish , tsh ( 1x96 test ) , t4 ( 1x96 test ) , t3 ( 1x96 test ) , liquiplastin ( 5 ml ) , liquicelin e ( 5 ml ) , calcium chloride ( 5 ml ) , hcv kit ( 50 test ) , amylase ( 50 test ) , lipase ( 50 test ) , recombinant factor viii ( 3rd generation dna origin ) 500 iu , recombinant factor viii ( 3rd generation dna origin ) 1000 iu , lh ( 1x96 test ) , fsh ( reagent ) , uric acid ( 5x20 ml ) , call counting machine , esr stand 6 tube capacity , bleading time test , helix pcd test ( conform to iso 13485 1class 2, 121c / 20 min, 134c / 3.5 min, shelf life 3 years after production, clear transition of pink into brown for steam, easy to interpret, easy to document, non toxic / lead free ) , chemical indicator ( shelf life 3 years after production, packed in an easy dispensing carton, clear colour transition of the emulator, non toxic / lead free ) , documentation labels ( process indicators ( steam ) , for steam 121 c 20 min & 134 c for 3.5 min, conform to iso 11140 1 class 1, clear transition of indicatorinto its end color, easy to use labe gun, double labels serve for an easy traceability and document , blood gas analyser card ( edan ) , blood gas analyser paper roll ( for printer ) , iv albumin 100 ml , hcb card test ( 50 test ) kit , rpr card test kit , whole blood finger prick test for hiv ( card test ) kit , sputum container ( per pcs ) , drop bottle ( per 200 ml ) , filter paper ( per 100 pcs pkts ) , cyrstol phenol ( per 500 gram pack ) , ethanol ( per 500 ml pack ) , liquid praffine ( per 500 ml pack ) , basic fuchin powder ( per 25 gram pack ) , urine strip 2 para meter ( 100 test ) , urine strip 4 para meter ( 100 test ) , urine strip 10 para meter ( 100 test ) , tarpin oil ( 400 ml ) , bt filter ( bacteria filter ) , ferittin estimatiry elisa reagent , dropper 3ml plastic , savlon ( 500 ml ) , optimal test kit for malaria test of pv , anti d 10 ml , anti a 1 lactin , anti a 10 ml , anti b 10 ml , anti ab sera 10 ml , edta ( k3 ) non vaccutenor ( 100 pc pkt. ) , plain vial non vaccutenor ( 100 pc pkt ) , cloride vial non vaccutenor ( 100 pc pkt. ) , rh view box , vdrl ( rpr test 100 ) , blood grouping kit , bovine serum albumin , test tube 3 / 4 inch ( 100 pcs ) , calcium 2x150 ml , w.b.c. diluting fluid 500 ml , test tube rack , widal koit span 4x5 ml , v.d.r.l ( shippils test strip one step ) , r.a. ( 1x50 test ) , s.g.pt kit ( 50 ml ) , uric acid kit ( 5x20 ml ) , triglyecride desgpopap ( 25 ml ) , alkaline phospohate ( 5x15 ml ) , leishman stain solution 500 ml , leishman stain solution 250 ml , sodium citrate 3.8% ( 500 ml ) , r.a. antigen ( 100 test ) , glucose antigen ( 2x200 ml ) , uric acid kit ( 20x2 ml ) , distilled water ( 5 ltr. ) , urea bun urease gldh ( 20x5 ) , urea dam mannual kit ( 125 ml ) , cholestral antiigen / kit ( 75 ml ) , hdl kit 50 ml , sgot 150 ml x 2 , total protien 25 test , albumin 25 test , microprotein kit 25 test , crp test kit 25 test , aso titre kit 25 test , urine pot , tips ( 100 1000ul ) , tissue paper ( each roll ) , cretinnine kit ( 50 test ) , billirubin kit ( 50 test ) , e.d.t.a vail 2 ml. ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction , halothen i.p 0.01%ww , thiopentone sodium 500 , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , triple dye lotion , fulcon tube ( 50ml pot ) , mathylene blue ( 25 gram bottle ) , sulphuric acid conc. ( 500 ml bottle ) , phenol crystal ( 500 gram bottle ) , lense cleaning paper ( 100 pcs packet ) , ethanol ( ethyle alcohal ) 100% ( 500 ml bottle ) , sodium hypo chloride ( 5 ltr jar ) , slide staning trey aluminium , slide staining tray plastic , glass staning rode , drop bottle ( 500 ml ) , spirit lamp glass , water bath , slide stand , stain jsb 1 , stain jsb 2 , temephos 50% ec 1 liter , diflubenzuron 25% wp 1 kg , anixide h , spyrometer , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , sputum container ( 50 ml pot ) , glass slide , fulcon tube ( 50 ml pot ) , mathylene blue ( 25 gram bottle ) , sulphric acid conc. ( 500 ml bottle ) , phenyle liquid ( 40% ) ( 5 ltrs jar ) , phenol crystal ( 500 gram bottle ) , d.m. water ( 5 ltrs. jar ) , lense cleaning paper ( 100 pcs packet ) , filter paper ( 100 pcs per packet ) , tissue paper roll , auramin o ( 25 gram pack ) , ethanol ( ethyle alcohal ) 100% , hydro chloric acid conc. ( 500 ml bottle ) , potassium per manganate ( 500 gram bottle ) , basic fuchin ( 25 gram pack ) , liquid parafin ( 500 ml bottle ) , sodium hypo chlorite ( 5 ltr jar ) , slide staning trey plastic , staning stand , drop bottle ( 125ml. ) plastic , spirit lamp glass / ss 4oz. , forcap ( 6 ) ss disecting , water bath 2 rack capacity electrically operated , slide box ( 50 pc slide boxes ) plastic , slide boxes ( 100 pc slide boxes ) , scissor ( 8 ) ss , parmanent marker pen , funnel keep big ( glass ) sz 4 , funnel keep big ( glass ) sz 6 , slide stand aluminium , diluent for cbc machine 20 ltr , lyse for cbc machine 500ml. , cleaner for cbc machine, 5 ltr , cbc reporting paper ( per roll ) , mouth gag ss , test tube rack plastic 12.5mmx24hole , test tube rack plastic 12.5mm x48 hole , test tube rack plastic 15mmx24 hole , test tube rack plastic 15mmx48hole , test tube rack plastic 18mmx48hole , test tube rack plastic 18mmx24 hole , call counting machine ( manually ) 5 key , bleading time test capilary tube , plain rubber urinary catheter each , stainless steel small galley pot 20 25ml. capacity , ecg paper ( schller ) ( per pkt. ) , hydro chloric acid conc. ( per 500 ml ) , crescent knife ( 2.6 ) , keratome ( 2.8 ) , side port ( 15 ) , trypan blue , iol lense pamma lense , viscoelastic hypersole , enteroglemina , ferittin estimatiry elisa reagent , umbilical cathether ( 100 pc ) , halothen i.p 0.01%ww, 250ml. , coppersulphate crystal for chemical cautery of umbilical stump 500 mg, 500gm , drop gsb ear ( 10ml. ) , stainless steel small galley pot each , ahg ( antihuman globulin ) , 5ml. , rh view box , measuring cylinder ( glass ) 100 ml , measuring cylinder ( glass ) 1000 ml , measuring cylinder ( glass ) 2000 ml , beaker glass ( 250 ml ) , bovine serum albumin 5ml. , blood bag single adult / paeditric , anti h lectin 5ml. , testube brush big size , mersilk 2.0, 1.0 cutting needle , lab wash ( 500ml ) , distilled water ( 5 ltr. ) , urea dam mannual kit ( 125 ml ) , microprotein kit 1x50ml. , tips ( 100 1000ul ) big size , glucose ( 1x9x50ml ) , serum bilirubin kit ( 35 test ) , micropipette fixed volume , micropipette variable volume , large microtips ( 1000 pc ) , small microtips ( 1000 pc ) , tissue paper ( each roll ) , call counting machine ( manually ) 5 key , bleading time test capillary tube , filtter paper 9 cm ( 100 pc ) , cappillary tube ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction 4x60ml. , plain vials ( 100 pc ) , floride vials ( 100 pc ) , floride vials non vaccum ( 100 pc ) , edta kj tube ( 100 pc pkt ) , plain vials 2 ml non vaccum ( 100 pc ) , elisa ( hiv ) 4th genrationkit 1x96test , elisa ( hbsag ) kit ( 1x96 test ) , elisa ( hcv ) kit ( 1x96 test ) , elisa ( malaria ) kit ( 1x96 test ) , rpr latex kit ( 250 test ) , rapid ( hiv ) kit , rapid ( hbsag ) kit , rapid ( hcv ) kit , rapid ( vdrl ) kit, syphillis card test , rapid ( malaria ) kit , anti ab reagent 10 ml , anti ahg reagent 5ml , cupling jar plastic 5 slide cpacity , shalis method hb meter , gel card , ahg ( for cross match ) , gel card grouping ( forward & reverse ) , gelcard machine 8 card with warmer , gelcard machine 24 card with warmer , liss solution , labozent 500ml. , plastic tub , pasteur pipette , apron ( lab coat ) , tube sealer ( portable ) , glucon d 100gm , emergency medicine box , centifuse machine 16 channel r8c model , chemical balance machine , hot air oven , pap smear ( cyto brush +spetula ) , glass slide pkt of 50 , eosin stain yelllow 100 ml , heamotoxilline harris 500ml , isoprofile ( propen 2 ol 500ml , autoclave lable , tournicate valcro , antibiotic disc , culture plate disposable90 mm , culture plate glass 100 mm , maconkey agarv powder 500gm , maconkey agarv powder 100 ml , grams iodine100ml , grams iodine powder , cristel violate100ml , cristel violate powder 25gm , sodium citrate vial ( pt vial ) non vaccum , sodium citrate vaccum , alliequet vial , trop i , trop t , amkitdw plant , pm kitdw plant , phosphorus 10x12 ml , gamma gt 2x44 / 2x11ml , magnesium 2x44ml , uibc 125ml , ldh 2x44 / 2x11ml , serrum iron 125 ml , lipase 1x44 / 1x11ml , amylase5x22ml , ferritin , ferritin calibrator , ferritin control l , ferritin control h , erythromoietin , urine pot 30 ml , petridish 90 mmg ( titan biotech ) , blood agar ( titan biotech ) , maconekey agar ( titan biotech ) , muller hilton agar ( titan biotech ) , urea broth base ( titan biotech ) , distillwater , conical flask 100 ml , conical flask 500 ml , cotton roll , nichrome loop 2 mm with holder , amikacin antibiotic disc ( titan biotech ) , ampicillin antibiotic disc ( titan biotech ) , ampicillin + sulbactam antibiotic disc ( titan biotech ) , cefoxitin antibiotic disc ( titan biotech ) , ceftazidime antibiotic disc ( titan biotech ) , ciprofloxacin antibiotic disc ( titan biotech ) , colistin antibiotic disc ( titan biotech ) , co trimoxazole antibiotic disc ( titan biotech ) , doxycilline antibiotic disc ( titan biotech ) , erythrmycin antibiotic disc ( titan biotech ) , gentamicin antibiotic disc ( titan biotech ) , imipenem antibiotic disc ( titan biotech ) , levofloxacin antibiotic disc ( titan biotech ) , linezolid antibiotic disc ( titan biotech ) , meropenem antibiotic disc ( titan biotech ) , nitrofuran tion antibiotic disc ( titan biotech ) , norfloxazacin antibiotic disc ( titan biotech ) , piperacillin antibiotic disc ( titan biotech ) , polymyxin b antibiotic disc ( titan biotech ) , teicoplanin antibiotic disc ( titan biotech ) , tetracycline antibiotic disc ( titan biotech ) , vancomycin antibiotic disc ( titan biotech ) , cefazolin antibiotic disc ( titan biotech ) , tobramycin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , aztreonan antibiotic disc ( titan biotech ) , cefepime antibiotic disc ( titan biotech ) , cefoperazone antibiotic disc ( titan biotech ) , sparfloxacin antibiotic disc ( titan biotech ) , azithromycin antibiotic disc ( titan biotech ) , ofloxacin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , triple blood bag , double blood bag , quadruple bag , penta bag , apheresis kit , acd solution for apheresis , total protein kit of colorimeter , iodine solution , height measurement scale , observation table , graph paper and pencil, ( remi, model no br 300 ) , graph paper and pencil, ( penpol, model no br 360 ) , graph paper and pencil df ( 300l ) terumo pcnpof , graph paper and pencil pdv 360 ultra re , double pan balance weight ( non digital ) , urinometer , hydrometer , copper sulphate , prothrombin time reagent , fibrinogen reagent , aptt kit , york scientific ( modal ysi 572 ) , digital weight machine ( 150 200 kg ) , measuring cylinder ( 1000 5000ml ) , gal card machine for blood grouping and cross machine , warmer for gel card machine , weighing scale , wall bp instrument , blood collection monitor , portable donor couch of stainless steel with z mattress , rh view box , protable tube sealer battery operated , stripper for blood withdrawal , carry box for blood ( 50 bags ) , carry box for blood ( 100 bags ) , portable o2 cylinder , reagent refrigerator model number ( br360 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , reagent refrigerator model number ( br300 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , blood culture bottles ( a ) gloucose brothe w / 0.5% sps ( blood culture bottle ) ( b ) glucose broth w / 0.5% sps ( blood culture bottle ) ( titan biotech , anaerobic jar ( titan biotech ) , l.j. medium slant ( 10 slants ) ( titan biotech ) , antibiotic discs , nichrome loop 2mm with holder , petridish 90 mm ( titan biotech ) , grams stain kit ( titan biotech ) , nutrient agar ( titan biotech ) , maconkey agar ( titan biotech ) , zn staining kit, zn acid fast stain kit ( titan biotech ) , sprit 500 ml , betadine solution 500 ml , hand wash 250 ml , mask surgical , hand cap , viscolon 5 ml , lox 2% inj. , anawin inj. , dispoven 3 ml , dispoven 5 ml , dispoven 10 ml , dispoven 3 ml , eye dress eco , eye drape poly , honide ( eye drop ) , moxiflox ( eye drop ) , inj. hyni dase , surgical blades , eye instrument set , surgical instrument trolly , blood gluco test stripes , iol lense 22 no , iol lense 21.50 no , iol lense 23 no , gentamicin inj , dexona inj. , cap. amoxycillin 500 mg , tab. ranitidine 150 mg , tab. dicyclogin ( h ) , tab. calcium d3 , tab. misoprost 200 mg , syp. multivitamin 100 ml , inj. dilona , inj. oxytoxin , betadine ointment , cord clamp ( apex ) , surgical gloves 6.5 , d syringe 5 ml , d syringe 2 ml , inj. ceftrizone + salbactum 1.5 gm , inj. randidine 2 ml , inj. diclofenac sodium 3 ml , inj. ondem 2 ml , tab. amoxicilin + clavunate 625 mg , tab. aceclofenac + pcm+ serratiopeptidase , cap. omeprazole 20 mg , micropore 3 , betadine oint 15 gm , bandage 4 , syringe 10 ml , vicril 1 no. 180 cm with needle , catgut 2 no. , catgut 1 no. , gloves 6.5 no. , gloves 7 no. , folys cathethar 16 no. , urine bag , bp blade 22 no. , inj. ranitidine 3 ml , inj. diclofenac 3 ml , inj. bupicane , inj. perinorm , syringe 5 ml , syringe 3 ml , inj. pantazocin 1 ml , inj. oxytocin 1 ml , intra cath 18 no. , cord clamp ( apex ) , inj. ceftrazone 1 gm , inj. methargin 1 ml , inj. anamine 4 ml , spinal needle 25 no. , edta tube ( double cap ) , sodium fluoride tube ( double cap ) , erba auto wash kit , erba norm kit em 200 , erba multical ( erba path kit code 120221 ) , urine sprip ( 7 parameter ) , erba h 360 lyse , h 360 diluent , microtipes samllest 10 to 100 , anti abo ( arkray ) , widal , erba tsh , blood glucose ( semi autoera ) , blood urea ( semi auto erba ) , uric acid ( semi auto erba ) , alkline ( semi auto erba ) , bilirurin ( semi auto erba ) , crp ( semi auto erba ) , glocose hexokinase ( erba em 200 ) , alkaline ( erba em 200 ) , albumin ( erba em 200 ) , protien ( erba em 200 ) , creatine ( erba em 200 ) , urea ( erba em 200 ) , uric acid ( erba em 200 ) , triglyceride ( erba em 200 ) , hdl ( erba em 200 ) , calcium ( erba em 200 ) , medsource hbsag kit , pop cast 2 inch , pop cast 4 inch , pop cast 6 inch , pop cast 8 inch , soft roll for ortho cases 2 inch , soft roll for ortho cases 4 inch , soft roll for ortho cases 6 inch , soft roll for ortho cases 8 inch , inj. piptaj 4.5 g , inj. rantac , trulon 1 no , trulon 2 0 , mersilk 1 no , dynaplast...

State Livelihood Promotion Society - Jharkhand

37658900 supply of office stationery , name of the items : ( package i ) , binder clip 19mm , attendance register ( no 2 ) , binder clip 25mm , binder clip 32mm , binder clip 41mm , binder clip 51mm , both side addehisive tape 2 inch , brown tape ( big ) , calculator 12 digit , calculator 12 digit , carbon sheet , cash book ( 2 quire ) ) laser paper , cash book ( 3 quire ) ) laser paper , cello tape white 2 inch , chart paper different colour 90 gsm , chisel marker , cloth envelop ( size 33x25cm ) good quality , cloth envelop ( size 40x30cm ) good quality , cobra files , colour photocopier white paper 75 gsm ( a4 size, packet of 500 sheets ) , coloured flag paper , coloured flag plastic , copy long size with 100 pages 30*20 ) laser paper , copy long size with 50 pages 30*20 ) laser paper , cover file ( water proof, good quality ) , double punching ( big ) hdp 2320 , double punching ( big ) no 480 , double punching ( big ) no 600 , fevi stick ( 15gm. ) , fevi stick ( 25gm. ) , fevicol 100gm , fevicol 50gm , file tray , fixed assets register 1 quire , flash card ( cutting chart paper 15 x9 cm ) , flip note ( indicator note ) , gems clip plastic , gems clip steel , generator logbook , gum bottle 300ml , gum bottle 700ml , highlighter pen , i card cover ( goj ) size 10.5*15.5 , index / alphabetic register ( 1 quire ) , index / alphabetic register ( 2 quire ) , jute thread , leaf files ( good quality ) , legal size xerox paper , letter dispatch register 2 quire , letter receipt register 2 quire , liver arch file, big size , meta card ( cutting chart paper ) , note sheet ( a4 size, packet of 500 sheets ) , notebook ( spiral ) 50 pages , notice board pin , office paper tag | treasury file tag | indexing tag ( 8 inch ) ( 100 pieces, red & white ) , paper cutter knife with blade. , paper pin t shape , paper weight , pen ( ball pen mrp rs.10 ) , pen , pen , pen , pen , pen , pen , pen , pen stand , pencil battery modal aa , pencil battery modal aaa , pencil dark black. ( hb ) , pencil eraser ( dust free ) , pencil sharpener , peon book ( copy size ) , pages 100 , permanent marker pen ( black / blue ) , photocopier white paper 75 gsm ( a3 size, packet of 500 sheets ) , photocopier white paper 75 gsm ( a4 size, packet of 500 sheets ) , photocopier white paper 75 gsm ( legal size, packet of 500 sheets ) , photocopier white paper 80 gsm ( a4 size, packet of 500 sheets ) , plastic folder button file , plastic folder button file double sided , plastic folder , register ruled ( 2 quire ) laser paper , stock register, rolling, size 20 ( good quality ) , register ruled ( 3 quire ) ) laser paper , register ruled ( 4 quire ) ) laser paper , register ruled ( 5 quire ) laser papper , ribbon , ring file , safety pin , scale 30c. size ( glass ) , scissors big , scissors medium , scissors small , single hole punching machine , stamp pad ink ( black / blue / violet ) , staplerhp 45 , stapler ( 10 ) , , stapler ( 10d ) , , stapler pin ( big ) , stapler pin ( small, cupper / steel ) , stick file ( plastic ) , stock register, rolling, size 20 ( good quality ) , thermocol sheet , visitor register , white board cum green board ( 4 x 6 ) , white board cum green board ( 2 x 3 ) , white board duster , white board marker pen , white / brown envelop with good quality paper ( size: 11” x 5” ) address of jslps dmmu hazaribag, to be printed in bi colour. , white / brown envelop with good quality paper ( size: 6” x 4” ) address of jslps dmmu hazaribag to be printed in bi colour. , writing pad ( 25 cm. x 18.5 cm. 50 pages ) , writing pad ( 25 cm. x 18.5 cm. approx. with spiral binding ) multi colour printing in the cover page., 100 pages ) , writing pad ( 25 cm. x 18.5 cm. approx. with spiral binding ) multi colour printing in the cover page., 50 pages ) , writing pad ( 25 cm. x 18.5 cm.50 pages ) , writing pad ( 25 cm. x 18.5 cm.100 pages ) , yellow dusting cloths ( 10 pc. in pkt. ) , notice board , paper pin u shape plastic coated , computer stationery items ( package ii ) , antivirus three user with three year free up gradation , xerox toner cartridge for phaser 3010 , cartridge hp mfp 436nda ( 56a / 56x ) , cartridge ( canon npg 59 2202n ) , cartridge kyocera task alfa 2201 ( tk 4109 ) , dongle ( 4g universal connect users / devices through wi fi 4g lte and 3g bands supported, micro sd card slot ) , cd marker , cd , extension cord size name: 2.5 x 13 , computer cartridge for hp laser jet m1005 mfp original , computer cartridge for hp laser jet m1005 mfp original , computer cartridge for laser jet hp printer ( hp p1007 ) , computer cartridge for laser jet hp printer ( hp p1007 ) , computer cartridge for laser jet hp printer ( hp p1007 ) , computer cartridge for laser jet pro mfp m226dw , mouse pad , pen drive ( 64 gb capacity ) , pen drive ( 128 gb capacity ) , hdmi cable c pin , mouse , hard disk drive, 1tb , keyboard with wire...

Health Medical Education And Family Welfare Department - Jharkhand

37512662 bids are invited for ppiucd insertion forceps (q3) , near vision chart (q3) , mask neonatal (q3) , allis forceps is:7388 (q4) , sponge holding forcep (q3) , examination lamp (q3) , labour table with mattress (q3) , stretcher trolley (q3) , cusco speculum (q3) , cord cutting scissor (q3) , sims speculum (q3) , suture needle curved (q3) , mouth gag (q3) , basin 825 ml ss (q3) , vision chart (q3) total quantity : 2950...