Health Department - Jharkhand

39485354 supply for office stationery, equipments etc. , items names : , executive chair , revolving chair , study chair , office table , almirah ( for office use ) , glass almirah , journal rack , computer table , dinning table set ( 1 table + 6 chairs ) , dinning table , lab table , examination table , stool steel chair , bed side locker , single bed ( for hostel ) ( double decker ) , almirah , chair , table , needleholder : , 6 , 7 , 8 , suture cuttingscissors , sutureneedle : , straight , curved , mackintosh roll : , full bed length ( qtyin meters ) , draw mackintosh , extra for treatment and dressing , hot water bag , ice caps , ice collar , corrugated rubber sheet , gloves different sizes , catheters : , urinary catheters , foleys catheters , nasal catheters , plain catheters , rectal catheters , finger stalls different sizes ( set ) , air rings , mucus sucker , breast pump , nipple shield , gastric lavage tube , ryles tube , flatus tube , blakemore sange staken tube , rubber tubes with different diameter and size , rectale syringe with nozzle , ring pressories each size , douche nozzle different sizes , mortar and pestle , nelsons inhaler , spirit lamp , test tube stand , test tube holder ( in dozen ) , sterilizer small , portable autoclave , weighing scales , adult weighing scale , baby weighing scale , back rest , splints different sizes , i. v .stand , microscopes , sphygmomanometer ( mercury ) , a regular ( dial ) , b electronic ( digital ) , stethoscope , over bed table ( cardiac table ) , screens / bed side curtains , three way adapter , mattress: , adult , child , mattress cover: , adult , child , bed sheets , baby cot sheets , draw sheets , sandbags with covers , sponge cloth , hot water bag covers , ice cap covers , air ring / cushion covers , gowns masks , patient s clothes: , male ( set ) , female ( set ) , baby dresses of different sizes ( set ) , diapers different sizes ( set ) , trolley cover , dirty linen bag / box , leggings ( pair ) , perineal sheets , triangular bandages , many tailed bandages , eye shields , dusters , slings , t binder , screen curtains ( set ) , adult human articulated skekelton with hanging facility in a glass cupboard with locking facility. , full set of dis articulated human skeleton. , full size human body showing all muscles and articals , human torso : , male , female , skin cross section , heart and large blood vessels , heart with detachable parts on a stand , eye with different sections , ear with different sections , human brain with spinal cord , lungs and trachea , larynx , digestive system: , stomach , female reproductive system: , uterus on stand , male reproductive system , urinary system: , kidney: , joints and ligaments: , wrist , elbow , shoulder , ankle , knee , hip , teeth , skeleton system , muscular system: , showing different muscles of the body , joints and ligaments: , nervous system: , brain , cardio vascular system , respiratory system , lungs , trachea , larynx , digestive system , oral cavity , teeth , stomach pancreas and spleen , small intestine , large intestine , liver and gallbladder , kidney macroscopic structure , skin , eye , ear , female reproductive system , menstrual cycle , male reproductive system , endocrine glands , first aid for burns , cardiac pulmonary resuscitation: , adult , children , infant , first aid charts or emergencies such as fracture, drowning, wounds, poisoning, bites ( each ) , stages of development of embryo ( set ) , female bony pelvis , foetal skull , female dummy ( zoe model ) / obstetrical training with doll , placenta , full size fetus , new born baby , baby cradle , breast changes in pregnancy , uterine changes in pregnancy showing height of uterus at different terms of pregnancy , stages of labour , first stage , second stage , third stage , breech presentation , complete breech , incomplete breech , foot presentation , shoulder presentation , face presentation , brow presentation , twin pregnancy , placenta previa different stages , caput succedaneum, cephalhaematoma , congenital malformation of new born: , cleft lip palate , spina bifida , hydrocephalus , anencephalus , all in one computer set , laptop , xerox machine , color printer , air conditioner , lcd projecter , lcd screen , over head projecter , community health nursing for anm , community health nursing for anm ( hindi ) , health worker keliyepathyapustak , community health nursing ( samudayikswasthvigyan ) ( hindi ) , nursing manual of nutrition and therapeutic diet , essentials community health nursing in hindi , where there is no doctor a village health care handbook , where there is no doctor hindi , mecical surgical nursing , fundamentals of nursing , principal & practice of nursing , health promotion for anm , aaharavumposhan , text book of anatomy & physiology for nurses , anatomy & physiology anotomy and physiology for nurses ( sharirrachanavigyanevamsharirkriyavigyankewalnursonke live ) ( hindi ) , prathamiksahayataevamsankatkalindekhbbal ( hindi ) first aid and emergency care , manual of first aid ( prathamikupcharka manual ) ( hindi ) , health promotion , nurse keliyemanovigyanavumswasthya , psychiatric meantal health nursing , text book of microbiology for nurses , sukhamjivvigyankipathyapustak ( text book for microbiology for nurses ) ( hindi ) , primary health care nursing for anm , psychology and sociology for anm and bt students , nursing arts proceduces ( nursing kemoolsidhanth ) valume i ( hindi ) , fundamentals of nursing ( hindi ) , senior nursing procedure ( nursing kemoolsidhant volume ii ( hindi ) , sociology for nurses , pharmacology for nurses , medicine kipathyapustak , baal swasthya nursing for anm , child health nursing for anm ( hindi ) , quick look nursing pathophysiology , comprehensive manual of pediatric nursing procedures , pediatric nursing , english for nursing , textbook of computer in nursing , textbook of obstetrics , midwifery & gynecological nursing ( hindi ) , maternal & neonatal nursing care plans , midwifery for anm , midwifery and gynecological , nursing ( hindi ) , manual of midwifery procedures , pedicatric nursing care plans , cumulative record for general nursing midwifery course , health centre management , imnci module for basic health worker , chart booklet , simplified partograth ( big size ) , family planning , journal of midwifery, women health &gynaecological nursing. , journal of community & social health nursing , patient cots adult , child , bed side locker , revolving stools / chair , manikins for demonstrating nursing procedure: , adult male imported , adult female , child manikin , new born , cpr ( full body ) , trays different sizes: , 24x16 , 14x10 , 11x9 , 8x5 , trays with cover assorted sizes , bowls: , 16diameter , 10diameter , 4diameter , 2 3diameter , bowls with cover , 6diameter , 4diameter , enema can , 1 1t. capacity , 1 / 2 1t. capacity , kidney trays of assorted sizes ( big ) , measuring jugs , 1000 ml. , 500 ml. , 250 ml. , assorted size basins , catheter dish with cover , knife dish with cover , feeding cups , douche can , sputum mugs , bed pans , urinals male , funnel: , 4diameter , 2diameter , jars with covers: , 12x8 , 6x4 , dressing drums: , 8x4 , 12x9 , tub for sitz bath , saucepan with lid: , 1 1t. capacity , 2 1t. capacity , kettle: , 1 1t. capacity , 2 1t. capacity , trolleys with upper and lower shelves ( without steel top ) , pint measure , gallipots , mugs , bottle brush , cheatle forceps , sponge holding forceps , artery clamps: , straight 6 , curved6 , dissecting forceps: , toothed , non toothed , mosquito forceps , kocher’s , scissors: , surgical 8 , bandage , mayos cutting scissors , tissue forceps , sinus forceps , biopsy forceps , liver biopsy needle , alice forceps , probe , groove director with probe , mouth gag , tongue depressor , tongue holding forceps , nasal speculum , aural speculum , re tractors: , single hook , double hook , bladder sound , male urethral dilator ( set ) , packing forceps: , nasal , oral , ear irrigation syringe , ear speculum , shaving set , safety razor with blades , bard parker knife handle , surgical blades different sizes set ) , catheters , airway , laryngoscope: , paediatric , adult , proctoscope , infusion set , autoscope , ophthalmoscope , tracheostomy set with various size of tracheal tubes ( set ) , head mirror , tanning fork , oxygen cylinder with stand , oxygen mask , measuring cups: , 240ml. , 120 ml. , 30 ml. , undine , eyebath cup , pipettes & droppers , glass connection: different types e.g. y.t.l. ( each ) , wolfs bottle , conical flasks , ounce glass , dram glass , thermometers : , oral , rectal , bath , room , lotion , pulse meter , urinometer , lactometer , heamoglobinometer , specimen glasses , test tubes ( dozen ) , glass slides with cover ( box ) , bottels500 ml. capacity for lotion and mixtures , automizer , manometer , glucometer , head mirror , tuberculin syringe , insulin syringe with needle , needle all sizes ( one dozen each ) , lumbar puncture needle , trochar, cannula for abdominal paracentesis , i.v. cannula different type sand sizes , biopsy needle : , adult , children...

Health Department - Jharkhand

39468446 supply for materials supply for materials and medical equipments , equipments name: , hospital seat bed , semi flower bed with ms side rail , flower bed with ms side rail , hospital i.c.u bed , hospital bed matress , hospital pellow , hospital sline stend , hospital bed side locker , hospital 3 fold screen , hospital strecture on trolly , pediatric bed , pediatric flower bed , ecg machine computerized , ventilators ( adult ) , pulse oxymeter , a.c1.5 ton 5 star with fitting , a.c 2ton 5 star with fitting , stabilizer automatic for ac double phase 5 kva , stabilizer automatic for ac double phase 3 kva , b.p apparatus stand model (isi mark) , stehoscope (isi mark ) , thermometer ( isi mark) , ecg paper roll cardiart gen x 3 cardiart 6208 view , suction machine , foetal doppler ( pocket doppler ) , foetal doppler ( tabple top ) , r o water machine , autocalve double drum , kidney tray big , curve kocher clamp , iv set ( adult ) , uro bag , sanitary pads , focus light , plastic apron , shoe cover , disposable cap , rubber sheet , eb x49 xga projector brightness: 3600lm with hdmi port (optional wi fi) , dustbin with lid 30 ltr. , hub cutters ( mannual ) , hub cutters ( electric ) , water container ( steel 20 ltr) , stools for immunization room (steel ) , torch light 4 cell , air rotor , bed pan (ss) , coolers big (isi mark) , table cloth , double door 308 litres 5 star refrigerator , 205 l direct cool single door 5 star refrigerator , chromic catgut 1/0no , chromic catgut 2/0no , chromic catgut 3/0 no , shadoless cellar light led , mersilk 1/0 no , mersilk 2/0 no , surgical instrument set , foelys cather 14 no , foelys cather 8 no , foelys cather 10 no , foelys cather 16 no , foelys cather 18 no , disposable syringe 3 ml , disposable syringe 10ml , disposable syringe 5 ml , disposable syringe 20 ml , b.p blade ( 15 no. ) , b.p blade ( 20 no. ) , b.p blade ( 22 no. ) , spinal needle 25 no , skin hook single , skin hook double , foreign body remover , foreign body extractor , needle holder ( big) 9’’ , needle holder ( small ) 6’’ , tooth forceps , plainforceps , scissors mayo’s ( 7’’ & 9’’) , scissors ( suture cutting ( 7’’ & 9’’) ) , b.p handle no 3 , b.p handle no 4 , surgical spirit 500 ml , scissors 8’’ , pen elkos first , handi palast ( round ) , lifter , intrument sterliser ( electric ) small , intrument sterliser ( electric ) medium , intrument sterliser ( electric ) large , arteriforcep medium straight , arteriforcep medium curve , arteriforcep large , elices forceps , niddle holder 8’’ , abdominal retracter small , abdominal retracter medium , abdominal retracter large , doins retracter , bone lever small , bone lever large , bone holdinyforcep small , bone holder forcep large , periostium elevator , pop 50 kg drum , towel clip , k wire1 , k wire1.5 , k wire2 , ss – wire 20 , ss – wire 22 , ss – wire 24 , k – nail all size , v – nail , sq – nail , cotton roll 400gm nett. , cotton roll 100gm nett. , kit kath 16 no , kit kath 18 no , kit kath 20 no , kit kath 22 no , kit kath 24 no , bandage 6 inch , bandage 4 inch , gauze than , green cloth , cotton bed sheet , blanket ( 4x 6 )2.5 kg , blanket ( 4x 6 )3 kg , carpet ( dari )( 30/ 30) , bp instrument electronic chargeable , glucose meter (isi mark) , hemoglobin test machine , stethoscope (isi mark) , thermometer genral , x ray view box large size , pulse oximeter , blood bag ( singal ) hl , hiv rapid card aspen , hbsag papid card aspen , hcv rapid card aspen , para hit total (mp) , r.p.r test card aspen , r.p.r test strip aspen , blood group kit (abd) arkary , anti ab arkray , anti human globulin arkray , 22% bovine albumin arkray , hiv elisa kit , hbsag elisa kit , hcvelisa kit , hiv rapid card retroquik , hbsag rapid card hepaview , hcv rapid flaviscreen , refrigerator digital thermometer , blood bag collection monitor , glass slide blue star , distilled wateer , sodium hypochlorite solution. , khan/khans test tube borosil , copper sulphate crystal , lancetblood , dobule cap e.d.t.a tube , khan/khans test tube stand 60 hole plastic , colorimeter , digital weight machine baby , digital adult weight machine , b.p machine ( mercury ) , elisa processor transasia elan 30 s , pumping ball/smiley ball , electric insects killer , elisa reader , elisa washer , autoclave electric vertical( pressur & temp display) , blood bag tube sealer , drabkins reagent , measuring cylinder 50ml , hydrometer ( specific gravity ) , pippet stand , cuvette ( for colorimeter) , needle destroyer ( electric ) , blood bag storage refrigerator , blood bag storage refrigerator thermofisher 650 ltr. , hydrogen peroxide 500 ml , hydrogen peroxide 100 ml , ec( 500 ml ) , stirrup pump ( ddt spray machine ) , cotton roll 25 gm nett. , cotton rol l 50 gm nett. , cotton roll 200 gm nett. , cotton roll 400 gm nett. , crepe bandage 6’’ , crepe bandage 4’’ , office table t9with two drawer , examination table , office table t104( three drawer ) , office table t8both side drawer , patient stool revolvingtable , impres table 1800mm , premium visitor chair with full arm , chair ch7b , laseda high back chair , sedna high back chair , bandage 6 , bandage 4 , revolving chair with arm , barvo high back chair , computer table c3d , strowel plain (almira 20 gauge )7’’/3.5’’ , strowel plain (almira 20 gauge )4’’/3.5’’ , steel rack 6’’/3’’ ( 5 rack ) , mattrics 3 seeter chair with arm , mosquito net small , mosquito net medium , mosquito net large , xerox machine (mp 2014) , didital ups eb 1650 ah inverter with inva tubular battery 220 ah , computer i3/11 gen/ 8 gb ram / 512 gb ssd rom/ windows 11/20” display/web came , • printers • laser printer • m438nda laserjet a3 monochrome all in one printer with network, duplex & adf , scannerlide 120 , coolers big ( isi mark ) , pillows covers , pillows , wire cutter , digital x ray machine 100ma , pen drive 32gb(hp) , pen drive 16gb(hp) , floor duster with handle , plastic chiar , epson ecotank m3170 wi fi all in one monochrome ink tank printer ith adf & duplex , computer table , office table size 4ft x 2.5ft double drawers , office table size 3ft x 2ft single drawers , laptop core i5 12th gen. 8gb ram, 1tb/ssd hard disk/ 2gb graphics, windos 11 , 3.8% sodium citrate solution 500 ml , abo & rh(anti ab&d) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent gauze than 18 m x 90 cm special , adenosine , airway 0 no. , airway 1 no. , airway 2 no. , airway 3 no. , airway 4 no. , ambu bag adult , ambu bag pediatric , ambu bag neonatal , apron , aso latex (span) (20 pcs) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , baby cap , baby dress , baby socks , baby tag , barium chlorine 500 ml , bendicts solution 500 ml , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blood bag350 ml , blood bag 100 ml , botroclot 10ml , bovine albumin 22% (5 ml) , bt set , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 24 no , cannula 26 no , capillary tube , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , cleansole , color coded bins black 20 litre , color coded bins black 40 litre , color coded bins black 60 litre , color coded bins black 80 litre , color coded bins blue 20 litre , color coded bins blue 40 litre , color coded bins blue 60 litre , color coded bins blue 80 litre , color coded bins red 20 litre , color coded bins red 40 litre , color coded bins red 60 litre , color coded bins red 80 litre , color coded bins yellow 20 litre , color coded bins yellow 40 litre , color coded bins yellow 60 litre , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , lam/i gel 01234 , lancet (100 pcs) , leishmans stain (500 ml) , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malaria pf/pv antibody card rapid test (50 kits) , malaria pf/pv antigen card rapid test (30 kits) , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , memantine , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micropore 1 inch , micropore 1/2 , micropore 2 , mucus sucker , iron bed , mattress 3x6 , foot step , dustbin plan , hydraulic bed , bucket , bed side screen , test tube (khan tube) , test tube (khan tube) 2.5 3 ml , test tube (khan tube) 3 4ml , test tube holding clamp , test tube rack , thiopentone , thrombophob ointment , tissue paper roll , tourniquet , color coded bins yellow 80 litre , cord clamp , cotton roll 400gm nett , cotton thread , cover glass (100 pcs) , cpr (latex) (20 pcs) , creatinine(creast) (35 pcs) , crescent blade disposable , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1ltr , distilled water 5ltr , donepezil , duolin respules , ec (700 ml) (agrawal) , ecg jelly , edta vial , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , enoxaparin , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , g.v. paint lotion 400ml , glacial acetic acid (500 ml) , glass slide (100 pcs) , gloass rod , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer strip , glucometer (ozocheck) , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hbsag card rapid test kit (50 pcs) , hcv rapid (30 kits) , heavy duty gloves , hiv card rapid test (50 kits) , nasal prongs (neonats) (cannula) , needle straight , new born diaper , oxygen mask adult , oxygen mask child , paraffin mesh , pedia set , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial , pottasium permagnate (400gm) , povidone iodine lotion 500ml , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pyrethrum extract 2% , rhyles tube16 no. , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , saline set , shoe cover disposable , side port disposable , slide dying rack , sodium calcium hypochloride (5 litre) , spirit 100 ml , spirit 1000 ml , spirit (methylated) 1000ml , sprit lamp , stritching thread , suction catheter , suction tube6fr , suction tube 8 fr , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , uro bag , vdrl (strip) , vdrl (syphilis) card rapid test (100pcs) , vdrl rapid card , vdrl rapid latex , vicryl(1 0) , vicryl1no , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl (2 0) , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , yellow tips for micropipette , temophos 25 ltr , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , swab , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , towel (24x18) , plastic mug 1 ltr , plastic bucket 20 ltr , anteseptic soap 75 gm , plastic sputum container with sticker , lence paper , potasium per magnate , zipper pouch , falcun tube , oxygen regulator with flow meter , non chlorinated biohazard bags black size 80kg , non chlorinated biohazard bags blue size 80kg , non chlorinated biohazard bags red size 80kg , non chlorinated biohazard bags yellow size 80kg , non chlorinated biohazard bags black size 2litre , non chlorinated biohazard bags red size 2litre , non chlorinated biohazard bags black size 40kg , non chlorinated biohazard bags blue size 40kg , non chlorinated biohazard bags red size 40kg , non chlorinated biohazard bags yellow size 40kg , hemogllobin test kit , hemogllobin test strips , lancet , glucometer , glucometer strips rate per pc , urine strips , hiv and syphilis test kit , hiv test kit , syphilis test kit , sickle cell rapid test kit , iodine test kit , hbsag test kit , filariasis test kit , malaria test kit , sanitary pad , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , oxygen cylinder small , oxygen cylinder medium , oxygen cylinder large , tubular battery 220 ah , ambu bag , eletric automatic unicron demmart star dental chair , dental x ray machine , vatech rvg sensor , desktop & color printer , dentail air compresor , auto clave , ultrasonic scalerhand pic walldent , waldent digital glass bed sterlizer , gdc extraction forcep kit set of 12 , gdc root elevator set kit10 , local anesthesia with aderenaline , dental micro moter with straight contra hand pic , walldent pro dental set 15 , mask , waldent dental lead appron , dental patient drape , gdc surgical curettee 3 (186) , air rotor handpic 2 lead (nsk) dyna , type 1 glass ionomer restorative , type 2 glass iconomer restrative , waldent composite kit , ewaldent eco plus light curring unity 2 , waldent endomeeter hand pic esw 2 , super endogald hand portopear file ( pack og of ) , waldeent flexgald rotry file 21 mm 25 mm , waldeent h hand file gald rotry 21 mm 25 mm , waldent e dta gutta percha paint 6% , waldent seal pexrin baid roat camal sealing matrial , raund barrel , stat barrel , farama cresal , calsium hydroxide podear 10 , saliva ejector , un chamber with 12 tray , gownpreparatior kit , endo2 bur , flish box , dj 16 , k hhand file , k file 6 to 15 , k file 8 to 15 , micro tourch & gas , skin mirar , mouth mirror , dental probe , dental twerer , dental cement carrier , steel visitor chair , transmittance / absorbance photometry based digital haemoglobinometer with auto / self calibration (no manual code / chip insertion) and 0 25gm/dl , strips / cuvette compatible with above digital haemoglobinometer , fad gdh enzyme based glucometer strips (1 glucometer free on 1,000 strips) , boronate affinity chromatography method based hba1c glycated haemoglobin analyzer with inbuilt bluetooth for wireless data transfer, in built rechargeable battery and weight less than 100g , strips compatible with above hba1c glycated haemoglobin analyzer , reflectance photometry based lipid analyzer for measuring tc, hdl, tg, ldl & tc / hdl ratio and inbuilt bluetooth for wireless data transfer , strips compatible with above lipid analyzer , auto disable / safety lancet (28g) with ec declaration of conformity / usfda & iso 13485:2016 , nt probnp rapid card , vitamin d rapid card , troponin i rapid card , troponin t rapid card , point of care device for hemoglobinopathies (sickle cell &? thalassemia) testing , point of care rapid test kit for sickle cell anaemia and beta thalassemia screening compatible with above device , portable automated abrneonatal hearing screeningdevice : based onbrainstem evoked response audiometry (bera) method batteryoperated device high sensitivity and specificity (more than 97%) test time: less than 5 minutes usb port and wi fi enabled non invasive and easy to use easy interpretable report: pass, refer and redo as the result validated and recommended by icmr (indian council of medical research) & department of health research (dhr) ministry of health,government of india...

Employees State Insurance Corporation - Jharkhand

39275745 bids are invited for disposable surgical items mse cloth adhesive tape 5 cm , bandage roller 2 inch , bandage roller 4 inch , bandage roller 6 inch , cotton roll 400gm , suction catheter 8fg , suction catheter 12fg , suction catheter 14fg , suction catheter 16fg , b p blade no 15 , b p blade no 22 , b p blade 23 , ecg electrode , intravenous canula size 20 g , intravenous canula22 g , intravenous canula 24 g , intravenous canula 16 g , intravenous canula size 26 g , mtp canula size 07 , mtp canula size 4 , mtp canula size 08 , mtp canula size 10 , oxygen mask adult , oxygen mask paed , nebulizer mask paed , nebulizer mask adult , needle disposablesize 18g , needle disposable size 24 g , gloves surgical size 7 , examination gloves plastic , nitrile examination gloves unsterile large , syringe disposable single use with needle 10ml 21g , syringe disposable single use with needle 2ml 24g , syringe disposable single use with needle 5ml 23g , blood set drip chamber with filter 18g needle , dispoable spinal needle size 23g , disposable spinal needle 25g , disposable spinal needle 26g , disposable spinal needle 27g , cotton crepe bandage 10cm x 4m , cotton crepe bandage 15cm x 4m , handloom cotton gauze 18m x 90cm , measured volume infusion set paed drip , abgel haemostatic sponge 1x5x8cm , two way folleys catheter 16fr , dyanplast 4 , knee brace m total quantity : 265965...

Rajendra Institute Of Medical Science - Jharkhand

38924336 supply of surgical consumables on rate contract basis at rims, ranchi , surgical consumable items , abdominal drainage kit ; size 16fg / 20fg / 24fg / 28fg / 32fg , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 20cm x 20cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 25cm x 25cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 30cm x 30cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 45cm x 45cm , abdominal / gauze sponge with x ray thread , 12 ply , size 20cm x 20cm , abdominal / gauze sponge with x ray thread , 12 ply , size 25cm x 25cm , abdominal / gauze sponge with x ray thread , 12 ply , size 30cm x 30cm , abdominal / gauze sponge with x ray thread , 12 ply , size 45cm x 45cm , absorbable gelatin powder (sterile) (such as gelfoam or similarproduct) , absorbable hemostat (oxidized regenerated cellulose) 4 in.x 8 in. (10cm x 20 cm ) , absorbable hemostat (oxidized regenerated cellulose) 2 in x 4 in(5.1cm x 10.2cm ) , absorbable hemostat (oxidized regenerated cellulose) 2 in. x 3in.(5.1cm x 7.6cm ) , absorbable hemostat (oxidized regenerated cellulose) 3 in x 4in. (7.6 cm x10.2 cm ) , absorbable hemostatic gelatin sponge (8cm x 5cm x 1cm) , absorbable hemostatic gelatin sponge (8cm x 3cm) anal , absorbent cotton roll net weight 400gm , accessoriesforprobesofmonitor(i)lncsdisposableprobes , accessoriesforprobesofmonitor(ii)ecgcable , accessoriesforprobesofmonitor(i)spo2extension , accessoriesforprobesofmonitor(i)etco2 sampleline , accessoriesforprobesofmonitor(i) eeg cup electrode , accessoriesforprobesofmonitor(i)temprature probe , accessoriesforprobesofmonitor(i)nibp hose , accessoriesforprobesofmonitor(i) nibp cuff , accessoriesforprobesofmonitor(i) battery , act cartridgesfor measurement of act , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 1 x 1 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 1 x 3 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 2 x 2 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 3 x 3 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 4 x 5 , adhesive felt pad 5x5cm, , adhesive felt pad 10x10cm , adhesive remover with silicone polymers for easy removal of the base plate, alcohol free, sting free 50 ml , adhesive tape cloth 3 x 10mtr. ( adhesive plaster ) , adhesive microporous paper tape 1 x 9.1 mtr , adhesive microporous paper tape 2 x 9.1 mtr , adhesive microporous paper tape 3 x 9.1 mtr , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 1 x 9.1mtr. , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 2 x 9.1mtr. , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 3 x 9.1mtr. , adhesive silicon gel tape size 1 x 1mtr , adhesive silicon gel tape size 1 x 5mtr , administration set for feeding bag for enteral nutrition feeding pump, dehp and latex free, length minimum 250 cm , aerosol oxygen mask adult / paed , air mattress/airbed/inflatable mattress (plain) (anti decubitus bubble)disposable electrically operated , alken trocar cannula , all type of topical haemostatic agents including thrombin based agents biological glue etc. , ambu bag adult 100% silicon material only , ambu bag paediatric 100% silicon material only , ambu bag neo natal 100% silicon material only , amplantz sheath all sizes , anaesthesia circuit a coxial modification of the basic t piece system, developed to facilitate scavenging of waste gases. the process includes patient inspiring fresh gas from the outer reservior tube and expiring into reservior tube. convenient, lightweight anaesthesia delivery system ; should be based on mapleson d system provided with a corrugated tube , expiratory valve and antistatic bag ; compact and inexpensive with low dead space , anaesthesia masks (disposable, latex free, inflatable cuff, transparent)size 0, 1, 2, 3, 4, 5 , anaesthesia masks (re usable silicone, transparent) size 0, 1, 2, 3, 4, 5 , angled tip arterial cannula sized 8 fr 24 fr, should be beveled thin wall tips attached to tapered cannula bodies.should have kink resistant wire wound bodies. size 8 fr., 10fr., 12fr., 14fr., 16fr., 18fr., 20fr., 22fr., 24fr , annuloplasty flexible ring tricuspid flexible design, suitable for mics,open sternotomy and robotics sizes : 25,27,29,31,33 , annuloplasty rigid ring sizes 24,26,28,30,32,34 saddle shape, mitral ahcwr, titanium core maintains the anatomical shape, efficient distribution of leaflet stress and chordal tension , annuloplasty semi rigid ring sizes 24,26,28,30,32,34 semirigid, mitral 3 dimensional, promotes annular remodelling , antegrade cardioplegia cannulae 12/14/16 fr. with vent and without vent. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 10fr. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 12fr. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 14fr. , anterior posterior nasal packing catheter (for epistaxis cases) , anterior vitrectomy pack infinity, for cataract surgery , anterior vitrectomy pack oertli for ophthalmic surgery , antiseptic skin cleaning wipes : key ingredients : alcohol free , ph balanced, chlorhexidine gluconate (chg) , vitamin e, aloe vera ; size 24cm x 30cm ; 10 wipes packed in resealable pouch per pack , antiseptic skin cleaning wipes for baby : key ingredients : alcohol free , ph balanced, neem extracts vitamin e, aloe vera ; size 15cm x 20cm ; 10 wipes packed in resealable pouch per pack , antiseptic skin cleaning wipes for neonatal : key ingredients : alcohol free , ph balanced, aqua fruit extracts, preservative ; size 15cm x 20cm ; 10 wipes packed in resealable pouch per pack , aortic punch blade should be able to float around the punch. punch should be available with tapered cutting blade to increase visibility.should be available in all functional sizes size 2.0mm ; 2.5mm ; 3.0mm ; 3.5mm ; 4.0mm ; 4.5mm , aortic root cannula should have radiopaque tips attached to clear pvc bodies.additional features: aortic root pressure monitoring and left heart venting.can be used to aspirate air emboli as well administer cardioplegia. sizes 4 fr ; 5fr ; 7fr ; 9fr ; 11fr , aortic root cannula with vent linesizes 5 fr 11 fr should have radiopaque tips attached to clear bodies with separate vent line. 5fr , 7fr , 9fr , 11fr , aortic root cannula pediatric neonatal sizes 4 fr should be able to aspirate air from aorta, should have radiopaque tip and standard 50.5 in length or a shortened 2.5 in. , arterial cannula for arch cannulation sizes 20fr. , 22fr , 24fr. should have elongated one piece wire wound body with radiopaque suture ring and dilator with depth markings. , arterial cannula angled with diffused flow tip sizes 18 fr 24fr, should be one piece wire wound body with integrated flutes for diffused flow. 18fr , 20fr, 22fr, 24fr , arterial perfusion cannulae pediatric sizes: 8fr, 10fr, 12fr,14fr and 16fr.non wire reinforced bevel tip.overall length 18cm with suture bump. , arterial cannula ; with on off switch to prevent backflow and exposure of blood to healthcare professional ; perforated wings to provide secure fixation, ventilation and to prevent skin maceration. size : 20g , arterial blood collection syringe ; reducing the burden on paramedical staff of manually preparing the abc syringes ; spray dried calcium balanced lithium heparin improves accuracy and consisstency ; tip cap on the syringe for safe transportation ; size : 3ml , artificial dural grafts all sizes , arteriotomy cannula should have polyurethane tube with a bulb shaped tip connected to winged female luer. sizes 2mm, 3mm, 4mm, 5mm, 6mm , arteriotomyshunts(intra coronary shunts) should be beveled tip. should have fully transparent body. sizes 1.0 mm. ; 1.25mm ; 1.5mm ; 1.75mm ; 2.0mm ; 2.5mm ; 2.75mm ; 3.0mm , av shunt (silicon) arm , av shunt adult , av shunt connector adult , axillary artery one piece cannula with central arterial pressure measurement should have elongated one piece wire wound body with radiopaque suture ring and dilator with depth markings.should have integrated pressure monitoring port at tipsize 18fr ; 20fr ; 22fr ; 24fr , baby drape : for all kind of surgeries n baby. translucent sof poly film size 1.2 x 1.2m ; incise area 25 x 20cm eto sterilisez. 5 yrs expiry self life. packing material 45gsm polypropylene one side and another side tyvek paper packing. , bain circuit with apl valve and bag (adult) , bain circuit with apl valve and bag (paed) , balloon inflation device/syringe , balloon maxillary sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , balloon frontal sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , balloon sphenoid sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , bandage than (100cm x 20 mtr) as per schedule f ii , biopsy gun used for obtaining histological core samples from soft tissue and organs. should be fully automatic. it should have echogenic and atraumatic needle tip , ergonomic and light weight , cannula with depth marking , easy and one hand operated with two stage arming , available with / without coaxial needle ; size 14g 10 & 16 cm / 16g 10 , 16 & 20cm / 18g 10, 16, 20, 25cm / 20g 10, 16, 20cm , biopsy gun used for obtaining histological core samples from soft tissue and organs. should be semi automatic. it should have echogenic and atraumatic needle tip , ergonomic and light weight , cannula with depth marking , easy and one hand operated with two stage arming , available with coaxial needle ; size 14g 10 & 16 cm / 16g 10 , 16 & 20cm / 18g 10, 16, 20, 25cm / 20g 10, 16, 20cm , biological glue 15 gm , biological indicators , bipolar and monopolar cautery leads for laparoscopic surgery , bipolar and monopolar cautery leads for turp procedure , bipolarcautery forecepsallshapes(bayonetandstraight)andsizesforuseinadultandpediatricuse.tobe compatible for use with valleylab, megadyne and erbe surgical electro cautery machines , bis monitor universal electrodes , bite block with strap adult and paed , bladder evacuator device all type & all sizes , bloodtransfusionset : dehpfreeand eo sterile. conforms to iso 1135 4 standard, sharp non vented spike suitable for blood bags and all type of standard blood containers, — provided with a cylindrical drip chamber with 200? filter to prevent the passage of any clot in the chamber, flash ball type injection port for extra medication, comes with smooth 150 cm long, kink resistant tube, efficient roller controller for accurate adjustment of transfusion rate. sterile, individually packed. , blood tubing for dialysis adult , blood tubing for dialysis paed , blower mister handle , blower mister should have specialized nozzle utilizing a micro orifice for fluid delivery and a separate orifice for gas delivery.should have the malleable shaft and on/off control on the hand piece. , blower mister without tubing , bone cement all type , bone marrow aspiration needles (one time use) – pediatric & adult. all types & sizes , bone marrow aspiration needles(reusable, autoclavable)– pediatric & adult. all types & sizes , bone marrow biopsy needle one time use (adult+pediatric) , bone marrow biopsy needles (reusable, autoclavable) – pediatric & adult. all types & sizes , bone wax , bottom sheet with adhesive 135 x 200 1 ( impermeable waterproof soft fabric ) , bovine pericardial patch size: 4cmx4cm, 6cmx6cm, 8cmx8cm , bp blade all size ( size 10 24 ) , bp cuff (manual): all adult and pediatric sizes , buffant cap non woven disposable female crimp cap : • should be of good quality. • made from non woven breathable fabric of 15 gsm • well fitted with double elastic or string. • air permeable. • properly ultrasonically sealed for uniformity. , bulldog vascular clamps (steel) all types and sizes. (straight and curved, all lengths) , c section kit sterile consist of 1 foil polyglactin 910 with triclosan coated no. 1 0 & no 1 & 1foil fast absorbing pg 910 3 0 , c – arm cover disposable , c arm cover (two part and three part) , cardiac sump sucker , cardio vascular patch eptfesizes: 5cm x 15cm x 0.6mm , cardio vascular patch eptfesizes: 3cmx 6cm x 0.4mm , cardio vascular patch eptfesizes: 10cm x 15cm x 0.6mm , cardioplegia cannula for ostial cannulation convex tip 10 fr 45° , cardioplegia cannula for ostial cannulation convex tip 10 fr 90° , cardioplegia cannula for ostial cannulation convex tip 12 fr 45° , cardioplegia cannula for ostial cannulation convex tip 12 fr 90° , cardioplegia cannula size infant: cardioplegia cannula should be made of soft 100% silicone & should be tapered conduit with distal open tip having adjacent lateral eyes, followed by a flange for secure positioning. it should have proximal luer lock & a ss needle with hub. size: infant. , cardioplegia needle neonatal, pediatric and adult sizes. 5fr and 8 fr should have stainless steel tip with plastic depth stop, needle should be attached to flexible pvc tubingwhich should include a drape clamp and female luer. size 5 fr. , cardioplegia needle neonatal, pediatric and adult sizes. 5fr and 8 fr should have stainless steel tip with plastic depth stop, needle should be attached to flexible pvc tubingwhich should include a drape clamp and female luer. size 8 fr. , cardiotomy venous reservoir adult , cardiotomy venous reservoir pead. , cardiotomy venous reservoir neonatal , care stream dr film size 10 x 12 , care stream dr film size 14 x 17 , care stream dr film size 8 x 10 , carpentier bi caval femoral venous cannula, sizes : 24/29 fr, should have wire wound kink resistant two stage design. , carpentier bi caval femoral venous cannula,sizes : 30/33fr should have wire wound kink resistant two stage design. , catheter mount (smooth bore flexible corrugated tubing) with double swivel patient connector with suction port , catheter mount (extendable) 22m/15f patient connector, 22f machine side connector , catheter mounts with double swivel patient connector with two openings for bronchoscopy and suction , cautery knife cleaner (sterile) , cautery knife cleaner (unsterile) , cautery lead for monopolar (disposable) , cautery pad adult (split type) , cautery pad paed. (split type) , cautery pencil, ptfe coated with adjustable length. , cauterytipswithptfecoated/nonstickdisposableblade/disposableneedle/disposableballptfeinsulation , centera cath arterial line all size , central venous catheter set – (3 4 fr ; length 10 15 cm ; should have polyurathane double lumen kit with flexible distal tip fully radio opaque should have flexible distal tip fully radio opaque graduation each centimeter from 5cm to the distal tip , should have distal & proximal lumen 18 g each for rapid infusion, 1 introducer needles , 1 guiding syringe 5 ml, 1 guide wire with j tip nitinol , 1 dilator with stopper, 1 scalpel, 1 fixation device) , central venous catheter set – (4.5 fr ; length 6 & 12.5 cm ; should have polyurathane double lumen kit with flexible distal tip fully radio opaque should have flexible distal tip fully radio opaque graduation each centimeter from 5cm to the distal tip , should have distal & proximal lumen 18 g each for rapid infusion, 1 introducer needles , 1 guiding syringe 5 ml, 1 guide wire with j tip nitinol , 1 dilator with stopper, 1 scalpel, 1 fixation device) , central venous catheter set – size : double lumen : 7 fr, 16 cm, 14/18 g, 18/18g. ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen : 4.5fr, 5 fr 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen : : 7 fr, 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen :8 fr, 8,5fr 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter, peripherally inserted 3 fr containing 1 splitting introducer needle and one radiopaque catheter single lumen 10 to 20cm length, 1 3ml syringe 1 syringe adapter, 1 removable connector with integral extension tube 10 cm with secondary fixation unit please quote for all types of central venous catheters made of polyurethane and silicone , chemo procedure gowns sms & polyethylene coating as per astm f1671 & tested against chemo drugs , chest drain bag with underwater seal,capacity 500ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chest drain bag with underwater seal,capacity 1000ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chest drain bag with underwater seal,capacity 2000ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chiba needle (all sizes and gauge) to be used for fine aspiration for cytological study , closed suction system ( 24hr / 72 hr ) minimises the risk of vap incidences in ventilated patients, kit should have 3 easily replaceble catheter minimising the need to replace entire suction system every 24 to 72 hrs. , catheter with lateral eyes, smooth tip and depth marking for maximum patient comfort, mdi port to provide an effective, quick and convienent way of drug delivery, ittigation port with one way valve allows lavage and irrigation of the suction catheter, on and off valve allow suction catheter tip to be isolated and create an enclosed cleaning chamber, transparent connectors and durable sleeve facilitates catheter manipulation and prevents infiltration of blood and sputum, 360 degree swivel elbow enables rotation for enhanced patient comfort and reduces torque ; size 6fr, 8fr, 10fr, 12 fr, 14fr, 16fr. , closed wound suction unit 06fr.to 08fr , closed wound suction unit 10fr, 12fr, 14fr, 16fr, 18fr, , colostomy bag , colostomy pouch with softflex skin barrier *without tape border *without starter hole *without integrated filter * odour barrier film *soft wire closure * barrier opening up to 15 mm & pouch length 11.5 cm. , combined spinal epidural kit , consumable for cardiac output monitor flotrac cardiac output sensor for cardiac output monitor of make edwards , consumable for cardiac output monitor ibp/ cvp transducer for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor large for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor medium for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor small for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor neonatal for cardiac output monitor of make edwards , consumable for cardiac output monitor acumen iq hpi sensor with ai for cardiac output monitor of make edwards , consumable for cardiac output monitor ibp cable for cardiac output monitor of make edwards , consumable for cardiac output monitor truclip or sensor holder for cardiac output monitor of make edwards , cord clamp, plastic individually packed , coreskintemperatureprobeswiththeprovisionoffreesupplyofinterfaceadaptors/cables(ifrequired)for comapatible with infant open care systems like dragger (an 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract , coreskintemperatureprobeswiththeprovisionoffreesupplyofinterfaceadaptors/cables(ifrequired)for comapatiblewith infantopen care systemslike fischerand paykel(presently installed inneonatalicu)(an 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract. , coronary artery retraction clips sizes 3mm and 5mm should be designed to improve exposure to a coronary anastomosis site.should be able to small prongs and gently hold tissues away from the vessel to improve vision. , corrugated drainage sheet , cpap infant nasal delivery circuit adaptor & sizing kit , cpap infant nasal prongs ;all sizes , cpap mask infant nasal interface all sizes , cr film 10 x 12 , cr film8 x 10 , craniotomy drape (50gm sms polypropylene fabric water repellent size: 1.6x3.2mm) ; adhesive area : 20cm dia. side channel & collecting funnel. olysheet lining 1.20 x 1.20m ; sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , crepe bandage 2 , crepe bandage 4 , crepe bandage 6 , ctg paper , cuff inflator/ pressure guage , cusa irrigation tubing suction compatible with soring machine for neuro surgery ot. , cvp manometer disposable : cvp measuring device suitable for continuous or intermittent monitoring of central venous pressure during infusion, particularly in icu, ccu, ots and casualty departments , manometer tube with graduation from 4 cm to +34 cm and attached to three way tap, provided with 120 cm long extension tube, fitted with female luer lock on one end and male luer lock on the other end for safe connection to the central venous catheter, latex free injection site is provided for extra medication, sliding indicator provided to record previous reading, moulded clamps with latex free rubber strings for easy fixation on the intravenous stand , sterile, individually packed in peelable pouch. , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 2” x 2”, inches , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 4 x4” inches , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 6x6 ‘ inches , delivery kit (sterile) consisting of the following: setup cover 100x195 cms; under buttock drape 75x125 cms; abdominal drape 100x150 cms; hand towel; cord cl baby blanket;vaginal sponge; maternity pad; placenta basin; abdominal sponge ( x ray opaque ) ; baby wipe ( 60 x 60 ) ; maternity mesh panty ; perineal sheet with legging ; underpad with collection bag ; waste bag ; id band ( paediatric ) ; id band ( adult ) , dialyser cellulose acetate – 0.5m2 , dialyser cellulose acetate – 1.0 m2 , dialyser cellulose acetate – 1.2 m2 , dialyser cellulose acetate – 1.5 m2 , dialysistenckhoffstraightcatheterkitscontaining16frpullapartsheath/dialator,18gaintroducerneedle,tunneling stylet, j/str, guidewire etc all sizes , dialyzers (multi use) polyphenylene membrane with polypropylene housing material. steam sterilized and bpa free all sizes , dialyzers (single use) polyphenylene membrane with polypropylene housing material. steam sterilized and bpa free all sizes , diapers (neonatal size (for babies weighing 1 to 3 kg) extra small size , diapers (neonatal size (for babies weighing 1 to 3 kg) small size , diapers adult (large) , diapers adult (medium) , diapers adult (small) , diapers adult (xtra) , diapers paed (large) , diapers paed (medium) , diapers paed (small) , digitalbp apparatus (formeasurementof blood pressure and pulse, should be able to detect systolic and diastolic bloodpressureandpulse,should bebased uponoscillometry principle,shouldgivedigitalresultsonlcddisplay. should have minimum 1 year warranty. , disposable connector all sizes; , disposable connector all sizes;y, without leur lock , disposable connector all sizes;y with leur lock , disposable connector all sizes;straight with leur lock , disposable connector all sizes;straight without leur lock , disposable enema nozzle , disposable eyepads (100%cottongauze,16 ply,ovalshaped, 75x95mm,pairpack),– individualunsterilepouch pack– individual sterile pouch pack , disposable e z clean 23/4 needle electrode , disposable fine tip marker pens for the identification and labeling drugs, radiology films, syringes, vials for individual patients (red, black, green) , disposable fine tip and bold tip skin marker pensforthe identification and labeling of individualpatients during surgery or other procedure (red, black, green) sterile water proof, indelible non toxic ink (with scale) , disposable full face cpap mask with standard 22m connection with 360° swivel connector, size 3, 4, 5, 6, and 7 , disposable hand control button switch cautery pencil with ez clean (ptfe coated) blade electrode , disposable hand control button switch pencil with ace blade electrode with holster , disposableindwellingbowelcathetersystemkitconsistingofonecatheter,two2000mlclosedodor barrier collection bags, two skin barriers, two lubricating jelly packets, one 1000 ml irrigation bag , disposable inner cannula for fenestrated tracheostomy tube size 7 & 8 mm , disposable kellys pad with automated measurement with collection pouch , disposable laryngoscope miller blades , disposable oxygen mask with silicon cuff & 2mtr star lumen tube (adult) , disposable oxygen mask with silicon cuff & 2mtr star lumen tube (paed / child ) , disposable pcnl drape sheet consisting of 1no. pcnl sheet, 4pcs drape sheet, 1pcs trolley cover(large), 1pcs trolley cover(small),1pcsmayotrolleycover,1pcsbedsheet,1pcsscreencoverwithadhesiveshouldbecustomised according to the requirement with additional components hydrohead 50cm, treated antistatic fabric static decay<1sec., weight 50gsm sms fabric, asorbent material near fenestration min 60gsm spun bond and polyethylene laminated and absorbency should be 4 times of its weight., manufactured in 100 000 class clean room , disposable single tubing all sizes (½,?,¼,3/16) , disposable single tubing sizes ? , disposable single tubing sizes ½ , disposable single tubing sizes 3/16 , disposable skin grafting blades , disposable sterile bed sheet – non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe, 160x260 cm (provide all details of gsm, type of fabric and method of sterilization) – white, green and blue – , disposablesterilefoley’scatheterinsertionkitconsistingof : 1. packed in csr overwrap (non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe )– 54x54 inch. 2. two pair gloves – size 7.0 and 6.5. 3. one waterproof underpad – size 3x4 feet. 4. one poly lined non woven fabric fenestrated drape – size 4x4 feet, fenestration size 15x15 cm. 5. outer plastic paper kidney/basin tray 1000 cc. 6. syringe 20 ml. 1 pc 7. syringe 5 ml. 1 pc 8. one povidine iodine ointment. 9.one lubricating jelly – 15 ml pouch/tube. 10. gauze sponges / pads (100% cotton woven, yarn:40s, mesh:, 26x18) 4x4 inch 08 ply with folded edges sterile peal open – four piece pack. , disposable sterile pillow cover non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe – 45x65 cm (provide all details of gsm, type of fabric and method of sterilization) – white, green, orange, yellow and blue , disposablesterilestretchersheetnonwovenfabric–singlepack(providealldetailsofgsm,typeoffabricand method of sterilization) –white, green and blue , disposable straps (head gear) for full face niv mask , disposable straps (head gear) for nasal niv mask , disposable tongue depressor wooden/plastic, individually packed (small/medium/large) , disposable, nasal prongs, neonatal , double lumen catheter to accommodate 2 guidewires , double lumen catheter to accommodate 2 guidewires 6.0/10.0 fr,50cm length , double lumen tube : robertshaw tube designed to fit patients anatomy for thoracic or pulmonary surgery and single lung long term ventilation. anatomically correct curvatures facilitate proper placement and intubation. high volume/low pressure tracheal cuff has a true barrel shape that minimizes pressure on the tracheal tissue and a uniquely shaped bronchial cuff helps prevent accidental upper lobe occlusion, tracheal cuff seperates the lung from the environment , bronchial cuff seperates the lungs from each other , colour coded pilot balloons with luer lock connector, marked with the name of the lumen (tracheal or bronchial) for easy identification , d shaped lumina provide maximum cross sectional area , minimising resistance to gas flows , provided with double swivel connections with double caps , sterile, individually packed. size 35/37/39/41fg (left) , double lumen tube : robertshaw tube designed to fit patients anatomy for thoracic or pulmonary surgery and single lung long term ventilation. anatomically correct curvatures facilitate proper placement and intubation. high volume/low pressure tracheal cuff has a true barrel shape that minimizes pressure on the tracheal tissue and a uniquely shaped bronchial cuff helps prevent accidental upper lobe occlusion, tracheal cuff seperates the lung from the environment , bronchial cuff seperates the lungs from each other , colour coded pilot balloons with luer lock connector, marked with the name of the lumen (tracheal or bronchial) for easy identification , d shaped lumina provide maximum cross sectional area , minimising resistance to gas flows , provided with double swivel connections with double caps , sterile, individually packed. size 37/39/41fg (right) , double lumen endotracheal tube (for olv) adult all sizes , double lumen endotracheal tube (for olv) paed all sizes , double lumen jugular catheter kit with laser cut side slots (all size) , double lumen jugular catheter with laser cut side slots (all sizes) , double lumen straight catheter kit with laser cut side slots (all sizes) , double lumen straight catheter with laser cut side slots (all size) , double prong needle for urethral sling , double stage venous cannula round and oval shape, should be two stage cannula with oval body in various sizes.should be two stage cannula with round body in various sizes.should have cannula body with thin walled with depth markings. different sizes 28/36fr. ; 32/40 fr ; 36/46fr;32/46fr ; 36/51fr , drape c.a.b.g. drape set : • made up of reinforced spun bond film composite material, blue laminate of polypropylene non woven fibers and polyethylene film. • highly absorbent yet impervious across entire drape. • low linting, non breathable, abrasion resistant, durable, strong tear resistant, conformable, with self adhesive containing hypoallergenic acrylate type adhesive with a silicone coated paper liner.• cabg pack:4 self adhesive cautery bags (30cmx35cm),3 op tapes(10cmx55cm),4 lint free hand towels (23.5cmx38cm),4 self adhesive towel drapes (91.5cmx100cm),1 self adhesive medium drape (183cmx183cm),1 self adhesive large drape(150cmx250cm),1 instrument table drape (150cmx200cm),1 large instrument table drape (183cmx240cm),1 self adhesive bilateral split drape (183cmx200cm),2 triangular drape (91.5cm x 91.5cm x 129cm). • sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , drape c arm drape 41 inch x 74inch , drape eye drapes (gsm polypropylene fabric 100x70cm with drainage pouch , drape universal extremity drape, sms fabric and dimension 90 x 131 in., fenestration one 2.5 in. conformable circular, fabric tube holders, control plus fabric reinforcement, ce certified, aami l 4 compliance , drape lamino spinal drapes all sizes , drape shunt drape , dressing paraffin gauze 10 x 10 cm in packs/ box of ten pieces , dressing paraffin gauze 15 cm x 2 m roll , dressing parafin gauze 10 x 30 , dressing silk protein & antimicrobial nanosilver based sterile soft, conformablesurgical pu foam dressing (non adhesive) 20 x 20cm , dressing silk protein & antimicrobial silver based bilaminated sterile surgical mesh wound dressing 20 x 25cm , dressing silk protein & antimicrobial silver based bilaminated sterile surgical mesh wound dressing 20 x 40cm , dressing silk protein & nanocrystalline silver based sterile, non adherent, antimicrobial gauze dressing 10x25cm , dressing silk protein based sterile non adherent gauze dressing to cover the wounds 10x25cm , dressing silk protein based sterile soft, conformable surgical pu foam dressing (non adhesive) 20x20cm , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 2in x 2in ( 5cm x 5cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 4in x 5in ( 10cm x 12.5cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 4in x 10in ( 10cm x 25cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 8in x 10in ( 20cm x 25cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 2in x 2in ( 5cm x 5cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 4in x 5in ( 10cm x 12.5cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 4in x 10in ( 10cm x 25cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 8in x 10in ( 20cm x 25cm ) , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes1x1 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes2x2 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes1x3 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes 3x3 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes4x5 , dviu knife , ecg cable compatible with bpl and schiller ecg machine , e c g electrode adult (button type) , e c g electrode neonatal (button type) , e c g electrode paed.(button type) , e c g jelly (250ml) , e c g jelly (5 kgs jar) , ecg paper roll compatible with schiller machine , ecg paper roll compatible with bpl machine , ecg paper roll for 12 channel ecg machine , model : cardiomin 12b , echo jelly (250ml) , eeg paste 250gms , elastic adhesive bandage size 10cm 4/6 mtr. (stretched length) , electric jet nebulizers. compresseor based jet nebulizer, light weight < 2 3 kgs, power 220v 50 hz ac, treatment time < 10 min, nebulization quantity: 10 ml, mmad: 80% < 5 micron, compressor pressure 40 50 psi, maximum flow rate: 8 10 lpm, operating flow rate: 6 8 lpm @ 10 psi lmp/psi, sound level, 50db, , electrical breast pump with one year warranty , embolectomy catheter 2fr to 9 fr , embolectomy catheter with perfusion channel all types and all sizes , endo mechanical circular stapler (cutter & stapler) (all types and all sizes) for open and laparoscopic surgery , endo mechanical contour stapler (all types and all sizes) , endomechanical disposabledissectingandgraspingforcepssize5mm,30 35cmlength,withoutrachet, insulated with connector pin for unipolar coagulation , endo mechanical haemolock clip applicator – for open surgery , endo mechanical haemolock/weck locking clip applicator 10mm (all size clips)– for laparoscopic surgery , endo mechanical hand piece / shears all types (open surgery and laparoscopic) and all sizes for use with bipolar vessel sealing device ligasure. , endo mechanical hemorrhoid surgery stapler all types & all sizes , endo mechanical hemostatic titanium vascular clips all types & all sizes (such as liga clips) , endo mechanical laparoscopic disposable cannula without trocar, with sealing valve/cap.all sizes and all types (pediatric, adult and bariatric) 15, 12, 10, 5, 3 mm with various lengths , endo mechanical laparoscopic disposable trocar and cannula set with sealing valve/cap. all sizes and all types. (pediatric, adult and bariatric) 15, 12, 10, 5, 3 mm with various lengths , endo mechanical laparoscopic endo bags for specimen retrieval disposable all sizes , endo mechanical laparoscopic equipment cleaning and maintenance devices , endomechanical laparoscopicneedleholder:5mmstriaghthandlewithdisengagableratchet,straightjaw,size 5mm, length 30 35cm, for use of 0/0 to 7/ sutures , endo mechanical linear cutter & stapler (all types and all sizes) open and laparoscopic surgery , endo mechanical linear staplers (cutter and stapler) for use in laparoscopic bariatric surgery (all types and all sizes) , endo mechanical ultrasonic energy consumables (probes, shears and hand pieces) all types and all sizes , endo mechanical ultrasonic shears (laparoscopic&open)all typesand allsizes(handpiece& hand probes,all types and all sizes) , endo mechanical haemostatic locking clips (like haemolock clips) all types and all sizes, along with provision of free applicators , endo mechanical screw shaped 5 mm polyglycolic lactic acid absorbable tacker laparoscopic mesh fixation devices, all lengths and capacity , endo mechical complete range of probes to be used in laparoscopic & open surgery cases using energy device compitable for ligasure (ls 10) vessel sealing system , endo mechnical anchor shaped 5 mm absorbable tacker laparoscopic mesh fixation device, all length and capacity , endo mechnical laparoscopic hand instruments reusable, indian make. 5mm. such as graspers and dissectors of variouskinds:maryland,fenestrated,atraumatic,toothed,etc.withrachetandwithoutrachet;scissorsofvarious kinds, needle holders, retractor, suction irrigation system. 30 35 cm length. , endo mechnical ligature clips in all sizes compatible with existing aesculap clip applicators. , endo mechnical linear stapler (all types and all sizes) open and laparoscopic surgery , endomechnical reloads(cartridges)fordisposablestaplers(foropenandlaparoscopicsurgery)(alltypes& sizes) , endo mechnical reloads (cartridges) for re usable (steel) linear staplers (all types & sizes) , endo mechnical reusable endo loop applicator (2300 mm length) , endo mechnical reusable linear cutter & stapler (all types & sizes) , endo mechnical titanium (liga) haemostatic clip applicators – for open surgery all sizes , endo mechnical titanium (liga) haemostatic clip applicators – for laparoscopic surgery all sizes 5mm and 10mm , endotracheal tube (north polar) – preformed et tube plain sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (north polar) – preformed et tube cuffed sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (south polar) – preformed et tube plain sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (south polar) – preformed et tube cuffed sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube plain, pvc , size 2.00mm 5.00mm ;manufactured from thermo sensitive material readily conforming to body contours at body temperature. kink resistant and transparent material to reduce any possiblity of occlusion in the tube bore, nasoral tip suitable for nasal/oral intubation, murphy eye with smooth edges and tip to reduce any trauma to the patient during procedure, provided with radio opaque line throughout the length for x ray detection and assistance in placement, proximal end is fitted with standard 15 mm connector which can snugly fit with other commonly used connectors, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed, pvc ,size 2.00mm 5.00mm : manufactured from thermo sensitive material readily conforming to body contours at body temperature. kink resistant and transparent material to reduce any possiblity of occlusion in the tube bore, nasoral tip suitable for nasal/oral intubation, murphy eye with smooth edges and tip to reduce any trauma to the patient during procedure, provided with radio opaque line throughout the length for x ray detection and assistance in placement, proximal end is fitted with standard 15 mm connector which can snugly fit with other commonly used connectors, sterile, individually packed in peelable blister pack. , endotracheal tube plain , size 5.00mm 10.00mm : thermo sensitive tube conforms to the tract anatomy , kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , size 5.00mm 10.00mm : thermo sensitive tube conforms to the tract anatomy , kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector, sterile, individually packed in peelable blister pack. , endotracheal tube plain, silicon and pvc blend , size 2.00 mm to 5.00 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , silicon and pvc blend : size 2.0 mm to 5.0 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , silicon and pvc blend : size 5.5 mm to 10.0 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , with subglottic suction line : thermo sensitive tube conforms to the tract anatomy, should have special suction port for removal of subglottic secreretions using syringe / suction minimize the risk of vap, kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector at proximal end ,sterile, individually packed in peelable blister pack. , endotracheal tube holder adult & paed , endotracheal tube t piece , endotracheal tube with cuff pressure monitoring all sizes , endotrachealtubewithsecondarylumenfortrachealirrigation(fordeliveryofsurfactant/orothermedications) pvc/silicone based, sizes internal diameter 1,2.0,2.5,3.0,3.5,4.0,4.5 mm , ent pediatric airway balloon catheter 5mm x 24mm / 7mm x 24mm / 9mm x 24mm , ent adult airway balloon catheter 10mm x 40mm / 12mm x 40mm / 14mm x 40mm / 16mm x 40mm , ent balloon inflation device , epidural catheter : soft tip epidural is specially designed for continuous anaesthesia and pain relief therapy ; catheter should be made from unique plasticizer free polymer with excellent bio compatibility ; flexible and atraumatic soft tip with three lateral eyes ; catheter should be printed to determine the depth of insertion and accurate placement in the epidural space ; luer lock twist commector ; crystal clear catheter with radio opaque line. , epiduralanaesthesiakitwithg18/16epiduraltouhyneedle,doublelayeredepiduralcatheterg20/g19. with crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter and lor syringe with parabolic graduation markings , epiduralanaesthesiakit latex freewithg18/16epiduraltouhyneedle,doublelayeredepiduralcatheterg20/g19 length 100cm.with crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter and lor syringe with parabolic graduation markings , epidural anaesthesia tray latex free withg20 epiduraltouhyneedle of length 5cm,doublelayeredepiduralcatheterg24 length 72 cmswith crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter attachable to pin pad present in kitand lor syringe with parabolic graduation markings , esmarch bandage 3 , esmarch bandage 4 , esmarch bandage 5 , extension line 100cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , extension line 150cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , extension line 200cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , external collecting urinary device , external defibrillating patches (all sizes) compatible for philips/ medtronic/mindray , face mask n 95 without respirator niosh certified , face mask with tie on : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm.tie string: 90 cm. , face mask with smooth elastic ear loops : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm. , face mask with eye shield (disposable) for full protection against any spurt/splash with tie on : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm.tie string: 90 cm. , facial oxygen tent mask adult / paed , femoral arterial cannulae; wire reinforced overall length should be 19.5.2 cm with ¼ vented connector sizes: 8fr ; 10fr ; 12fr ; 14fr. , femoral arterial cannulae; wire reinforced overall length should be approx. 24cm with 3/8 vented connector sizes: 16fr, 18fr and 20fr. , femoral catheter double lumen , femoral catheter single lumen paed , femoral catheter single lumen adult , femoral catheter straight 11.5f * 16 cm , femoral multistage venous cannulasizes: 29/29/29 fr should be one piece wire wound multiple side holes body with percutaneous kit. , femoral multistage venous cannula sizes: 29/46/37 fr should be one piece wire wound multiple side holes body with percutaneous kit. , femoral venous cannulae; wire reinforced overall length should be approx. 24cm with ¼ non vented connector.sizes 8fr, 10fr, 12fr and 14fr.. , femoral venous cannulae; wire reinforced overall lengthshould be 752 cm with 3/8 non vented connector sizes 18fr. ; 20fr ; 22fr ; 24fr ; 28fr , fibrin glue for ophthalmic surgery , fine suction tip for ent , fistula canula for hemodialysis with anti reflective valves and safety needle, length 30mm/38 mm (all sizes) , fistula needle , flexo metallic endotracheal tube plain : size : 3.00mm to 5.00mm flexo metallic endotracheal tube for airway management intended for use in surgeries demanding flexible head or neck position , specially designed suitable to laryngeo tracheal anatomy , tubes are fitted with a reinforced stainless steel spiral core to overcome any possiblity of the bore occlusion due to kinking or collapse of the tube , flexo metallic feature provides 100% kink resistance and anti crushing strength to the endotracheal tube , completely flexible tube with a thin,strong wall. high volume, low pressure cuff provides effective seal between tube and trachea and minimizes the risk of folds. radio opaque line with precise graduation marking guarantees proper placement of the tube , murphy eye ensures clear airway and no mucus blockage, sterile, individually packed. , flexo metallic endotracheal tube cuffed : size : 5.00mm to 10.00mm flexo metallic endotracheal tube for airway management intended for use in surgeries demanding flexible head or neck position , specially designed suitable to laryngeo tracheal anatomy , tubes are fitted with a reinforced stainless steel spiral core to overcome any possiblity of the bore occlusion due to kinking or collapse of the tube , flexo metallic feature provides 100% kink resistance and anti crushing strength to the endotracheal tube , completely flexible tube with a thin,strong wall. high volume, low pressure cuff provides effective seal between tube and trachea and minimizes the risk of folds. radio opaque line with precise graduation marking guarantees proper placement of the tube , murphy eye ensures clear airway and no mucus blockage, sterile, individually packed. , foley catheter 2way latex 6fr, 8fr, 10fr,silicon coated , foley catheter 2way latex 12fr,14fr, 16fr,18fr,20fr,22fr,24fr silicon coated , foley catheter 2way made of 100% silicon material 6fr, 8fr, 10fr , foley catheter 2way made of 100% silicon material 12fr,14fr, 16fr,18fr,20fr,22fr,24fr , foley catheter 3way latex 18f,20fr,22fr,24fr,26frsilicon coated , foley catheter 3way made of 100% medical grade silicon, the foley should have an inbuilt flow control stopper to regulate the urine flow, enable ease of mobility for patient and maintain bladder health,vballoon should be made of tear resistance silicon rubber size 18fr,20fr,22fr,24fr, 26fr , fourlumen centralvenouscatheter 8 f (cathertermaterial polyurethane certon with polyhexanide methacrylate withadditionalhydromercoating,fourlumen14/16/18g/18gwithlength15cm,catheterkitcontainingavalve needle 18 g, novlon material dilator, scalpel, guidewire made up of nitinol, an egg lead for and a safesite connetor , fuji dry laser film 10 x 12 , fuji dry laser film 8 x 10 , fuji dry laser film 14 x 17 , full gown material 50gsm(nw sms) front stichless,fluid barrier cuff (not knitted cuff) 1 nos.disposable bag 1 nos, plain sheet large(25 micron thick pe hygine fil of size 120x210 cm) 2 nos, water proof leggings (cover upto knee) 1 pair, cap 1 nos, mask 1 nos, paper hand towel 2nos, nitrite gloves (latex powder free double layer on finger tip) pair, googles (wearing on the any type of spectcle) 1nos, note: all the product should be in single sterilized pack.packet material 35gsm polypropylene one side and another side half part tyvek paper 35 gsm packing , gauge than(18mtr x 90cm) as per schedule f ii , gloves latex examination light powdered non sterile pack size 100/pk) , gloves latex non powdered for microsurgery all sizes , gloves sterile latex surgical gloves powder free(polymer coated) powder free gloves coated with unique blend of polymer to provide excellent donning capability, should conforms to is 13422:1992, astm d3577:2019, en 455 1:2020, en 455 2:2009+a2:2013, en 455 3:2006 & en 455 4:2009 standards specification, the physical properties, dimension & tensile strength of the material should be as per european ce/usfda standards, anatomically ahaped with micro rough surface in inner palm and in inner part of the finger area which provides good grip at wrist and in curved fingers. product should have shelf life of 5 years, sterilized by validated process cycle (iso 11135:2014), shouldpass viral penetration test as per astm f 1671, biologically compatible as per iso 10993 part 5, 7, 10 & 11 non toxic & non irritant.size 6 ; 6.5 ; 7.0 , 7.5 , 8.0 , 8.5 , 9.0 (in pair) , gloves sterile latex surgical gloves pre powdered, product should conforms to is 13422:1992, astm d 3577:2019, en 455 1:2000, en 455 2:2009+a2:2013, en 455 3:2006 & en 455 4:2009 standards specifications, lightly powdered with modified absorbable corn starch usp, sterilized by validated process cycle (iso 11135:2014), shouldpass viral penetration test as per astm f 1671, biologically compatible as per iso 10993 part 5, 7, 10 & 11 non toxic, non irritant & non pyrogenic. size in pair : 6 / 6.5 / 7.0 / 7.5 / 8.0 / 8.5 / 9.0 , gloves nitrile examination non sterile , gloves polyethylene (sterile) (in pair) , gloves polyethylene (non sterile) , glucometer test strip. each 1000 strip should be accompanied by a glucometer on free of cost basis. glucometer should not require code ( code free glucometer ) , should be able to use fresh capillary, venous, neonatal blood. accuracy should be as per international standard iso 15197 requirement for blood glucose monitoring system. should be capable of being stored continuously in ambient temperature of 0° to 50° celsius , should have capillary, venous, blood testing, all software update shall be provided free of cost . glucometer should be usfda approved or ce mark from notified body (eu) , goggles (disposable) for full protection against any spurt / splash , graft woven trifurcate 12mm x 6mm x 6mm, 40 50 cm in length, gelatin coated. , graft woven trifurcate 14 mm x 7mm x 7mm, 40 50 cm in length, gelatin coated. , graft woven trifurcate 16mm x 8mm x 8mm, 40 50 cm in length, gelatin coated. , graft : regular & small beadings (rings) ptfe graft all sizes and length. , graft dacron bifurcated woven grafts 12mmx6 mm with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 14mmx7mm, with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 16mmx8mm, with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 18mm x9mm with 40 50 cms length,collagen coated. , graft knitted dacron straight graft 6mm to 16 mm with 30 35 cm length,collagen coated. , graft knitted dacron straight graft 18mm to 24 mm with 30 35 cm length,collagen coated. , graft knitted dacron straight graft 6mm to 16 mm with 60 70 cm length,collagen coated. , graft knitted dacron straight graft 18mm to 24 mm with 60 70 cm length,collagen coated. , graft dacron knitted axillo bifemoral bifurcated graft with extended support, gelatin coated. , graft dacron knitted axillo bifemoral graft 90 degrees angle with 60 cm side branch 8mm and 0 mm, gelatin coated. , graft e ptfe stretchre in forced removable ringed thin wall pre configured axillo bi femoral vascular graft. size: 8mm diameter x 70cm/40cm length , graft e ptfe stretchre in forced removable ringed thin wall pre configured axillo bi femoral vascular graft. size: 8mm diameter x 90cm/40cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 6mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 7mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 8mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced removable ringed thin wall vascular graft.size: 6mm diameter x 50cm/70cm/80cm length. , graft e ptfe stretch re in forced removable ringed thin wall vascular graft.size: 8mm diameter x 50cm/70cm/80cm length. , graft ascendingaortic reconstruction graft : one piece design collagen coated valsalva graft for repair or reconstruction of the ascending aorta. one piece design collagen coated valsalva graft for repair or reconstruction of the ascending aorta.unique un crimped section that does not stretch should allow easy sewing of valve remnants or prosthetic valve should facilitate estimation of the length required for optimal placement of valve remnants or prosthetic valve to ensure optimal clinical outcomes. should have the ability to be precisely trimmed and shaped in case of remodeling technique procedures. at least 3 references line should act as a guide for prosthetic valve. coated polyester fabric cross linked type i bovine collagen water permeability < 5m * cm 2 min 1 @ 120mmhg , graft dacron straight woven grafts 6mm to 16 mm, 30 35 cm long, collagen coated. , graft dacron straight woven grafts 18mm to 28 mm, 30 35 cm long,collagen coated. , graft dacron straight woven grafts 30mm to 38 mm, 30 35 cm long,collagen coated. , graft dacron straight woven grafts 6mm to 16 mm, 60 70 cm long,collagen coated. , graft dacron straight woven grafts 18mm to 28 mm, 60 70 cm long,collagen coated. , graft dacron straight woven grafts 30mm to 38 mm, 60 cm 70 long,collagen coated. , graft dacron bifurcated knitted grafts 12mmx6 mm, with 40 50 cms length , graft dacron bifurcated knitted grafts 14mmx7mm with 40 50 cms length , graft dacron bifurcated knitted grafts 16mmx 8mm, with 40 50 cms length , graft dacron bifurcated knitted grafts 18mm x 9mm with 40 50 cms length , graft dacron woven 3 branch arch grafts 20mm to 34 mm,collagen coated. , graft dacron woven 4 branch arch grafts 20mm to 34 mm,collagen coated. , graft dacron woven thoraco abdominal grafts 20mm to 30mm, gelatin coated. , graft dacron woven graft 20 to 34mm with 8mm and 10 mm perfusion side branch, 40 50 cmlength, gelatin coated. , graft dacron woven extra length graft with offset branch graft 22 to 32 mm with 8mm perfusion side branch, gelatin coated. , graft dacron woven pre curved graft 22 mm to 32 mm with 8mm perfusion side branch, gelatin coated. , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 3mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 3.5mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 4mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 5mmdiameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 6mm diameter , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 2/6x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 14/7 x 40cm / 50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 16/8x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 18 / 9 x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 20 / 10 x 50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size :22/12 x40cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 24/12x40cm , graft e ptfestretch large diameter reinforced aortic vascular graft of all diameters and length , graft large diameters e ptfe grafts all sizes and length , graft : regular & thin wall e ptfe graft all sizes and length , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 6 mm diameter , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 7mm diameter , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 8mm diameter , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 6 mm diameter. , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 7mm diameter. , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 8 mm diameter. , guide wire 80 cm fixed core straight (for dialysis) , guide wire 80 cm j tip (for dialysis) , guide wire amplatz extra stiff wire guide 0.035” 300cm , guide wire amplatz ultra stiff wire guide 0.035” 180cm , guide wire amplatz ultra stiff wire guide 0.035” 260cm , guide wire hydrophilic in all dia sizes 150/180 cm (straight) , guide wire hydrophilic in all dia sizes 150/180 cm (j tip) , guide wire hydrophilic in all dia sizes 150/180 cm (straight) , guide wire hydrophilic in all dia sizes exchange length 260/300 cm (j tip) , guide wire hydrophilic in all dia sizes exchange length 260/300 cm (straight) , guide wire hydrophilic in all dia sizes exchange length stiff shaft 260/300 cm (straight) , guidewire 0.015 x 40 45 cm j and straight tip (neonatal) , guidewire 418 0.018x40 45 cm j and straight tip (neonatal) , guidewire hydrophilic ni ti alloy, kink resistance j tip 0.018, 0.032,0.035,0.038 inch x 150cm , guidewirehydrophilicni tialloy,kinkresistance,floppyandstraighttip(comparabletoterumo) 0.18, 0.032,0.035,0.038 inch x 150cm , guidewire hydrophilic stiff with floppy tip 0.032,0.035,0.038 inch x 150cm , guidewires0.018 straight tip an all length , half gown : material 25 micron thick made up of microporous hygiene breathable polyethylene films ; size 750 mm width x 1500mm length ; should be water proof , light weight , blood pathogen proof , latex free ; disposable , single use , eto sterile ; packing material : 45g polypropylene film one side and another side 25gsm tyvek paper with 5 years expiry life. , heart positioner for minimally invasive beating heart surgery should be a positioner with detachable shaft for mics via thoracotomy. , heart valve : aortic valved graftwith conduit hemashield technology with collagen impregnation provides uniform tissue ingrowth, biocompatability, low porosity no preclotting required wooven duble velour hemashield composite graft sizes : 19,21,23,25,27,29,31, , heart valve : bioprosthetic heart valve latest generation with racheting system, mitral, suitable for future viv, opens at 8 atm pressure, low profile height 9mm, less lvot obstruction, facilitates mics, innovative flexifit racheting system, improved radio opaque markers on the stent posts, c shaped steel wire wrapped for better flouroscopy visualisation, 1 cut release, porcine, double valour polyester, flexible copolymer, ptatented linx ac, sizes : 25,27,29,31,33 , heart valve : bioprosthetic heart valvelatest generation, aortic, suitable for future viv,opens at 8 atm pressure, improved radio opaque markers on the stent posts, c shaped steel wire wrapped aroundfor better flouroscopy visualisation, 1 cut release, porcine double valour polyester, flexible copolymer, linx ac, size ; 19,21,23,25,27 , hemodialyzers single use bpa free (all sizes) , high flow humidification system disposable , high flow infusion catheter2.5f,2.8f,3.0f , high flow nasal cannulae system (neonatal size),flexible,kink free tubing with adhesive pads to secure on skin, compatible with use with heated humdifier, sizes preterm neonate , term neonate, infant and paediatric applications , hiv universal protection kit full gown material 50gsm(nw sms) front stichless,fluid barrier cuff (not knitted cuff) 1 nos.disposable bag 1 nos, plain sheet large(25 micron thick pe hygine fil of size 120x210 cm) 2 nos, water proof leggings (cover upto knee) 1 pair, cap 1 nos, mask 1 nos, paper hand towel 2nos, nitrite gloves (latex powder free double layer on finger tip) pair, googles (wearing on the any type of spectcle) 1nos, note: all the product should be in single sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , hme filter , hot water bottle (made of good quality of rubber). , hub cutter ( manual ) , hub cutter ( with electricity ) , hydrocepahlus shunt high pressure , hydrocepahlus shunt low pressure , hydrocepahlus shunt medium pressure , hydrophillic guide wire .032 x 260 cm and .025x260 cm length , hypodermic disposable needles: smaller gauge (like 26g,24g,22g) 1.5 inch , iabp balloon (various sizes) compatible with data scope (macquet)iabp machine. , icd drainage bag , incentive spirometer ( breathing exerciser ) , infantcpapnasalprongs,3.0mmnarediameter/2.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,3.5mmnarediameter/2.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,4.5mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,4mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.0mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.5mmnarediameter/5.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.5mmnarediameter/6.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.0mmnarediameter/6.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.0mmnarediameter/7.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.5mmnarediameter/7.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infant feeding tubes with markings sizes 4fg / 5fg / 6fg / 7fg / 8fg / 9fg / 10fg , intra aortic balloon catheter 7.5fr. , intra aortic balloon catheter 8fr. , intra aortic balloon catheter 9.5fr. , introducer needle, 1fr, 18mm length , intubationstyletreusable(malleablealuminiumwithsmoothhighdensitypolyethyleneoutersleeve) size : 6fr , 10fr, 14fr , iodinate drape : small ; size 15 x 10 cm ; adhesive area : 10 x 10 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : medium ; size 50 x 25 cm ; adhesive area : 30 x 25 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : large ; size 50 x 35 cm ; adhesive area : 35 x 35 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : extra large ; size 90 x 45 cm ; adhesive area : 60 x 45 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , irrigation and suction tube 5mm size 5mm, length 43cm, suction and irrigation tubewith lateral holes with 2 way stopclock for single hand use , i gel laryngeal mask all size , iui cannula (curved) , ivadministrationsetfor photosensitive drugs (photosensitiveivset). should have uv resistant tubing, and priming filter. should be latex free and dehp free. , iv cannnula with wing without port 26g , iv cannnula with wing without port 28g , iv cannula with port with wing 14g , iv cannula with port with wing 16g , iv cannula with port with wing 18g , 20g , 22g , iv cannula with port with wing 24g , iv cannula with port with wing 26g , iv cannula with port with wing 28g , iv cannula with port with wing with safety from needle prick 14g , iv cannula with port with wing with safety from needle prick 16g , iv cannula with port with wing with safety from needle prick 18g , iv cannula with port with wing with safety from needle prick 20g , iv cannula with port with wing with safety from needle prick 22g , iv cannula with port with wing with safety from needle prick 24g , iv cannnula with port with wing with safety from needle prick 26g , iv cannula with wing without port 16g , iv cannula with wing without port 18g , iv cannula with wing without port 20g , iv cannula with wing without port 22g , iv cannula with wing without port 24g , i.v. cannula fixator crepe material , i.v. cannula fixator with semi premeable transparent film with pad , iv extension line 10cm with three way , iv extension line 100cm with three way , iv line filter with injection port , iv micro drip infusion set with drop size reduced to 60 drops per ml for paediatric and critical therapy, manufactured from non toxic , clear and transparent p.v.c material, sharp piercing spike for easy insertion in fluid container along with built in preventive bacterial air vent, infusion set has a cylindrical collapsible drip chamber for proper visulization od the drop rate, provided with disc type fluid filter to filter any particulate matter in the i.v fluid, long super smooth kink resistant tubing with efficient roller controller for accurate and unrestricted flow,y type injection port made up of silicone provided for extra medication, luer lock connector for secure fitment to all standard devices, sterile and individually ribbon packed. , iv microdrip set with burrette : measured volume set : 100ml ; 100% latex free provided with y type injection port made up of silicone for additional medication and luer slip connector, equipped with a micro drip with reduced drop size of 60 drops per ml, provided with a burette type chamber of 100 ml capacity with 10 ml overflow limit, burette chamber is made of bio compatible medical grade transparent styrene polymer, suitable for infusing all types of fluids, unique floating auto shut valve acts as a floating indicator and automatically shuts off the drain path to prevent the passage of air in the line, no kink device prevents kinking of tube during transportation and transfers, separate plugs for extra medication and change over, sterile, individually packed. , iv microdrip set with burrette : measured volume set : 150ml 100% latex free provided with y type injection port made up of silicone for additional medication and luer slip connector, equipped with a micro drip with reduced drop size of 60 drops per ml, provided with a burette type chamber of 150 ml capacity, burette chamber is made of bio compatible medical grade transparent styrene polymer, transparent , cylindrical & calibrated measured volume chamber with bold scale, bacteria retentive ait inlet on spike, microdrip with 60ml drops per ml, 15micron fluid filter in the drip chamber, tube length : 150cm, soft and kink resistant pvc tubing. , iv needle 16g/18g/20g in 1/2, 1 & 1.5 length , iv needle 21g/22g/23g/24g in 1/2, 1,1.5 length , iv needle 26g in 1/2, 1,1.5 length , iv set with airvent, dehp free, sharp and easy piercing air vented spike, bacteria retention air inlet with snap cap, approx 20 drops/ml, , iv set , safety infusion set, dehp free , vented spike fits tightly, ensuring easy insertion and removal, comes with unique air stop feature which is a hydrophilic filter membrane present at the bottom of the drip chamber which prevents the ingress of air in case of emptied fluid container, provided with an innovative prime stop, which is a hydrophobic membrane placed on the luer lock fitting that stops fluid leaking and dripping on the floor, longer drip chamber fits firmly in the users hand, ensuring abetter grip, specially designed y type injection port made up of silicone havin resealing property is provided for additional medication, soft, see through, clear 180 cm long dehp free pvc tubing, which is kink resistant for uninterrupted and smooth flow, advance, handy roller clamp for efficient control, sterile and individually blister packed. , ivseteo sterileanddehpfree(vented)20drops/ml,rollerclamp,0.2micronaireliminatingfilter,priming filter, should be latex free, pvc free. , precision infusion set : i.v set with dial flow controller specially designed for controlling the flow rates of fluid, eliminates the need of expensive electronic i.v pumps, provided with soft and kink resistant clear pvc tubing for uninterrupted flow, gentle gravity drive is self correcting, wide dial operates as thumb wheel like roller clamp, security door prevents the accidental change of flow rate, low cost disposable set provides maximum safety, traditional grip, reliable flow control, and ergonomic shape, provided with specialised y type injection port made up of silicone for additional medication, dehp free, sterile , individually packed. , kit for angiography ( radial) : kit should contain 1.) radial sheath (should be usfda approved) 1pc 2.) diagnostic catheter (should be usfda approved) 1 pc 3.) guidewire 0.035 x 150 1 pc 4.) pressure line m/f 1 pc 5.) manifold 2 port 1 pc 6.) luer lock syringe 10ml 1pc , kit for angiography ( femoral) : kit should contain 1.) femoral sheath ( should be usfda approved ) 1pc 2.) diagnostic catheter jl (should be usfda approved ) 1 pc 3.) diagnostic catheter jr ( should be usfda appoved) 1 pc 4.) guidewire 0.035 x 150 1 pc 5.) pressure line m/f 1 pc 6.) manifold 2 port 1 pc 7.) luer lock syringe 10ml 1pc , knee drape : material : 50 gsm sms polypropylene water repellent. overall size 240 x 340cm ; elastic aperture 5cm dia. polysheet lining. 120 x 120 funnel. polysheet lining 1.20 x 1.20m. sterlized pack. 5 years expory life. packing material 45gsm polypropylene one side and another side tyvek paper 25gsm , lamino spinal drape ; material : 50gsm sms polypropylene fabric water repellent ; sheet siz size: 1.5x3.0m ; incise sheet : 15 x 35cm : polysheet lining 1.20 x 1.20cm ; sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper m) ; , lancet device (pricker), hold the lancet for finger prick blood sugar , lancet needle 30 gauge / 31 gauge single use compatible with all type of pricker , lancet safety lancet single use safety device that cannot be used after activation, minimising the risk of needle stick injury and cross contamination between different people. , laryngeal mask airway pvc (disposable) size 1 to 5 , laryngeal mask airway silicon size 1 to 5 , laryngeal mask airway intubating (disposable) all sizes , laryngeal mask airway intubating (reusable) all sizes , laryngeal mask airway standard (disposable) all sizes , laryngeal mask airway standard (reusable) all sizes , laryngeal mask airway with port for naso gastric tube with preformed curve (disposable) all sizes , laryngeal mask airway with port for naso gastric tube with preformed curve (reusable) all sizes , laryngeal mask airway with port naso gastric tube, flexible and no curve (reusable) all sizes , laryngeal mask airway with preformed curve (disposable) all sizes , laryngeal mask airway with preformed curve (reusable) all sizes , leadercath arterial line all size , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 2 x 2 , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 4”x4’ , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 6”x6’ , makintosh sheet ( rubber sheet ) roll size : 90cm x 10mtrs , male cath (silicon) all sizes , male urinary incontinence device , malecot catheter 6f to 24f all sizes & length , malecot catheter soft : 6,8,10,12 f (usfda/ce approved) , masimo rd sedlline eeg sensor , masimo rd set , masimo o3 sensor rso2 , mayo trolley cover (75x90cms.) – 1 (exclusion coated heavy duty (imperable waterproff) , measuring jug for urine and other liquid material , metallic telescope dialators for pcnl indian & imported , mettalic tracheo bronchial stent straight all sizes , mettalic tracheo bronchial stent y shaped all sizes , micro suction tubes sizes 9 fr should have a vacuum control port, malleable shaft, should equipped with a length of tubing and clamp terminating with a ¼ in (0.64cm) connector. , mini tracheostomy non seldinger kit , mini tracheostomy seldinger kit , minimally invasive aortic root cannula with length more than 30 cm should have more than 30 cm long body to allow insertion during mics , minimally invasive retrograde cardioplegia cannula with deflecting tipsizes 13 and 15 fr should have tip deflecting models for sinus placement through thoracotomy should be able to allow minimum 10mm sweep.should be auto/ manual inflatable. , mucus extractor, sterile, disposable , multi lumen extension sets (v set) three lines , multi lumen extension sets (v set) two lines , multichannel cardioplegia cannula , multifunctionalmaskdesignedtoadministerhighoxygen&toreducetheriskofco2rebreathing.maskhasa provision of attaching nebulizing chamber to administer nebulization medication. double oxygen tubing available with mask allows for nebulization without interupting oxygen therapy. special opening on sides to accommodate ng and og tubes. accessforhydration,oral suction or oral medicine without interrupting oxygen therapy.fda approved. (mask, adapter, two 7 oxygen tubing & nebulizing chamber) , multiple use injection port for syringes , multiple stage venous cannula should have polyurethane wire wound body with radiopaque markers and multiple holes at distal end. sizes 23fr. , multiple stage venous cannula should have polyurethane wire wound body with radiopaque markers and multiple holes at distal end. sizes 29fr. , mva kit ( manual vaccum aspiration kit ) one pack of double valve kit must contain 1 pc double valve syringe , connectors, lubricating oil , and 1 pc cannula of each size 4,5,6,7,8,9,10,12mm , napkin absorbant all sizes , nasal cannula, infant , nasal cannula, neonate , nasal cannula, premature neonate , nasal cpap 10cm h20 , nasal pack 4.5 cm , nasal pack 8.0 cm , nasal pack with airway 8.0 cm , nasal prongs (disposable) for neonates , nasal tampoone polymethylene 8cm , nasogastric (ryles) tube ( pvc) with connector size : 6fg / 8fg / 10fg , nasogastric (ryles) tube ( pvc) with connector size : 12fg / 14 fg / 16fg / 18fg / 20fg , nasogastric (ryles) tube ( pvc with silicon elastomer coating) with connector size : 6fg / 8fg / 10fg , nasogastric (ryles) tube ( pvc with silicon elastomer coating) with connector size : 12fg / 14 fg / 16fg / 18fg / 20fg , nasopharyngeal airway : suitable for suctioning in i.c.us and provide an alternative way when oro pharyngeal airway is occluded, design of the tube conforms to the nasopharyngeal anatomy, flexible for maximum patient comfort, tube manufactured in medical grade pvc is soft, flexible and kink resistant, soft material for enhanced nasal passage comfort, atraumatic soft rounded edges and smooth surface, specially designed bevel tip reduces mucosal trauma during insertion, tube marked with the internal diameter for easier size identification, thin wall construction provides maximum inner diameter, interior walls with channel grooves facilitate easy insertion of catheter, removal 15 mm connector to allow connection to ventilation systems, individually packed in peelable pack. size : 3.0mm 8.5mm , nebuliser kits (jet/venturi type) – specialty specific , nebuliser kit with ‘t’ piece for ventilator circuit with oxygen tubing , nebuliser kit with adult mask and oxygen tubing , nebuliser kit with neonatal mask and oxygen tubing , nebuliser kit with paed. mask and oxygen tubing , nebulizer mask with double moulded (soft seal) pvc free aerosol mask with 2.0 mtr. tube, metal nose clip should mri compatible sizes: adult, child , needle cutter: stainless steel alloy adjustable blade,safe,hygiene,easy to use, no maintenance cost,compact & practical dimension , needle for – sacrospinal puncture in pelvic floor mesh repair , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore ext set , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore bi ext set , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore tri ext set , needle less syringe 10ml , needle less syringe 2ml , needle less syringe 3ml , needle less syringe 5ml , nelatonurinarycatheter size 6fr 20 fr , neontal weighing machine up to 5 kg , neuro patch 1.5cm x 3cm , neuro patch 2cm x 10cm , neuro patch 4cm x 5cm , newborn kit (consisting of neonatal front open clothes, bib, cloth diapers, baby towel, wet wipes , nibp cuff (all sizes for neonates) compatible with mindray multipara (neonatal) monitors. , noninvasivepositiveairwaypressuredevicewithamouthpiece,walloxygenport&manometerport&can accommodate nebulizer for aerosol therapy , non vented niv masks. disposable, full face mask, for use with niv module of invasive mechanical ventilators, should be completely air tight, no vent should be present over surface of mask, there should be facility to increase or decrese the mask tightness. , one piece pediatric aortic cannula size 6fr 16 fr vented, should be beveled with thin wall tips and should be elongated one piece. size 6fr. / 8fr. / 10fr. / 12fr. /16fr. / 18fr. , ophthalmology hydrophilic acrylic foldable lense optic diameter 6.00mm, overall length 12.50mm, a constsnt 118.00 , ophthalmology hydrophilic acrylic foldable lense optic diameter 6.00mm, overall length 12.50mm, a constsnt 118.00, fully aspheric optics with 360 degree squareedge , ophthalmology hydrophobic foldable single piece intraocular lense , ophthalmology hydrophobic foldable acrylic lens with preloaded injecting system diameter 6.00mm, overall length 13.00mm, a constant 118.4, fully aspheric optics. , ophthalmology hydrophobic foldable acrylic lens semi preloaded, natural yellow, chromophore, 360 degree, square edge, fullr aspheric optics diameter 6.00mm, overall length 13.00mm, a constant 118.4 , ophthalmology hydrophobic acrylic foldable lens diameter 6.00mm, overall length 13.00mm, a constant 118.40 , ophthalmology pmma , ophthalmology amniotic membrane , ophthalmology balanced salt solution with and without glutathian bss plus & bss plain , ophthalmology c3f8 gas for intraocular use , ophthalmology side port blade , ophthalmology cresent blade , ophthalmology keratome blade , ophthalmology implant blade , ophthalmology mvr virectomy blade , ophthalmology glaucoma valve implant / drainage devices , ophthalmology intraocular lens implant (multipiece) foldable , ophthalmology intraocular lens implant (single piece) foldable (firm should quote their higher version/medium and lower version lenses. , ophthalmology laser probe (curved) 23g, 25g , ophthalmology ologen collagen matrix implant , ophthalmology phaco pack for infiniti vision system , ophthalmology sterile eye drape and pad , ophthalmology viscous fliud injector pack , ophthalmology vitrectomy total plus pack valveless in 23 g and 25 g , oro pharyngeal airway : disposable guedel airway 0 no, 00 no, 000 no, 0000 no. , oro pharyngeal airway : disposable guedel airway 1, 2, 3, 4, 5, 6 no. , ostial perfusion cannula with basket tip and soft convex tip sizes 10 fr, 12 fr and 14 fr. should have flanged, radiopaque basket tips/soft tips attached to malleable stainless steel shafts. size 10 fr./ 12 fr. / 14fr. , oxygen mask high concentration with reservior bag , oxygen mask with non rebreathing reservoir bag with 2 3 meter long oxygen tubing , oxygen mask with bacteria filter , oxygen mask with capnography port adult , oxygen mask with co2 monitoring line, adult , oxygen twin bore nasal cannula soft tip curved with tubing adult paed, neon , oygen mask double moulded (soft seal), pvc free oxygen mask sizes adult, child , oxygenator without integrated filter ( adult ) , oxygenator without integrated filter ( paediatric ) , packed red cell & whole blood leucocyte reduction filters. bedside filtration of one & two unit of packed red blood cells or whole blood should have universal spike with microbiological recovery vent, should be with attached straight administration set/automatic self leveling drip chamber performance shouldconsistently average less than 2x105 residual leukocytes per unit, red cell recovery should average greater than 90%. filter housing hold up volume should be <25ml for one unit filter and <35ml for two unit filter it should be single use should be latex free , patient identification band along with logo of rims for mother & baby (combined) , patient identification band along with logo of rims for adult & pediatric , pauls tracheal culture bottle simplifies procedure for sampling of tracheal fluids, secure sterile bottle ensures accuracy of culture tests, vaccum coltrol connector allows easy and quick sampling procedures , graduated suction tubes allows a reading for depth of intubation , pa vent cannula should have a soft, pliable tip with female luer end; should have movable depth marker and an introducer needle should be included. , pcn dilators 6 14 fr , pcn set 10fr , pcn fascial dilator 6fr onwards (indian & imported) , peadritic closed suction with y adapter with colored coded silicon catheter, blunt tip, size 5fr, 6fr, 7fr, 8fr, 10fr , pediatric and adult intraosseous needle , pediatric central venous catheter (femoral) 16/18 and 18/20 gauze , pencil ( all types of electrode tips) , penile cateter large/medium/small , permanent double lumen dialysis curved catheter with split tip,cuff and airguard valve introducer size 14.5f length 19cm, 23cm, 24cm , pigtail stents 7fr/5cm,7fr/10cm, 7fr/15cm, 10fr/15cm, 10fr/5cm, 10fr/10cm, 10fr/15cm , plain sheet large for ot table. 25 micron thick pe hygine film , size 120 x 210cm, note: product should be in sterilized pack.packet material 45 gsm polypropylene one side and another side 25gsm tyvek paper with 5 years expiry life. , plain sheet for instrument table 25 micron thick pe hygine film , size 120 x 150cm, note: product should be packed in sterilized pack.packet material 45 gsm polypropylene film one side and another side 25 gsm tyvek paper with 5 yrs expiry life , plasma exchange kit , plasma exchange kit for multifiltrate , plasma filter 0.2m2 , plasma filter 0.5m2 , plastic apron (above knee length), disposable (sterile, packed individually) , plastic apron (long below knee length) , disposable (sterile, packed individually) , pop bandage different sizes 10cm x 2.7mtrs , pop bandage different sizes 15cm x 2.7mtrs , posterior vitrectomy pack constellation, for retinal surgery 23g and 25g , postrier vitrectomy pack oertli for retinal surgery 23g and 25g , pre filled sterile normal saline flush device (3ml) , pre filled sterile normal saline flush device (5ml) , pre filled sterile normal saline flush device (10ml) , pre filled terminally sterile flush syringes of normal saline in 3 sizes:3ml , pre filled terminally sterile flush syringes of normal saline in 3 sizes:5ml , pre filled terminally sterile flush syringes of normal saline in 3 sizes:10ml , premature soft tip nasal cannula should have soft tip nasal cannula with tubing. ce marked. , pressure domes compatible with maquet heart lung unit , pressure dressing all types , pressure infusion bag disposable 0.5 ltr , pressure infusion bag disposable 0.5 ltr with manometer , pressure infusion bag disposable 1.0 ltr. , pressure infusion bag disposable 1.0 ltr. with manometer , pressure infusion bag reusable 0.5 ltr with manometer , pressure infusion bag reusable 1.0 ltr. with manometer , pressure extension line low pressure large bore extension line madeup of pvc 10cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line low pressure large bore extension line madeup of pvc 150cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line low pressure large bore extension line madeup of pvc 200cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line 100cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line 150cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line 200cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line high pressure monitoring line100cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure extension line high pressure monitoring line150cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure extension line high pressure monitoring line200cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure transducers single dome disposable with the provision of free supply of interface adaptors/cables for all monitors like philips viridia, philips transport, datex, mindray, ge and dash monitors (and 20% extra, total approx. 300) that would be in use in rims for the entire period of rate contract , pressure transducers double dome disposable with the provision of free supply of interface adaptors/cables for all monitors like philips viridia, philips transport, datex, mindray, ge and dash monitors (and 20% extra, total approx. 300) that would be in use in rims for the entire period of rate contract , promethus system – consists of prometh 1 adsorber, prometh 02 adsorber, albuflow afo 1, blood line primary and secondary set, f 60 dialyser, y – adapter, spike adapter and dialyser exchange set , pulse oximter hand held finger . oxygen saturation range: 0 100%, pulse rate range: 15 320, measurement wavelengths and output power* 1. red: 6 0 nanometers @ 0.8 mw maximum average, 2. infrared: 910 nanometers @ 1.2 mw maximum average, %spo2 accuracy: 70 to 100% ± 2 digits, pulse rate accuracy (20 250bpm): ± 3 digits, internal power:battery: two 1.5 volt aaa batteries, operating life: 600 spot checks (30 secs/spot check) in a 6 month period, storage life: 12 months, weight < 75 gms, iec certifitied with respect to operating temperature, humidity and altitiude, 5 year warranty , puncture needle y shape (extra port) 18 g, 20 g 4cm, 7cm , puncture needle 18 g puncture needle, 90 mm length, 1.20 mm diameter, sharp beveled tip, hub of needle should admit 0.038”aus guide wire, e.g. vygon type , respiratory face mask (n 99), filters 99% of particles, folded mask dimension 240 x 85 mm, thickness 3.6 mm, green colour, duckbill shape, ear loop (elastic bands), ce, iso, en , retrograde cardioplegia cannula with auto inflate sizes 13 fr and 15 fr should have silicon/ pvc bodies with auto inflatable cuff and pressure monitoring lines; should have multiport tip/ integral stopcock. sizes 13 fr , retrograde cardioplegia cannula with auto inflate sizes 13 fr and 15 fr should have silicon/ pvc bodies with auto inflatable cuff and pressure monitoring lines; should have multiport tip/ integral stopcock. sizes 15 fr , reusable cautery pad, whole body size. pediatric, adult, neonatal (gel pad type) , reusablepulseoximetrysensorneonate(masimosettechnology)(withtheprovisionfofreesupplyofinterface adaptors /cables for allmonitors like radical masimo, mindray etc (and 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract , reusable silicon bipolar cable , reusable spo2 (pulse oxymeter) sensor with lead (forall monitors like philips viridia, philips transport, ge, datex, mindray and das monitors) pulse oxymeter machine , scalp vein set all sizes , shoe cover (in pair) disposable : • should be of good quality (thick) • made from non toxic non woven, thick fabric. • well stitched in universal regular size. • skid resistant & dust proof. • hard elasticated for better grip and easy to wear. • should cover the ankles. • size: assorted (std. size of shoe from 7 to 12) & blue color. , silicon ostial cannula for continuous perfusion sizes 15 fr,17fr and 20 fr should have a silicon body with soft bulb shaped tips, should have a female luer connection site. , single stage venous cannula with metal tip sizes 12 31 fr , should have kink resistant wire wound taper body with beveled metal tip. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr. , single stage venous cannula with right angle, should have kink resistant wire wound taper body with tapered multiport tips. should be right angled with plastic tip. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr./30fr. / 32fr. / 34 fr. / 36fr. / 38fr. / 40fr. , single stage straight venous cannula malleable, should have kink resistant malleable wire wound taper body with tapered multiport tips. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr./30fr. / 32fr. / 34 fr. / 36fr. / 38fr. / 40fr. , skin punch biopsy needle , skin stapler with multiple pins preloaded (all type & all sizes) , skin staples remover all types and all sizes , snake suture organizer , spinal needle for interventional pain procedures in painot ; size 16g to 27g , spinal puncture needle. all sizes (gauge & lengths) , spinal needle with pencil point having 1mm side hole opening, having clear transparent groved hub and colour coded stylet, instoducer needle 20g x 13/8. size 25g x 3 1/2 (0.53 x 88mm) and 27g x 3 1/2 ( 0.73 x 88mm) , stent metallic ureteral stent for temporary stenting of the ureter, coil design, 6f, length 26 cm , stent soft ureteral stent set with monofilament tether stent with graduation marks to aid in placement along with monofilament tether for repositioning and ease of removal, pigtail straightener, stent positioner with radiopaque tip, and wire guide , sterile gauze swab 12ply sizes 5cm x 5cm , sterile gauze swab 12ply sizes 7.5cm x 7.5cm , sterile gauze swab 12ply sizes 10cm x 10cm , sterile surgical pad / combine dressing ( absorbant cotton pad with non woven fabric ) size 10cm x 10cm , sterile surgical pad / combine dressing ( absorbant cotton pad with non woven fabric ) size 10cm x 20cm , sterilization reel medical grade paper reel for sterilization, compatible to eto size 5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 7.5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 10cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 12.5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 15cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 20cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 25cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 30cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 35cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 40cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 45cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 50cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 60cm with 200m length , stethoscope , stone basket 3f 4w , stone basket 4f 4w , stone basket 5f 4w , stone basket zero tip 3fr 1.9 , stone basket/nitilon 3fr 1.9 , stone extraction balloon (above injection port) , stone extraction balloon (below injection port) , stone extractor tipless 4.5 , straight tip arch cannula vented and non vented; pediatric and adult, should be beveled thin wall tips attached to tapered cannula bodies. should be available in pediatric and adult sizes. size 8 fr./ 10fr. / 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. , streaming microwire , suction catheter plain – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter thumb control sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter flower tip – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter atraumatic tip – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction machine electrical driven , suprapubic drainage catheter for cystostomy and supra pubic drainage size : 12frto 22 fr , surgeons cap disposable: • should be of good quality • made from non woven breathable fabric of 35 gsm • well fitting with back elastic or string. • air permeable. • properly ultrasonically sealed for uniformity. • different sizes & color. , surgical blade with plastic handle disposable (individual sterile pack) all sizes , surgical blades , carbonated steel all types and sizes. high quality, sterile, individually packed. , surgicalbladeswithsafetyhandles&disposablelock,highperformancescalpelblades,sterilizedbygamma radiation,available in varioussizes,in both highcarbon& stainlesssteel,each bladeispacked in aluminium,carbon steel blades are vpi paper protected,blade no. 10,11,12 & 15 fit on all no. 3 fitment handle,blade no. 18,19,20,21,22,23,24,25,36 fit on all no. 4 fitment handle , surgical blades without handle, all sizes disposable (individual sterile pack) , surgicalblades,carbonated/steelalltypesandsizes.highquality,sterile,individuallypacked.conformingto usfda , surgical disposable gown for use in the o.t., icu, cath lab etc. as a protective covering, for operating, impervious to transferofmicroorganisms,bodyfluidsandparticulatematter.thegowncomprisedofasinglelayerofsms (spunbond/meltblown/spunbond)polypropylenefabricmanualclosurewith2waterabsorbantpapertowels,size (small, medium, large, extra large) aami , surgical eye drape , surgical gown sterile breathable impervious to water / blood / bacteria. should be lint resistance / flame resistance. fabricshouldbereinforcedinkey areasforhighfluidcontact.shouldbeavailableindifferentsizes,wrappedin smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670 / 1671.prefered standard is en13795 , surgical gown sterile breathable impervious to water / blood / bacteria. should be lint resistance / flame resistance. fabric should be reinforced in key areas for moderate fluid contact. should be available in different sizes,wrapped in smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670 / 1671.prefered standard is en13795 , surgical gown sterile breathable impervious to water/blood/bacteria, should be lint resistance/flame resistance. fabric should be non reinforced for low fluid contact. should be available in different sizes,wrapped in smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670/1671. prefered standard is en13795 , surgical gowns large, xtra large, l xtra long, breathable performance fabric, raglan sleeves, colour coded neck binding red, adjustable hook & loop neckline, low linting fabric, book fold, ce certified & aami level 3/en 13795 high performance , surgical hoods protective 3 layer sms fabric, tie neck, universal size & aami l 4 compliant , surgical mask fog free, flat pleated shape, blue colour, ear ties, anti fog layer, dimention finished: 177 x 95 mm, thickness 45 mm ce, en, iso , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 3ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 5ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 10ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 20ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 50ml (with needle) , syringe toomy , syringe sterile disposable hypodermic syringe for single use with needle , 1ml , syringe sterile disposable hypodermic syringe for single use with needle , 2ml , syringe sterile disposable hypodermic syringe for single use with needle , 3ml , syringe sterile disposable hypodermic syringe for single use with needle , 5ml , syringe sterile disposable hypodermic syringe for single use with needle , 10ml , syringe sterile disposable hypodermic syringe for single use with needle , 20ml , syringe sterile disposable hypodermic syringe for single use with needle , 50ml , syringe sterile disposable hypodermic syringe for single use without needle , 1ml , syringe sterile disposable hypodermic syringe for single use without needle , 2ml , syringe sterile disposable hypodermic syringe for single use without needle , 3ml , syringe sterile disposable hypodermic syringe for single use without needle , 5ml , syringe sterile disposable hypodermic syringe for single use without needle , 10ml , syringe sterile disposable hypodermic syringe for single use without needle , 20ml , syringe sterile disposable hypodermic syringe for single use without needle , 50ml , syringe sterile disposable hypodermic syringe for single use without needle , 0.5ml , syringe sterile single use , reuse prevention syringe with detachable needle , 2ml , syringe sterile single use , reuse prevention syringe with detachable needle , 3ml , syringe sterile single use , reuse prevention syringe with detachable needle , 5ml , syringe sterile single use , reuse prevention syringe with detachable needle , 10ml , syringe bulb irrigation 50ml , syringe insulin 1ml , t piece connector for ventilator circuit (all male female combinations) , t piece connector with expandable tubing and oxygen tubing of 3 meter. , t piece in line self sealing , t piece resuscitator circuit, disposable,1.6 metres long, for use with mechanical infant resuscitator during resuscitation of newborns , temporary pigtail pacing wireshould include unipolar atrial and ventricular pacing, pediatric unipolar pacing, and the bipolar pacing lead. , thermometer digital (should be 100% mercury free, should have dual display of body temperature (°c & °f), should be ce marked , thermometer disposable tympanic , thermometer rectal & infrared , thoracic drainage catheter size : 12fg/ 14fg / 16fg / 20fg / 24fg / 28fg / 32fg , thoracic drainage catheter with trocar size : 8fg / 10fg / 12fg / 14fg/ 16fg / 20fg / 24fg / 28fg / 32fg / 36fg , three stage venous cannula, should be three stage venous cannula for vacuum assisted venous drainage(vavd) / kinetic assisted venous drainage(kavd) sizes 29/29/29 fr , three stage venous cannula, should be three stage venous cannula for vacuum assisted venous drainage(vavd) / kinetic assisted venous drainage(kavd) sizes 29/46/37 fr , three way stop cock , three way stop cock without any dead space (placenta system) , titanium clips, all sizes and all types alogwith provision of free applicators , tmt paper 215x280mm compatible with shiller tmt machine , tracheal tube introducer (bougie) : should provide rigidity to endotracheal tube to facilitate et intubation , should habe iltra smooth surface for low friction , should have a traumatic angled tip, should have marking provided all along tube to facilitate identification of tube position , should have vented lumen for oxygen feed size 6fr, 10fr, 15fr , tracheostomy button / decannulation plug , tracheostomy cover bib , tracheostomy mask adult , tracheostomy mask paed , tracheostomy speaking valve , tracheostomy tube – cuffed , sizes 3.5mm, 4mm, 4,5mm, 5mm, 5.5mm, 6.0mm, 6.5mm, 7.0mm, 7.5mm, 8.0mm, 8.5mm, 9.0mm, 9.5mm, 10mm, , tracheostomy tube – uncuffed , sizes 3.5mm, 4mm, 4,5mm, 5mm, 5.5mm, 6.0mm, 6.5mm, 7.0mm, 7.5mm, 8.0mm, 8.5mm, 9.0mm, 9.5mm, 10mm , tracheostomy tube (pvc siliconised) cuffed with disposable inner cannula, all sizes , tracheostomy tube (pvc siliconised) cuffed with integrated subglottic suction port, all sizes , tracheostomy tube (pvc siliconised) cuffed with single cannula (without inner cannula), all sizes , tracheostomy tube (pvc siliconised) cuffed with tapered distal tip and inverted cuff shoulder, all sizes , tracheostomy tube (pvc siliconised) uncuffed with disposable inner cannula, all sizes , tracheostomy tube pvc – siliconised, uncuffed with single cannula (without inner cannula), all sizes , tracheostomy tube pvc siliconised with adjustable length/flange, all sizes , tracheostomy tube reinforced with adjustable flanges all sizes , tracheostomy tube silicon cuffed with cuff volume maintenance device, obturator, tracheostomy tube tie and 15 mm disconnect wedge. – sizes 5,6,7,8 , tracheostomy tube with fenestration, all sizes , tracheostomy tube (pvc siliconised) cuffed with reusable inner cannula, all sizes , tracheostomy tube, neonatal, uncuffed, size 2.5mm , tracheostomy tube, neonatal, uncuffed, size 3.5mm , tracheostomy tube, neonatal, uncuffed, size 3mm , tracheostomy tube, neonatal, uncuffed, size 4mm , tracheostomy tubes reinforced with cuff pressure monitoring all sizes , tracheostomy tubes silicon cuffed (air cuff) adult sizes 5, 6, 7, 8, 9 , tracheostomy tubes silicon uncuffed adult sizes 5, 6, 7, 8 , tracheostomy tubes silicon uncuffed neonatal sizes 2.5, 3, 3.5, 4 , tracheostomy tubes silicon uncuffed pediatric sizes 4.5, 5 , tracheostomy tubes with cuff pressure monitoring all sizes , tur set , tur loop cutting , u bag standard (made of medical grade non toxic,biocompatible p.v.c. sheets,two layered,laminated pvc sheet to avoid any leakage/seapage,providing hanging & carrying systems) , ubarpack /ubarpackvi oneouterwrap35x 35,onesuture bag,oneu drapewith controlreinforcement 75x124, one bar drape with control reinforcement 70x98 & ce certified, aami l 4 compliance , ultrasound jelly ( 250 gms tube ) , ultrasound jelly ( 5kgs jar ) , ultrasound transducers water balloon , umbilicalcatheter,radio opaqueandtransparentpvc,distancemarkingseverycentimeterfrom5 25cm,flexible thermo sensitive material with open and rounded distal tip, fr 03,04,05,06,07,08 , umbilical cvc no plain, fr 04/fr 05/fr 06 , umbilical double lumen catheter, polyurethane size: fr 2.5, length 30cm , umbilical single lumen catheter, polyurethane all size & all length for neonates , under buttock drape with fluid collection pouch 101.5cmx112cm, control plus absorbent pad , under pad sheet size 60 x 90cm , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 500ml ( single chamber ) , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 1000ml ( single chamber ) , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 2000ml ( double chamber ) , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe 60x60 cm – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 120x150 cm – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe 40x60 cm, – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 80x175 cm – individual unsterile pouch pack , underpad/underlay/protective sheet, with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 60x90 cm,– individual unsterile pouch pack , universal pack major, 1 back table cover, zone reinforced, 44x90, 112cm x 229cm, 1 mayo stand cover,reinforced,23x54,58cmx 137cm,1 suture bag,1 absorbenttowel,15x22,38cm x 56cm, utility drapes,25x15,63.5cmx55.5cm,withtape,1suturebag,1bottomdrapewithcontrol*plus,76x76,193cmx 193cm, 1 top drape with control*plus, 108 x 50, 274 cm x 127cm, 2 side drapes with control*plus, 44x76, 112 cm x 193cm , universal pack minor, 1 back table cover, zone reinforced, 44x88, 112cm x 224cm, 1 mayo stand cover, reinforced, 23x54, 58cm x 137cm, 1 suture bag, 1 bottom drape with surround, 65x76, 165cm x 193cm, 1 top drape withsurround, 109 x 59, 277 cm x 150cm, 2 side drapes with surround, 45x33, 114 cm x 84cm , urchin heart positioner , ureteral access sheath all sizes and types (8, 10,12,14 fr) , ureteric catheter 3,4, 5,6 fr , ureteric dialation set – teflon (indian) , uretheral catheter open end + closed end different sizes 3, 4, 5 6, 7, 8 , uretheral dialator (teflon) all sizes indian , uretheral stent siliastic 6f, 8f & 10f without balloon catheter used in padiatric urethroplasty , uretheral stents double j stent different sizes , uretheral stents mono j stent different sizes , uretheral stents triple j stent different sizes , urethral dilation set 5f to 20 f , urethral splint : 6,8,10,12,14 f , urine collection bag, graduated in ml with measured volume meter for accurate measurement of urine, also available with needle free sampling port , inlet tube length 120cm, capacity of urine collection bag 2000ml, soft, frosted and kink resistant pvc tubing with t type bottom outlet, available with molded hanger for easy handling. , urinal – autoclavable , urine pot with measure plastic (female) , urine bag with t type bottom outlet for single hand operation and efficient emptying of the bag, capacity 2000ml, tube length 100cm , urine bag for paediatrics , urine bag leg bag set , urine collecting bag, neonatal size , urine pot with measure plastic (male) , urine sample collection bag with sticker (paed) , uro dynamic catheter double lumen 5f , uro dynamic catheter double lumen 7f , uro dynamic catheter triple lumen 7.4f 30cm , urosticks , urostomy one pc pouch * urostomy pouch * cut to fit * softlex skin barrier * without starter hole * without tape border * odour barrier rustle free film * with comfortwear panels boy side only * barrier opeing up to 38 mm & pouch length 22 cm. , urostomy pouch , urostomy pouch with accuseal tap, standard opaque with flange 38,45,57 cm , urostomy/vesicostomy bag (pediatric) , urovac bladder evacuator material latex , uternie evacuation kit double valve aspirators to generate a vacuum equivalent to that of eva, should be steam auto clavable at121 degreecelsius(250degreef)for30minutes,itshould be 610 660 mm(24 26 in)hg vacuumis comparable to eva, usfda approved. , venous cannulae single stage. (neonate) thin flexible wire reinforced straight open light house tip. overall lengthapprox.28cm with ¼ acceptance size 12fr, 14fr and 16fr , vented niv masks s, m, l. disposable full face masks forcpap/bipap machines, should be compatible with all available machines, cushioning technology to maximize comfort, sealing technology to minimize leakage,harness should be easy to remove and reattach. , ventilator/breathingcircuitwith‘y’connector–paediatric.(smoothboretubingwiththesmoothinnerlumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector – adult (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector– neonate. (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector – paediatric. (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator tubings for neonates , ventilator/breathing circuit with ‘y’ connector – adult (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator/breathing circuit with ‘y’ connector –neonate (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventricular catheter , ventricular catheter passer , ventricularexternalcsfdrainagesystem(containingonebag,oneventricularcatheterwithstylet,connector, trocar, catheter anchoring collar, connecting tube) , ventricular part of hydrocephalus shunt , ventricular peritonial shunt (paed) system like ceredrain system , venturi mask adult , venturi mask paediatric , veres needle all types and all sizes , vertical isolation drape for dhs, drape size 90x126, 229cm x 320cm, clear film, adhesive incise area 16x30, 41cm x 76cm, tube holders, centralrelease tape strip forhorizontal rod attachment, fluid collection pouch with suction port, ce certified, aami l 4 compliance , vertical tube attachment device all type & all sizes , vessel cannula with and without valve should have clear and radiopaque bodies.these should terminate with a female luer.should have tips in various sizes and shapes. sizes 2mm,3mm, 4mm , vessel dilator 10f,12f,14f coons type , vessel tip 16g /17 g , voice prosthesis system like provox trachphone , vp shunt (adult) with high pressure , vp shunt (adult) with low pressure , vp shunt (adult) with medium pressure , waterproof sterile ostomy cover , waterproof sterile wound cover , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 10cm , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 20cm , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 25cm , waterproof silk protein and nanocrystalline silver based sterile transparent pu film surgical wound dressing with adhesive border and center non adherent pu foam high absorbent layer 15x15cm , waterproof silk protein and nanocrystalline silver based steriletransparent pu film surgical wound dressing with adhesive border and center non adherent absorbent layer 10x25cm , water repellant silk protein and nanocrystalline silver based sterile antimicrobial non woven surgical wound dressing with adhesive border and center non adherent absorbent layer 10x25cm , water repellant silk protein and nanocrystalline silver based sterile antimicrobial non woven surgical wound dressing with adhesive border and center non adherent absorbent layer 10x30cm , weighing machine digital up to 150 kg , wide area fixation dressing stretchable and wash proof , winged infusion set non coring needles with injection site to access ports, various sizes 20g x 1.00, 22g x 1.00, 19g x 1.00, 22g x 0.5, 20g x 0.75, 22g x 0.75, 20g x 1.5 & 22g x 1.5 , wire enforced arterial cannula (6 fr to 20 fr) , wrapping sheet cotton (dosuti) 1.5 mtrs x 2.5 mtrs for dead body , wristbands(strechable,waterresistant)allsizes adults,pediatricandneonates;differentcoloursforpatient identification , y connector for biventricular shunt , y connector with ultra long ventricular catheter , y connector with xi ventricular catheter , y set for endoscopic irrigation during turp procedure , yankaur suction vacuum control handle with flexible kink resistant tube, sterile, disposable , single pack (all sizes) , zine paste bandage , polypropylene mesh size 6cm x 11cm , polypropylene mesh size 7.6cm x 15.2cm , polypropylene mesh size 15cm x 15cm , polypropylene mesh size 30cm x 30cm , bidirectional & unidirectional tissue control device of various strenght and various size ; unidirectional 20cm, 3.0, 17mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; unidirectional 20cm, 4.0, 17mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; unidirectional 45cm, 3.0, 19mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ;unidirectional 45cm, 4.0, 19mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; bidirectional 7x7, 5.0, 19mm , chromic gut suture, with needle, size 1 0, 152cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 1, 152cm, 1/2 circle rb heavy 40mm , chromic gut suture, with needle, size 2, 152cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 1, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 2, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 1 0, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 3 0, 76cm, 1/2 circle rb 20mm , chromic gut suture, with needle, size 2 0, 76cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 1 0, 76cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 2 0, 76cm, 1/2 circle rb 40mm , chromic gut suture, with needle, size 1 0, 76cm, 1/2 circle rb 40mm , chromic gut suture, with needle, size 1, 100cm, 1/2 circle rb heavy 50mm , chromic gut suture, with needle, size 1, 76cm, 1/2 circle rb heavy 40mm , triclosan coated polyglactin 910 antibacterial 45 cm , 1/2 circle oval round body, needle 16 mm, size 5 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 70 cm , 1/2 circleround body, needle 20 mm, size 4 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 1/2 circleround body, needle 30 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 1/2 circleround body, needle 30 mm, size 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 3/8 circle cutting, needle 25 mm, size 3 0, box of 12 foils , triclosan coated polyglactin 910 70 cm , 1/2 circleround body, needle 30 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body, needle 40 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body, needle 40 mm, size 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body (heavy), needle 40 mm, size 1, box of 12 foils , triclosan coated polyglactin 910 70 cm,1/2 circle round body (heavy),needle 40 mm,size 1, box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle reverse cutting needle 40mm,size 2 0,box of 12 foils , triclosan coated polyglactin 910 45 cm,3/8 circle cutting needle 22 mm, size3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm,3/8 circle cutting needle 26 mm,size 2 0,box of 12 foils , triclosan coated polyglactin 910 90 cm, 1/2 circle reverse cutting os,needle 40 mm,size 1, box of 12 foils , triclosan coated polyglactin 910 70 cm, 1/2 circle round body,needle 20 mm size 3 0, box of 12 foils , triclosan coated polyglactin 910 45 cm,5/8 circle cutting needle 16 mm,size 4 0, box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circlecutting needle 22 mm,size 3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm, 1/2 circle reverse cutting os,needle 40 mm size 2,box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle tapercut, needle 36 mm, size 3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle tapercut,needle 40mm size 0.box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle reverse cutting os, needle 36 mm size 0,box of 12 foils , triclosan coated polyglactin 910 35 cm,1/2 circle reverse cutting (heavy) port, needle 23 mm size 1.box of 12 foils , triclosan coated polyglactin 910 70 cm, 1/2 circle reverse cutting (heavy)port. needle 23 mm size 1.box of 12 foils , triclosan coated polyglactin 910 45 cm, 1/2 circle reverse cutting os 8 needle 40 mm size 2,box of 24 foils , poliglecaprone 25 , 70 cm,3/8 circle reverse cutting ps 1needle 24 mm,size 3 0,box of 36 foils , poliglecaprone 25 ,70 cm,3/8 circle cutting ,needle 25 mm,size 3 0,box of 12 foils , poliglecaprone 25, 70 cm,5/8 circle round body ur 6 uro,needle 26 mm,size 2 0,box of 12 foils , poliglecaprone 25 , 70 cm,1/2 circle round body,needle 30mm,size 2 0,box of 12 foils , poliglecaprone 25, 70 cm,1/2 circle round body needle 30 mm size 0,box of 12 foils , poliglecaprone 25 , 70 cm,straight cutting, needle 60 mm size 3 0,box of 12 foils , poliglecaprone 25, 70 cm, 1/2 circle round body ,needle 20 mm.size 3 0 box of 12 foils , poliglecaprone 25 , 70 cm, 1/2 circle round body, needle 30 mm.size 2 0 box of 12 foils , poliglecaprone 25 , 70 cm, 1/2 circle round body, needle 30 mm.size 0 box of 12 foils , poliglecaprone 25 , 70 cm,3/8 circle reverse cutting, needle 26 mm,size 3 0,box of 12 foils , nylon suture 70 cm,3/8 circle cutting ,needle 16 mm,size 3 0,box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 26 mm, size 3 0, box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 45 mm, size 2 0, box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 45 mm size 0,box of 12 foils , nylon suture 100 cm.1/2 circle reverse cutting (heavy), needle 45 mm,size 1, box of 12 foils , nylon suture 150 cm loop,1/2 circle round body,needle 40 mm,size 0,box of 12 foils , nylon suture 100 cm,1/2 circle round body (heavy),needle 40 mm,size 0,box of 12 foils , nylon suture 100 cm,1/2 circle round body (heavy),needle 40 mm,size 1,box of 12 foils , nylon suture 150 cm loop.1/2 circle round body (heavy),needle 48 mm.size: 1,box of 12 foils , nylon suture 100 cm,1/2 circle reverse cutting (heavy),needle 50 mm size 1, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 3 0, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 0, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 2 0, box of 12 foils , nylon suture 70 cm, 3/8 circle cutting,needle 90 cm , size 1, box of 12 foils , nylon suture 70 cm, 3/8 circle cutting,needle 90 cm , size 2, box of 12 foils , black braided silk 90 cm,3/8 circle cutting , needle 16 mm,size 4 0, box of 12 foils , black braided silk 90 cm,3/8 circle cutting , needle 16 mm,size 3 0, box of 12 foils , black braided silk 76 cm,3/8 circle round body, needle 30 mm,size 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 26 mm,size 3 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 45 mm,size 2 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 45 mm,size 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 16 mm,size 4 0, box of 12 foils , black braided silk 76 cm,1/2 circle reverse cutting, needle 50 mm,size 2 0, box of 12 foils , black braided silk 76 cm,3/8 circle cutting, needle 60 mm,size 1, box of 12 foils , black braided silk 76 cm,3/8 circle round body, needle 16 mm,size 4 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 25 mm,size 3 0, box of 12 foils , black braided silk 76 cm,1/2 circle round body, needle 20 mm,size 4 0, box of 12 foils , black braided silk 76 cm,1/2 circle round body, needle 20 mm,size 3 0, box of 12 foils , black braided silk 76 cm,1/2 circle tapercut, needle 17 mm,size 4 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 35 mm,size 3 0, box of 12 foils , black braided silk 76 cm,straight round body, needle 50 mm,size 2 0, box of 12 foils , black braided silk 76 cm,straight cutting, needle 60 mm,size 2 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 30 mm,size 2 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 30 mm,size 0, box of 12 foils , black braided silk 90 cm,1/2 circle tapercut, needle 17 mm,size 2 0, box of 12 foils , black braided silk 76 cm,1/2 circle tapercut, needle 25 mm,size 2 0, box of 12 foils , polypropylene suture monofilament 70 cm , 3/8 circle cutting , needle 22 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 90 cm , 3/8 circle cutting, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut, needle 25 mm, size 0,box of 12 foils , polypropylene suture monofilament 90 cm , 1/2 circle tapercut, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut double needle, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 60 cm , 3/8 circle cutting , needle 16 mm, size 4 0,box of 12 foils , polypropylene suture monofilament 70 cm , 3/8 circle cutting , needle 13 mm, size 6 0,box of 12 foils , polypropylene suture 45 cm, 3/8 circle cutting , needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body double needle, needle 26 mm, size 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body , needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 70 cm, 3/8 circle round body double needle, needle 12 mm, size 5 0, box of 12 foils , polypropylene suture 70 cm, 3/8 circle round body double needle, needle 13 mm, size 6 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle round body(heavy), needle 30 mm, size 0, box of 12 foils , polypropylene suture 150 cm loop , 1/2 circle round body, needle 40 mm, size 0, box of 12 foils , polypropylene suture 150 cm loop , 1/2 circle round body(heavy), needle 48 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle round body, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body(heavy), needle 30 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body(heavy), needle 40 mm, size 1, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle round body, needle 30 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle round body, needle 30 mm, size 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body, needle 16 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut, needle 36 mm, size 2 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body double needle, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle tapercut double needle, needle 17 mm, size 4 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle tapercut , needle 17 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle reverse cutting, needle 45 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut double needle , needle 25 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle cutting , needle 16 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut double needle, needle 25 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 45 cm, 3/8 circle reverse cutting, needle 12 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body, needle 16 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body double needle, needle 16 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 100 cm, 1/2 circle reverse cutting(heavy), needle 45 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body, needle 20 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, straight cutting, needle 60 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body double needle, needle 20 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut(heavy), needle 30 mm, size 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle tapercut double needle, needle 17 mm, size 3 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle tapercut double needle, needle 17 mm, size 2 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle tapercut , needle 17 mm, size 4 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle reverse cutting os, needle 40 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body, needle 20 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 45 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body (heavy), needle 30 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 150 cm loop,1/2 circle round body (heavy), needle 40 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 150 cm loop,1/2 circle round body (heavy), needle 50 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body , needle 20 mm, size 4 0, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body , double needle, needle 30 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 75 cm,1/2 circle round body , double needle, needle 20 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 40 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 40 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle reverse cutting (heavy), needle 50 mm, size 1, box of 12 foils , polyester suture 90cm , 1/2 circle tapercutdouble needle, needle 17mm, size 2 0, box of 12 foils , polyester suture 90cm , 1/2 circle tapercutdouble needle, needle 17mm, size 2 0, box of 12 foils , polyester suture 100cm , 1/2 circle tapercut (heavy),needle 45mm, size 2, box of 12 foils , polyester suture 100cm , 1/2 circle round bodyneedle 25mm, size 3 0, box of 12 foils , polyester suture 76cm , 1/2 circle tapercut ,needle 17mm, size 2 0, box of 12 foils , polyester suture 100cm , 1/2 circle reverse cutting,needle 50mm, size 0, box of 12 foils , metal skin stapler extractor , titanium clip engulfs tissue tip to tip closure, blue small 6 clips, size 100 , titanium clip engulfs tissue tip to tip closure, white medium 6 clips, size 200 , titanium clip engulfs tissue tip to tip closure, green medium large 6 clips, size 300 , titanium clip engulfs tissue tip to tip closure, yellow large 6 clips, size 400 , open applicator small 20cm length for 100 clips , open applicator small 20cm length for 200 clips , open applicator small 20cm length for 300 clips , open applicator small 20cm length for 400 clips , laproscopic applicator for 300 clips , laproscopic applicator for 400 clips , bladeless trocars with tissue seperating flap 5mm contain two 05mm*100mm sleeve/ cannula and one 05mm obturator , bladeless trocars with tissue seperating flap 10mm contain two 10mm*100mm sleeve/ cannula and one 10mm obturator , bladeless trocars with tissue seperating flap 12mm contain two 12mm*100mm sleeve/ cannula and one 12mm obturator , disposable curved circular stapler 29mm row 3 , disposable curved circular stapler 32mm row 3 , 60mm disposable linear cutter stapler , 80mm disposable linear cutter stapler , disposable linear cutter reload 60 3.8 blue, cut line 60mm, staple line 64mm , disposable linear cutter reload 60 4.8 green, cut line 60mm, staple line 64mm , disposable linear cutter reload 80 3.8 blue, cut line 80mm, staple line 84mm , disposable linear cutter reload 80 3.8 green, cut line 80mm, staple line 84mm , laproscopic powder endocutter stapler 60mm medium. mec60 340 , powder endocutter reload used with endoscopic linear cutter, 60mm blue, articulation 60 degree both side and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm green, articulation 60 degree both side and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm white, articulation 60 degree both side and rotation 360 degree , disposable shear 36mm for ultrasonic generator , tissue seperating dual layer mesh with plcl barrier 20*25 oval , tissue seperating dual layer mesh with plcl barrier 15*20 oval , tissue seperating dual layer mesh with plcl barrier 15*15 square , mesh fixation device non absorbable 15 spikes , mesh fixation device non absorbable 30 spikes , mesh fixation device absorbable 30 spikes , mesh fixation device absorbable 15 spikes , bladeless trocars with tissue separating flap 10mm contain: two 10mm*100mm sleeve/ cannula and one 10mm obturator , bladeless trocars with tissue separating flap 12mm contain: two 12mm 100mm sleeve/ cannula and one 12mm obturator , disposable curved circular stapler 29mm row 3 , disposable curved circular stapler 32mm row 3 , 60mm disposable linear cutter stapler , 80mm disposable linear cutter stapler , disposable linear cutter reload 60 3.8 blue, cut line 60mm, staple line 64mm , disposable linear cutter reload 60 4,8 green, cut line 60mm, staple line 64mm , disposable linear cutter reload 80 3.8 blue, cut line 80mm, staple line 84mm , disposable linear cutter reload 80 3.8 green, cut line 80mm, staple line 84mm , laproscopic powder endocutter stapler 60mm medium. mec60 340 , powder endocutter reload used with endoscopic linear cutter, 60mm blue, articulation 60 degree both sides and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm green, articulation 60 degree both sides and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm white, articulation 60 degree both sides and rotation 360 degree , disposable shear 36mm for ultrasonic generator , tissue separating dual layer mesh with plcl barrier 20 25 oval , tissue separating dual layer mesh with plcl barrier 15 20 oval , tissue separating dual layer mesh with plcl barrier 1515 square , mesh fixation device non absorbable 15 spikes , mesh fixation device non absorbable 30 spikes , mesh fixation device absorbable 30 spikes , mesh fixation device absorbable 15 spikes , eye drape , 26 g disposable needle , 23 g disposable needle , crescent , keratome , site port , lens foldable 16 no. , lens foldable 17 no. , lens foldable 18 no. , lens foldable 19 no. , lens foldable 24 no. , lens foldable 26 no. , lens foldable 26 no. , consumables for dvt pumps and enteral feeding pump – make cardinal health , 73011 sml scd express sleeve t/l intx5 , 73012 med t/l scd express sleeve intx5 , 73013 lge scd express sleeve t/l intx3 , 673656 epump 1000ml non sterile x30 , consumables for crrt and bcm machines,make fresenius medical , ultra flux av600 , av cassette blood lines adults + filtrate line(a/v 143 ml) , multifiltrate substituate line 1heater bags , multifiltrate dialysate line (158ml) , hf female spike adapter , filtrate bag 10l , plasma filter (p1 dry) , plasma filter (p2 dry) , skin electrode , multibic solution , consumables for aerogen solo ultrasonic nebulisers , aerogen solo nebulisers (pack of 10) , aerogen solo convenience pack (pkt of 10) (includes 10 x solo nebulisers, adult tees) , aerogen solo adult tee pieces (pack of 10) , aerogen solo paediatric tee pieces (pack of 10) , continuous neb tube set, tubing assembly only (pack of 5) , continuous neb tube set, syringe & cap only (pack of 5) , continuous neb tube set, syringe & cap only (pack of 50) , aerogen solo single patient use mask kit intl (pack of 5) , aerogen solo single patient use vented elbow (pack of 5) , aerogen pro x controller only , ultra only (pack of 10) adult , ultra only (pack of 10) paediatric , ultra and solo (pack of 10) , aerogen pro control module kit international , aerogen pro usb controller starter kit , aerogen pro nebuliser assembly , aerogen pro filler cap (pkt 5) , aerogen pro adult tee with silicone plug (autoclavable) (pkt 5) , aerogen pro paediatric tee with silicone plug (autoclavable) (pkt 5) , aerogen pro mask kit intl (inc. vented elbow & 22 mm f/22 mm m elbow) (autoclavable) (pkt 5) , battery replacement kit , ultra starter kit (pack of 10) adult mask &solo , ultra starter kit (pack of 10) paed mask & solo , consumables for aerogen solo ultrasonic nebulisers , fx 8 single use dialyser cat no. 5004731 , blood tubing 5008 cat no. f00000384 , peadiatric blood tubing 5008cat no. f00001068 , av fistula needle set (bain avf)16 g cat no. apavf005 , av fistula needle set 17 g cat no. apavf003 , bibag 900 gramm cat no. f00006672 , citrosteril 5 ltrs cat no. ap0005158 , puristerial 340 cat no. 5085621 , diasafe plus cat no. 5008201 , double lumen juglar catheter curved 11.5 f cat no. 817009 , double lumen juglar catheter straight 11.5 fr cat no. 817005 , tripple lumen catheter,std , tripple lumen catheter,std , chlorine test kit cat no. 6316881 , hardness test kit cat no. 6350911 , regeneration salt tablets cat no. 5085531 , compatible part a with bibag , filter cartridge 20 20?m big blue cat no. 6349711 , water inlet filter cat no. m395061 , fx 8 single use dialyser cat no. 5004731 , consumables for hotline fluid warmers , hotline warming set disp 30/ca, l 70 , consumables for patient warmers , snuggle warm, adult full body convective warming blanket 10/bx , snuggle warm, pediatric full body convective warming blanket 10/bx , snuggle warm, upper body convective warming blanket 10/bx , snuggle warm, pediatric underbody convective warming blanket 10/bx , consumables for masimo monitors , pediatric for regional oximetry , sensor disposable for regional oximetery (20/box) , sensor disposable for brain function monitoring (25/box) , sensor disposable for continuous hemoglobin, ori, pvi, spo2, pi (10/box) , disposable neonatal spo2 adhesive sensor (20/box) , clip sensor , rad 97 patient cable , adult bp cuff , hose pipe , filters pod for bed air , pediatric for regional oximetry , disposables and modules for cardiac monitor, make edwards , flotrac cardiac output sensor for hemosphere monitor , cvp transducer with pm line and iv set a. it should be able to give a pressure & waveform on minimally invasive continuous cardiac out put monitor. b.it should be able to give a pressure & waveform on any multipara monitor with ibp module. c.it must have 3±1 ml/hr flow rate across flush device with iv bag pressurized to 300 mm hg. d.it must have moisture resistance connector sheath without pin. e.it should have gold/copper/aluminium plated connector wires. f.it must have an operating pressure range of 50 to 300mmhg, with overpressure tolerance range of 500 to +5000mm hg. g. it must have a provision to put arm strap. h.it should have an integrated flush device which can be operated from any direction for easy accessibility. i.it should have a test port that can be used to check the performance of the transducer when used along with a simulator device for the purpose. , acumen iq sensor a. it must be compatible with hemosphere monitor. b. it must able to provide co,ci,svv,ppv,sv,svi,svri,svr, hypotension prediction index, dp/dt, eadyn. , hypotension prediction index module/software for hemosphere monitor , nirs/ cerebral oximetry module for hemosphere monitor. nirs/ cerebral oximetry sensors – large ,medium, small, neonatal , consumables for high flow, make fisher & paykel , 900pt561heated breathing tube (circuit) + mr290, airspiral™, for airvo 2 (box 10 , opt942nasal interface, optiflow™+, adult, small, for mr850 & airvo (pack 20) , opt944nasal interface, optiflow™+, adult, med., for mr850 & airvo (pack 20) , opt946nasal interface, optiflow™+, adult, large for mr850 & airvo (pack 20) , opt970tracheostomy direct connection, mr850 & airvo (pack 20) , 900pt913filter for airvo 2, pack of 2 , 900mr869probe, airway temp & flow, for use with 1.5m circuits . with right angle connector, , mr850 , 900mr805electrical adaptor dual heated, rt circuits , rt380adult ventilator circuit dual heated + rt019 filter + mr290 chamber (box 10) dual heated , disposables forportable deployable isolation system with negative flow make bed air , filter pod , canopy , negative flow attachment...

Health Department - Jharkhand

38614118 rate contract for supply of medicine,chemical and consumable item for sbmch,hazraibagh , drugs items : , tab. albendazole (400mg) , tab. anti cold , tab. amlodipine (5mg) , tab. atenolol (50mg) , tab. avil (chalpheniramin (25mg) , tab. azithromycine 250mg , tab. azithromycine 500mg , tab. cefadroxyl 250mg , tab. cefadroxyl 500mg , tab. calcium d3 500mg , tab. cefixime (100mg) , tab. cefixime(500mg) (200mg) , tab. cetrizine 10mg , tab. cipro 500mg + tz 600mg , tab. ciprofloxacine (500mg) , tab. ciprofloxacine (250mg) , tab. amlodipine (10mg) , tab. amlodipine + telmistarn 5+40 , tab. dicolofenae sodium (50mg) , tab. dicolofenc + paracetamol , tab. dicyclomine 20mg , tab. dicyclomine 20 mg + paracetamol 325mg , tab. domperidon (10mg) , tab. fluconazole 150mg , tab. folic acid 5 mg large , tab. ibuprofen 400mg+ paracetamole 325mg , tab. levofloxacin (500mg) , tab. ketrolac (50mg) , tab. cefixime (200mg) , tab. diazepam (2mg) , tab. diazepam (5mg) , tab. chromostat 500 mg , tab. fursemide 40mg , tab. lanoxin 0.25mg , tab. metformin (500mg) sr , tab. astrovastin 40 mg+ fenofibrate 150mg , tab. voglibose (2mg) , tab. voglibose (3mg) , tab. prochlorperazine , tab. p.c.m.d.t. (250mg) , tab. p.c.m.d.t. (500mg) , tab. p.c.m.d.t. (600mg)/ (650mg) , tab. antacid , tab. dilantoin sodium (100mg) , tab. drotaverine (40mg) , tab. nitrocontin (2.6 mg) , tab. nitroglycerin , tab. ecospirin (75mg) , tab. telmisarten (20mg) , tab. telmisarten (40mg) , tab. aceclofenac (100mg) , tab. ondansetron (8mg) , tab. ondansetron (4mg) , tab. chloroquine 300mg , tab. zinc sulphate (20mg) , tab. levofloxacin (250mg) , tab. metoclopramide 10mg , tab. metronidazole (200mg) , tab. metronidazole (400mg) , tab. nefedipine 10/20 mg , tab.norfloxacin 400mg +tinidazole 600mg , tab. ofloxacin 100mg , tab. ofloxacin 200mg , tab. ofloxacin 200mg+ orindazole 500mg , tab. pantoprazole 40mg , tab. paracetamol 500mg , tab. rantidine 150mg , tab. roxythromycine 150mg , tab. roxythromycine 300mg , tab. salbutamol 4mg , tab. tranaxaemic acid + mefenamic acid , tab. vitamin b complex , tab. losartan potassium 50mg , tab. amoxicillin 250 mg , tab. amoxycilline + clavulanuic acid (625mg) , tab. amoxycilline + clavulanuic acid (325mg) , tab. ascorbic acid 500mg , tab. levocetrizine 5mg , tab. erythromoycin 250mg , tab.cepodoxime proxetil , tab. cefuroxime axetil 250mg , tab. cefuroxime axetil 500mg , cap. omeprazole (20mg) , cap. doxycycline (100mg) , cap. cefalexine (250mg) , cap. cefalexine (500mg) , cap. ampicilline 500mg , cap. ampicilline 250mg+ cloxacilline 250mg , cap. amoxycilline (250mg) , cap. amoxycilline (250mg)+cloxacilline 250mg , cap. amoxycilline (500mg) , cap. nifediepin (5mg) , cap. cefalamine (500mg) , cap. cefalamine (250mg) , inj. drotaverin 2 ml , inj. theophyillin + ethophyillin ampl. , inj. metochlopramide ampl 2 ml , inj. tramadol ampl/vail 2ml , inj. l.b artether , inj. cefotaxime with water (500mg) , inj. cefotaxime with water (1gram) , inj. cefotaxime + salbatum with water (1.5gram) , inj. hydro corstisone , inj. pralidoxim , inj. trenexamic acid , inj. ketorolac (1ml) , inj. pantoprazole with water vial (40mg) , inj. pentazocin , inj. citicholine , inj. neostigmine ampl , inj. antitetanus human immunoglobullin , inj. haloperidol , inj. fursemide , inj. dilantin sodium 100mg , inj. labatalol , inj. diclofenac sodium(3ml) , inj. dicyclomine (2ml) , inj. insulin primixed (30/70) , inj. xylocaine 2% (plain) , inj. multiviatmin ampl , inj. chlorpheniramine , inj. tetvac ampl , inj. tetvac vial 10 ml , inj. sodium chloride ampl , inj. sodium bicarbonatne ampl , inj. sensrocain (30ml) vial , inj. ranitidine ampl , inj. b complex amp , inj. promethazina , inj. metoclopramide ampl , inj. oxytocin ampl , inj. ondensetron ampl , inj. methyl erometrine ampl , inj. megnesium sulphate ampl , inj. phenraminemaleate ampl , inj. ketamin (10vial) , inj. ketamin (2ml) ampl , inj. immunoglobin ampl , inj. gentamycine 80mg vail , inj. gentamycine 20mg vail , inj. phenytoin sodium , inj. dopamine ampl , inj. dicyclomine ampl , inj. diclophenac sodium 2ml ampl , inj. fusemide vial , inj. dexamethasone vial , inj. ethamsylate , inj. ceftriaxone inj. 1gram with water vial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone 250mg with water vial , inj. cefoperazone (1gm) with water vial , inj. dizepam2 ml , inj. atropin (ampolue) ampl , inj. ampicillin 500mg vial , inj. ampicillin 250mg vial , inj. amino phylie ampl , inj. amikacin (100mg) , inj. amikacin (500mg) vial , inj. amikacin (250mg) vial , inj. adrenaline ampl , inj. anti sanke venus serum , inj. a.r.v. (anti rabies) single dose , inj. a.r.v. (anti rabies) multi dose , inj. calcium gluconate amp , susp. salbutamol sulphate 100ml , susp. paracetamol 125mg 60ml , susp. ofloxacin + metronidazole 60ml , susp. metronidazole 60ml , susp. iron folic acid 200ml , susp. domperidone (30ml) , susp. cough syrup adult 100ml/110 ml , susp.cough syrupchild/60ml , susp.co trimoxazole 50ml , susp. cetirizine 30ml , susp. cefixime 50mg 30ml , susp. albendazole 10mg 15ml , susp.azithromycin (200mg) 30ml , susp. antacid 100ml , susp. amoxycilline 60ml , susp. levocetrizine 60ml , spirit 100ml , silver salphadazin , neospsrin powder 60mg , scalp vein set (18 nos.) , scalp vein set (22 nos.) , scalp vein set (24 nos.)(all size) , salvon 1lt. , saline set , saline rl (500ml) , saline ns (500ml) , saline dextrose 5% (500ml) , saline dextrose 10% (500ml) , saline d.n.s. (500ml) , oxygen mask adult , urine albumin & sugar test kit , phenyl 5lt. , needle straight , needle curved , mucus sucker , m.c. lotion 400ml , lysol 500ml , lotion. benzyl benzoate (1000ml) , leucoplast with zinc oxide 4 x 5 mt , leucoplast with zinc oxide 4 x 9 mt , leucoplast 3 , leucoplast with zinc oxide 7.5 cm x 5 mt , leucoplast with zinc oxide 7.5 cm x 9 mt , lecopore 3 , lecopore with zinc oxide 7.5cm x 5 mt , lecopore with zinc oxide 7.5cm x 9 mt , leclyete p(100 ml) , leclyete m(100 ml) , iv metronidazole 100ml , iv mannitol (300ml) , iv mannitol (100ml) , iv ciprofloxacine (100ml) , isolyte p(500ml) , intracath 22g , intracath 22g needle, kink resistant tube dia 3.00mm length 1500mm , intracath 22g dial flow regulator with extra big injection moulded drip chamber, fluid filter, y connector, luer lock adapter, 22g needle, kink resistant tube dia 3.00mm length 1500mm , intracath 20g , intracath 20g needle, kink resistant tube dia 3.00mm length 1500mm , intracath 20g dial flow regulator with extra big injection moulded drip chamber, fluid filter, y connector, luer lock adapter, 22g needle, kink resistant tube dia 3.00mm length 1500mm , inestinal catgut 2 0 , instetinal catgut 1 0 , betamathson ditrotionate oint , water for injection , handiplast 100 pcs. per box , gloves 7.5 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , gloves 6 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , examination gloves all sizes , gauge than (18m x 90cm) , absorbent gauze than 18m x 90cm special , absorbent gauze than 18m x 90cm sch f ii delux quality , g.v.paint lotion 400ml (agarwal) , fradiomycin cream 15gm , formalinsolution 500ml , follys catheter 20 two way , follys catheter 18 two way , follys catheter 16 two way , follys catheter 10 two way , ec (700 ml) (agarwal) , disposable syring5ml , disposable syring10ml , disposable syring3ml , disposable syring2ml , disposable syring1ml , dextrose 25% , chromic catgut plain 2 , chromic catgut with needle 1 , cotton thread , cotton roll 400gm nett , absorbent cotton i.p 400gm/roll (net weight) , absorbent cotton i.p 400gm 500 gross , cord clamp , cord clamp with rebban pack , ciprofloxacine eye / ear drop 10ml , cannula (18 12)/jelco , cannula (18 12)/jelco (johson) , butterfly scalp vein set (24 no.) , butterfly scalp vein set (23 no.) all sizes , povidine iodine lotion 500ml , neaomycine powder , neaomycine oint , bandage than (18m x 90cm) , absorbent bandage than 18m x 90cm special , absorbent bandage than 18m x 90cm sch f ii delux quality , b.p. blade no. 20(all sizes) , b.p. blade no. 15 , b.p. blade no. 12 , analgesic cream (30mg tube) , adhesive micropore 2 , adhesive micropore 1/2 , adhesive micropore 1 , bleaching powder 25kg , diclofenac gel 30gm , antifungal skin cream , ors , ors ( pedartic pack) , ord adult 21 24 gm pack , plaster of paris 5kg , plasama volume expendore 500ml , uro bag , uro bag with hanger for adult/child , rhyles tube 16 no. , mersyl 2 0with curved needle , mersyl 2 0 with straight needle , xylocaine jelly 2% , lidfast jelly , salbutamol inhaler , b.t. set , burn patti , crep bandage 6 , crep bandage 4 , budecort respules , asthalin respules , duolinrespules , plaster of paris (50kg)/ jar , inj. compose 2ml , tab. compose , inj. methergin , inj. deriphylin , either 500ml , inj. k nate (phytomenadione) 1ml , spinal needle 25g , 0.5% bupivacain (heavy) , inj. gardinal , inj. artemether , inj. artisunate , inj. i.v. ciprofloxacine , sus ibrufen 60ml , tab. terniafine , oxiconazole cream , terbinafine cream and lotion , moisturing cream/ lotion , kojic acid , hydroxyquinone cream , tertinoin 0.025%/0.04%/0.05% ointment , cap. isotretinoin 10mg/ 20mg , clindamycin gel , mometasone , desonide , tab. prednisolone 5mg/ 10mg/20mg , tab. methotrexate , coal tar + salicylic acid cream and lotion , tab. hydroxychloruquine 200mg , nadofloxacin ointment , sunscreem spf 30/ spf 50 , lancet , gluco meter strip (contour) , glacial acetic acid , r b c diluting fluid , cleansole , urine pot , w b c diluting fluid , tissue paper , tourniquet , n/10 hcl solution , 3.8% sodium citrate solution , lugnlos iodine solution , fouchet reagent , sulphar powder , barium chloride , methleine blue , edta vial , fluoride vial , plain vial , hb% tube , cpr (latex) , abo & rh(anti ab&d) , fluoride powder , blood bag , anithuman globulin serum , anti ab sera , antih , anti a1 (lactin) serum , bovine albumin 22% , vdrl rapid latex , vdrl rapid card , vdrl (syphills) card rapid test , hiv tridot , hiv retroquik , hiv card rapid kit , hiv elisa kit , trapin oil , sanitary napkin , digital x ray 8x10 konica flim , digital x ray 8x10 fusi flim , povodine iodine scrub 10% , povodine iodine scrub 7.5% , desnet 5liter , inj. meropenam 125 mg , inj. dobutamine , sus. montelukast , levipil syrup , inj. midazolam , inj. hemsyl , caffeine oral capnea , inj. caffeine , inj. hydrocort 100mg , thrombophob ointment , xylocain jelly , nasal prongs (neonats) , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , inj. megazid + salbactum , vitamin d drop , inj. levetiracetam 100 mg , multivitamin drop , iron drop , inj. kcl , %% lysole , 3% phenyl , suction tube 6fr , suction tube 8fr , chlohexidine , micropore 1 inch , new born diaper , syringe 50ml , baby cap , baby socks , cannula 26 no , cannula 24 no , paedia set , inj. phenpres ls , inj. termin , inj. levobuapivacaine 0.5%with dextrose 4ml , inj. ropivacine hydrochlioride in dextrose 0.75 % 4ml , inj. phrnylephrine 50 mcg per ml 10 ml vial , pregnancy kit , oxygen mask chlid , fetal doppler , ultrasound jelly/ecg jelly 250ml , tab. intraconazole 100mg , inj. prostaglardin , inj. endpoprost , tab. misoprost 1x4 , nebulizer set , inj. phenobarbitone , susp. levosalbutamol ambroxol , disposable niddle 18fr , disposable niddle 22fr , glucometer strip ozocheck , 3% nacl 100ml , nasal normal saline drop , betadine ointment , t bact ointment , cidexopa solution 5 lit , moxifloxacin eye drop , chloramphenicol eye ointment , permethrin lotion 5% , tacrolimus ointment 0.1% , 1% gaba benzene hexachloride lotion , betamethasone dipropionate neomycine cream , clobetasol fusidic acid cream , soframycin cream , luliconazole cream , itraconazole cream , tab. wysolone 5 mg , inj. prostodin , inj. tranexamic acid , tab . labetalol 100mg , inj. dilona 25mg , inj. glycopyrrolate , inj. noradadrenaline 2mg , inj. ondensatron 4mg , inj. efcorlin 50mg , inj. botropase , botrociot 10ml , inj. propofol , inj. anawin heavy , inj. amawin plain , lignocaine2% with adrenaline , lignocaine 2 % , inj. mephentermine , inj. butodol , inj. nacphin 10mg , xylometazoline nasal drop adult , xylometazoline nasal drop pedia , ofloxacin + dexamethasone ear drops , wax ear drop , gentamicin dexamethasone ear drops , clotrimazole ear drops , inj. netromycin 10mg , inj. netromycin 25mg , mersilk (1no) cutting body , mersilk (1 no)cutting body , mersilk (1 0)cutting body , mersilk (2 0) cutting body , mersilk (8 0)cutting body , endotracheal tube 2.5no , endotracheal tube 3no , endotracheal tube 3.5no , plian ctagut 1 no , plain catgut 3 0 , plain catgut (1 0) , mersilk (3 0) cutting body , mersilk (4 0) cutting body , prolin 0 , prolene (1 no) , prolene (2 0) , prolene (3 0) , plain catgut (2 0) , vicryl 1no 45cm , vicryl 1no 70cm , vicryl 1no 90cm , vicryl 1no 140cm , vicryl (1 0) , vicryl (2 0) , prolene mesh 7.5x10cm , prolene mesh 7.5x5cm , underwater 1c drain for chest tube , malecot catheter different sizes , softratulle mesh , paraffin mesh , phenylephrine , thiopentone , inj. lignocaine adrenaline , inj. xylocard 2% , tab epipress , inj. nitroglycerin , inj.adenosine , inj.morphine , inj.diltiazem , inj.pyronate , inj.enoxaparin (l.m.w.h) , ambu bag adult , epidural catheter , suction catheter , magills forceps large , magills forceps small , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , trece ostomy tube set , airway 01234 , lam/i gel 01234 , stylet , inj. iron surcose , inj. meropenam 250mg , inj. meropenam 1g , inj. moxifloxacin , ecg roll 3 channel , ecg roll 6 channel , ecg roll 12 channel , centraline 7.15 fr , centraline 4.5 fr , centraline 7 fr , dialysis line adult , nibulizer , nibulizer mask adult , nibulizer mask child , tab iron & folic acid large , tab. rebeprazole + domperidome , pcm + diclophenic + serrisopeprtidaze , pcm + acyclofenic + serrisopeprtidaze , glimepridie & metfformin hydrochloride (er) , glipizide & metfformin hydrochloride 5/500mg , tab. glipizide 5mg , tab.glipizide 500mg , tab.linezolid 300mg , tab.linezolid 600mg , tab.torsemide 10 , tab.warfarin 10 , tab.warfarin 5 , tab.warfarin 1 , tab.warfarin 2 , tab.carvedilol 3.125 , tab.carvedilol 6.25 , betahistine 16mg , inj. pipracilline + tazobactum 4.5 gm , inj. meropenum 1g , inj. methylcobalamin 500mg , inj. methylcobalamin100mg , inj. mvi , inj. methylcobalamin , tab.methylcobalamin od , tab. deferasirox dispersible 500mg (desirox) , tab. deferasirox dispersible 250mg (desirox) , tab. iron & folic acid large , ipratropium bromide & levosalbetamol , budesomide , inj. levofloxacin 100mg , inj. paracetamol 100mg , inj. recombinant anti rho d immunoglobulin (anti d) , lantus insulin , tab. calcium carbonate 500mg , diapper , insulin regular vial , insulin mixtard vial , inj.nahco3 25ml (sodium bi carbonate) , tab. ecosprin 75mg , tab. metoprolo 25mg , tab. metoprolo 50mg , tab. atorvastatin40mg , tab. rampiril 25mg , tab. rampiril 50mg , inj. kcl 100mg , inj. nacl 3% 100mg , dynaplast , inj. arv single dose vial , inj .arv multi dose vial , inj. asvs , inj. h. albumin 20% , zinconia syrup , inj. l ornithine , inj. iron sucrose , injcholcifefurol , tab.aceclofenec + pcm+ serisopeptize , silver nitrate gel , megaheal ointment , s liv syrup , abdominal belt (s, m, l,xl ,xxl) , multivitamin tab , tab metoprolol extended , tab. torsemide + spironolactone , tab. prefabalin & nortriptyline hydrochlordie , betadin 10% , betadin scrub 7.5% , ramovac 16 no. , ramo adk 28 , ramo adk 32 , ramo adk 24 , cotri plate , cotri pencil , cotri machine , hemodialysis catheter double lumen , tab tenovir disoproxil fumarate 300mg , 3 way cannula , inj. levetiracetam , pedia drip (measured volume iv set) , l.p. needle 20 no. , tab panteprazole + domperidom , bupivacaine hydrochloride inj. (amawin) , hyaluroridage inj. 1500 iv (hynedage) , hypromrllose opthalmic solution usp(hyprosol) , adrenaline acid tartrate inj. (epitrate) , pilocaprine nitrate inj. (carpinol) , proparacaine hcl eyedrop (paracain) , moxifloxacin eyedrop , bromofanac eyedrop , tropicamide and phenylephrine eyedrop , moxifloxacin plus prednisolone eyedrop , trypan blue solution 0.06% (auroblue) , tab acetazolamide 250 (dimox 250) , tab pheniramine maleate 25mg (avil 25mg) , isopropye alcohol solution (surgical sprit) , non absorbable surgical suture 10 0 , micropore 1 , needle 26 g , black goggles , side port (disposal) blade , kereatome 2.8mm blade (disposable) , crescent blade (disposable) , b.p blade (all size) , sodium chloride opthalmic aolution 5% eyedrop (hypersol 5) , sodium chlorode oint (hypersol 6) , lens +18.00,+19.00,+ 20.00, +21.00, +22.00, 23.00, +24.00, +25.00, +26.00, +27.00 , inj. sucol , glycopyrolate amp. , atropin sulphate amp. , pantazocine amp. , ketamin amp. , dizepam amp. , thiopentone sodium vial 1/2gm 1gm , isoflurane bot 100ml , dexedetomidine hcl vial 50 micro gr. , medazolam vial , ondansetron amp. , tramadol amp. , diclofenec sodium amp. , lignocaine vail 2% 30ml , bupivacain 5% 4ml , ropivacain amp. 75% 20ml , lignocaine 2% with adrenaline , bupivacain 5% 20ml , vecronium bromide amp. , succinylcholine chloride vial , recuronium bromide vial , nestogime + gycopyrolate amp. , noradranilne amp. , adrenaline amp. , mephenterimine vial , magnesium sulphate amp. , nitroglycerine amp. , promethazine amp. 2ml , dexamethasone vial , hydrocortisone succinate vial , fursemide amp. , chlorphenaramin meleatr amp. , esmolol amp. , dopamine hydrochloride amp. , fentanyl inj. , sufentanyl inj. , xylocaine 5% heavy amp. , ligoncaine heavy amp. 5% 2ml , ligoncaine jelly tibe 2% , paracetamol inj. amp. , prochloreperazine amp. , promethazine amp. , chloropromazine amp. , deriphyllin amp. , epidural set withepidural catheter , halothanb.p. , butorphanol tartrate amp. , succinyl choline chloride vial (inlipolised powder form) , phenylepherine amp. , epinephrine amp. , xylocaine spray 5% , 10% , 6% hydroxy ethyl starch sol.bot. , 3% hydroxy ethyl strach sol.bot. , azithromycin 250mg , azithromycin 500mg , amoxycillin 500mg + clavulanic acid 125mg , livocitrizine 5mg , livocitrizine 5mg +10mg , chplecalciferol 60000 iu , aceclofenac 100mg +paracetamol 325mg , ofloxacin 200mg + ornidazole 500mg , ofloxacin 200mg , cefuroxime 500mg + clavulanic 125mg , 20% gealin infusion bot. , 3% 100ml nacl sodium chloride soln. bot. , verapamil 5ml amp. , orcyprenaline 10gm tab , flumezenil 2ml amp. , naloxone hydrochloride amp. , terbutaline amp. nebuliser , nitroglycrine sublingual tab , nitroglycrine sublingual spray , torsamide 2ml amp. , propofol vial , 1% & 2% , atracurium besylate amp. , budacort , endotracheal tube 6,6.5, 7,7.5,8,8.5 , nitroglycrine amp. 5cc , acetylcystine amp. , betaloc (metaprolol) , lenoxin tab. / amp. , methyl predinisolone inj. , bain circiut (paediatrics) , endotracheal tube 0.2,5,3,3.5,4,5.5 , laryngoscope adult , air way no. 3,4 paediatric size , spinal needle (all size) , tab telmisartan 40 , cholecalciferol schet , ursodeoxycholic 300 mg , tab itraconazole 200 mg , tab fluoxetine 20 mg , tab trihexphenidyl 2 mg , tab lorzaepam 2 mg , tabsodium valproate 300 mg , tab sodium valproate 500 mg , tab olanzapine 10 mg , multiple elec. and dextrose (p) 500 ml , multiple elec. and dextrose (m) 500 ml , dextrose 5% 50 ml , sodium chloride 500 ml , metronidazole 100 ml iv , ciprofloxacin inj. ip 100 ml , infusion set , 3.5 colloidal infusion 500 ml , surgical paper tape 2.50 cm x 9.1 cm , surgical paper tape 5.00 cm x 9.1 cm , ceftriaxone 1gm inj. , ceftriaxone 1gm + sulbactum 500 mg inj. , ceftriaxone 1gm + tezobactum 125 mg inj. , ceftazidime 1gm , cefuroxime sodium 1.5 gm , methylcobalamin + pyridoxine hcl + nicotinamide inj. , nandrolone decanoate 50 mg inj. , iron sucrose inj. , dexamethasone 30 ml inj. , gentamicin 10 ml inj. , crystaline amino acid 200 ml , blood administration set (bt set) , urin bag , cannula fixator bandage , vasopressor , inj. isoprenaline , inj. vasopressin , inj. milirenole , inj. adenosime , iv paracetamol (100 ml. bottle) , inj. ketamine 50mg/ml , inj. termine 30mg/ml (mephentermine sulphate) , inj. anawin heavy (bupivacaine hydrochloride in dextrose inj. ) , tab. olanzapine 5 mg , tab. olanzapine 10 mg , tab. risperidone 2 mg , tab. risperidone 3 mg , tab. trihexyphenidyl 2 mg , tab. clonazepam 0.5 mg , tab. lithium carbonate 300 mg , tab. sodium valporate 500 mg , tab. amitryptyline 25 mg , tab. sertraline 100 mg , tab. clobazam 5 mg , tab. clobazam 10 mg , inj. serenace (haloperidol) 5 mg , inj. lorazepam 4 mg , inj. promethazine 50 mg , tab. sodium valporate 300 mg , tab. carbamazepine 200 mg , cap. fluoxetine 20 , tab. lorazepam 2 mg , inj. thiamine 100 mg , sodium valporate syurp , inj. dopamine , soluble asprin 325 mg , enteric coated asprin 75 mg , t.clopidogrel 75 mg , t.isosorbide dinitrate 65mg/10mg , t.isosoribde mononitrate 10mg , t.isosorbide mononitrate 20mg , t.metoprolol 25mg , t.rampiril 2.5mg , inj. frusmide , t.aldactone 25mg , t.atorvastatin 40mg , inj. lignocaine , inj. amidarone , t.amiodarone 200mg , inj.pheniramine meleate , inj. hydrocortisone , inj. pantoprazole , inj. streptokinase 1500000iu , inj. adrenaline , inj. nor adrenaline , inj. amiodarone , inj. tenecteplast , inj. reteplase , inj.morphine , tab. atorvastatine (40) , tab. ecosprin (75 ) , tab. clopidogril (75) , tab. cardac 12.5 , inj. elaxim (tenectoplase) , inj. nahco3 , 50 cc syringe , p.m.o line , inj. dobutamine , abg machine , inj. adenosine , inj. amidarone , central line , endotracheal tube 6 no. , endotracheal tube 6.5 no. , air way adult size 6 , air way adult size 6.5 , air way adult size 3 , air way adult size 4 , suction tube 14 , suction tube 16 , suction tube 18 , sodium bicarbonate 25 ml , inj. meropenum 1gm , inj. netromax 10 mg , inj. cefotaxime 125 mg , inj. midazolam , inj. amplicillin 100 mg , inj. vancomycin 100 mg , inj. pipracillin + tazobactum 4.5gm , inj. capnea , ivf. isolet p , inj. d5% , inj. heparin , formalin vaporize (5lit) , vit d3 drop , syp. levipil , hmf sachet , drop capnea , inj. gardenal , syp. gardenal , syringe pump , washable slipper , room thermameter , weight machine (baby) , oxygen nasal prongs , dispo syringe 1 ml , dispo syringe 3 ml , dispo syringe 5 ml , dispo syringe 10 ml , dispo syringe 20 ml , dispo syringe 50 ml , ett 2.5, 3, 3.5 , cannula 26 fr , cannula 24 fr , sprit 5 liter , leucoplast 1 , leucoplast 2 , micropor 1 , hand wash , hand sanitizer , pmo line , losse gloves , pedia set , formoline (5lit ) , sterlization indicator tst control spot , baby diapper , disposable cap , disposable mask , dispo niddle 18 fr three way connector , baby blanket , dispo needle 22 fr , betadin solution , suction tube 10 fr , suction tube 12 fr , glucometer strip , d.w respule , neonate b.p cuff , gelonet , lignocane gel , muprocin ointment , inj. enoxaparin 0.6 mg , inj. terectepluse 30 mg , inj. erythropoetin , inj. iron ferron fumarate amp. , central venom cannula for dialysis , inj. tobramycin , nebulizer solution respules salbutamol , nebulizer solution respules budetcrol. , adult b.p cuff , tab. vitamin c 500 mg , tab. vitamin d 60 k , inj. remdesivir , tocillizumab , amphotericin b deoxycho latf , posaconazole , tab. ivermctin 12 mg , for cbc (complete blood count) machine , diluent 20l for (ad3200 plus) , lyse 500ml for (ad3200 plus) , probe cleaner for (ad3200 plus) , k3 edta single cap tube , fluoride single cap tube , plane clot activator single cap tube , k3 edta double cap tube , fluoride double cap tube , plane clot activator double cap tube , forbiochemistry semi auto analyser , amylase , lipase , alkaline phosphatase , alt( gpt) , ast (got) , bilirubin total , bilirubin direct , calcium , creatinine , creatine kinase nac , cretine kinase mb , total cholesterol , ldl cholesterol , hdl cholesterol , chloride , triglyceride , g glutamyl transferase , glucose , lacathedehydrogenase (ldh) , magnesium , phosphorus , microprotein reagents , uric acid , urea , micro albumin , crp. latex , crp (turbidometric) , albumin , total protein , d dimer , ferritin , bionorm quality control , biopath quality control , bio cal calibrator , for fully automatic biochemistry analyser. (merilyzer autoquant 200 excelus) , amylase , lipase , alkaline phosphatse , alt (gpt) , ast (got) , bilirubin total , bilirubin direct , total protein , albumin , creatinine , urea , uric acid , total cholesterol , ldl cholesterol(direct) , hdl cholesterol (direct) , triglyceride , g glutamyl transferase , glucose , lacatedehydrogenase (ldh) , creatine kinase nac , cretine kinase mb , d dimer , ferritin , bionorm quality control , biopath quality control , bio cal calibrator , bio cal calibrator , other reagents required , t3 , t4 , tsh , double cap edta vial (liqiud) , double cap plain clot actvator , double cap fluoride vial , r a latex , aso latex , hbsag kit , capillary tube , filter paper , d/ water , bendicts solution , test tube (6) , e s r stand (6group) westergrens mehtod , westergrens tube , haemometer (haemocytometer) set (top up) , hb% pipette , leishmans stain (500 ml) , widal kit (span) , lancet , blood group & rh typing (each) , glacial acetic acid (500ml) , cover glass , hypchloride (5 litres) , vdrl (strip) , micro pipette (10 100 ul) , micro pipette (100 1000 ul) , micro pipette (10 100 ul tips) , micro pipette (100 1000 ul tips) , crp latex , sprit (99.9%) (01jar = 5 litres) , cleansole , urine pot , tourniquet , n/10 hcl solution (each 500ml) , 3.8% sodium citrate solution (each 500ml) , lugols iodine solution , fouchet reagent , earlichs aldehyde reagent , sulphar powder , braium chloride (each 500ml) , metheline blue (each 500ml) , edta vial , flouride vial , plain vial , hb% tube (top up) , rbc diluting fluid (each 500ml) , wbc diluting fluid (each 500ml) , platelats diluting fluid (each 500ml) , semen diluting fluid (each 500ml) , disposable syringe with needle 5ml , urine strips ( two parameter ) , for hb% (cyna.) drabkin solution , test tube rack , westergren pipette , sodium / calcium hydrochloride 500ml , fluroide powder 25gm , edta powder 25gm , antihuman globulin serum , anti ab sera 10 ml , anti h 5ml , anti a1 (lactin) serum 5ml , bovin albumin 22% 10ml , vdrl rapid latex , m.p pf/pv card antibody , maleria pf/ pv antibody , hiv tridot , hiv reteroquik , tarpin oil , trop. t , r.a test , k3 edta single cap tube , fluoride single cap tube , plain clot activator single cap tube , k3 edta double cap tube , fluoride double cap tube , plain clot activator double cap tube...

Health Department - Jharkhand

37890680 rate contract for medicine at sadar hospital deoghar , items : , tab. albendazole (400 mg) 10x10 , tab. anti cold 10x10 , tab amlodipine (5mg) 10x10 , tab. atenolol (50mg) 10x10 , tab. avil (chalpheniramin( 25 mg) 10x10 , tab. azithromycine250 mg 10x10 , tab. azithromycine 500mg 10x10 , tab cefadroxyl 250mg 10x10 , tab cefadroxyl 500mg 10x10 , tab. calcium d3 500mg. 10×10 , tab. cefixime (50 mg) 10×10 , tab. cefixime (100mg) 10x10 , tab. cefixime (200mg) 10x10 , tab. cetrizine 10mg. 10x10 , tab. cipro 500mg + tz 600mg 10x10 , tab. ciprofloxacine (500 mg) 10x10 , tab. ciproifloxacine (250mg) 10x10 , tab. co trimoxazole ds 10x10 , tab. co trimoxazole ss 10x10 , tab. dicolofenae sodium (50mg) 10x10 , tab. dicolofenc + paracetamol 10x10 , tab. dicyclomine10x10 , tab. dicyclomine + paracetamol 10x10 , tab. domperidon (10mg) 10x10 , tab. famotidine(40 mg) 10x10 , tab. famotidine 20 mg. 10x10 , tab. fluconazole 150 mg. 10x10 , tab. folic acid large10x10 , tab. ibuprofen 400mg + paracetamole 325mg10x10 , tab. levofloxacine 250mg 10x10 , tab. levofloxacin (500mg) 10x10 , tab. katrolac ( 50 mg) 10×10 , tab. diazepam (2 mg) 10 ×10 , tab. diazepam (5 mg) 10 ×10 , tab. chromostat10 ×10 , tab. lasix10 ×10 , tab. lanoxin 10 ×10 , tab. metformin(500 mg) sr 10×10 , tab. glimepride ( 2 mg) 10 ×10 , tab. voglibosevo (0.2mg) 10 ×10 , tab. stemetil10×10 , tab. p.c.m.d.t.( 250 mg) 10×10 , tab. paracetamol (500mg) 10x10 , tab. antacid 10 ×10 , tab. dilantin sodium ( 100 mg) 10 ×10 , tab. drotaverime ( 40 mg) 10×10 , tab. anaspas 10 ×10 , tab. nitrocontin (2.6 mg) 10 ×10 , tab. sorbitrate ( 5 mg) 10 ×10 , tab. ecospirin (75 mg) 10 ×10 , tab. ecospirin (100 mg) 10 ×10 , tab. telmisarten ( 20 mg) 10 ×10 , tab. telmisarten ( 40 mg) 10 ×10 , tab. aceclofenac (100 mg) 10 ×10 , tab. ondansetron ( 8 mg) 10 ×10 , tab. ondansetron ( 4 mg) 10 ×10 , tab. chloroquine 10 ×10 , tab. zinc sulphate ( 20 mg)10 ×10 , tab. metoclopramide 10mg 10x10 , tab. metronidazole (200mg) 10x10 , tab. metronidazole (400mg) 10x10 , tab. nefedipine 20 mg 10x10 , tab. norfloxacin 400 mg+ tinidazole 600 mg 10x10 , tab. ofloxacin100mg.10x10 , tab. ofloxacin 200mg 10x10 , tab. ofloxacin200mg + ornidazole (500mg) 10x10 , tab. pantoprazole 40mg 10x10 , tab. ranitidine (150mg) 10x10 , tab. roxythromycine 150mg 10x10 , tab. roxythromycine 300mg 10x10 , tab. salbutamol 4mg 10x10 , tab. tranaxaemic acid + mefenamic acid 10x10 , tab. vitamin b complex 10x10 , tab. levocetirizine 5 mg+montelukast 10 mg.10x10 , tab.vitamin c 10x10 , tab.vitamin d 10x10 , tab.amoxycilline + clavulanic acid(625 mg) 10×10 , tab.amoxycilline + clavulanic acid(325 mg) 10×10 , tab.ascorbic acid10×10 , tab. levocetrizine 5mg 10×10 , tab. erythromoycin250 mg 10×10 , tab. cefpoboxime proxetil50 mg. 10×10 , tab. cefpoboxime proxetil100 mg. 10×10 , tab. cefpoboxime proxetil200 mg. 10×10 , tab. cefuroxime axetil 10×10 , cap. omeprazole (20mg) 10x10 , cap. omeprazole (10mg) 10x10 , cap. doxycycline (100 mg) 10x10 , cap. cefalexine (500mg) 10x10 , cap. ampicilline 500mg 10x10 , cap. ampicilline 250 + cloxacilline 250 10x10 , cap. amoxycilline (250mg) 10x10 , cap. amoxycilline (250 mg) cloxacilline (250mg) 10x10 , cap. amoxycilline (500mg)10×10 , cap. depin (5 mg)10×10 , cap. cefalamine (500 mg)10×10 , cap. cefalamine (250 mg)10×10 , inj.amikacine (100mg)vial , inj. amikacin (250mg) vial , inj. amikacin (500mg) vial , inj. theophyillin + ethophyillin2ml ampl , inj. perinorm 5mg, 2ml ampl , inj. tramadol 50mg, 2ml ampl , inj. arteether 150mg ,2ml ampl , inj. cefotaxime with water(500 mg)vial , inj. cefotaxime with water(1 gram)vial , inj. ceftriaxone 250mg with watervial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone inj 1gram with watervial , inj. ceftriaxone+ salbatum with water (1.5 gram) , inj. drotaverin40mg ,2ml ampl , inj. h coart/ prima coart 100mlvail , inj. pam ampl 500 mg, 25 ml , inj. trenexa ampl 500 mg, 5ml , inj. ketorolac 30mg, 1 ml, vail , inj. pantoprazole with water40 mg ,vial , inj. fortwin ampl 30mg, 1 ml, ampl. , inj. stemetil ampl 12.5mg, 1 ml ampl. , inj. citycolin ampl 500 mg, 2ml ampl , inj. neostigmine 2.5 mg, 5ml ampl , inj. antirabies human illnvoglabin vail , inj. antitetanus human illnvoglabin , inj. halopendol ampl , inj. lasix 20 mg ml ampl , inj. dilantin sodium100 mg 2 ml ampl , inj. labatalol 20 mg4 ml ampl , inj. diclofenac aqua 75 mg (1 ml) , inj. anaspas 2 ml ampl , inj. insulin primixed (30/70) 3ml ampl. , inj. xylocaine 2% (plain) 30 mlvail , inj. multivitamin 2 ml ampl , inj. avil 22.75 mg 2ml ampl , inj. tetvac 0.5ml ampl. , inj. tetvac 10ml vial , inj. tetanus toxide 1mg 10 ml vial , inj. sodium chloride 100ml iv , inj. sodium bicarbonate 25ml ampl , inj. sensorcaine (30 ml) vial , inj. ranitidine 50mg 2ml ampl , inj. b complex 2ml amp , inj. botroclot 1mlamp , inj. pipracillin(piperacillin 4000mg + tazobactam 500mg) 4.5 gm. vial. , inj. pipracillin+ tazobactum 1.125 mg. vial. , inj. meropenam 1.125 mg. vial , inj. kanadian. 0.5 mg. ampl , inj. anawin heavy 4mlampl. , inj. adenosine 3mg. 2ml vial , inj. antidine 2ml ampl , inj. phenargan 25mg 2ml ampl , inj. metochlopramide 2ml ampl , inj. oxytocin 1mlampl , inj. ondensetron 2ml ampl , inj. methyl ergometrine 0.5 mg 1 ml ampl , inj. megnesium sulphate 5mlampl , inj.pheniramine 2ml ampl , inj. phenytion sodium 50mg 2 ml ampl. , inj. ketamin inj. (10ml vail) , inj. ketamin (2ml) ampl , inj. carboprost 1ml ampl , inj. propofol 10 ml vial , inj. promethazine 2 ml ampl. , inj. dobustat 250 mg vial , inj. labetalol 20 mg. 4ml vail , inj. immunoglobin 10 mg, 100 ml iv , inj. gentamycine 80 mg.2ml vial , inj. gentamycine 20 mg.2ml vial , inj. epsolin 2ml ampl , inj. dopamine 200mg 5ml ampl , inj. dicyclomine20mg 2ml ampl , inj. diclophenac sodium 2ml ampl , inj fusemide 20 mg 2ml , inj. dexamethasone2 ml ampl , inj. chromostat 1 mg 2 ml amp , inj. cefoperazone (1 gm.) with watervial , inj. dizepam 50 mg 10 ml vail , inj. atropin 0.6mg 1ml ampl , inj. ampicillin500mg vial , inj. ampicilin 250mg vial , inj. amino phylline 250 mg 10 ml vail , inj. adrenaline 1 ml ampl , inj anti snake venus serum 10ml vail , inj a.r.v. (anti rabies) single dose 1ml ampl , inj a.r.v. (anti rabies) multi dose , inj calcium gluconate amp 100mg 10ml ampl , injclindamycine 600 mg. 4ml ampl , inj. narabre naline 4mg 2 ml amp , inj. heparine 5000 iu 5 ml vial , inj. pentazocine lactate 1ml amp , inj. neostigmine methyle sulphate. 2.5mg. 5 ml ampl , iv saline rl (500ml) , iv saline n.s. (500ml) , iv saline dextrose 5%(500ml) , iv saline dextrose 10%(500ml) , iv saline d.n.s. (500ml) , iv metronidazole 100ml , iv mannitol (300ml) , iv mannitol (100ml) , iv ciprofloxacine(100ml) , iv plasma volume expendore 500 ml , dextrose 25% 100 ml , ors each , susp. salbutamol sulphate 100ml , susp. paracetamol 125mg 60ml , susp. ofloxacin + ornidazole 30 ml , susp. metronidazole 30ml , susp. metronidazole+ ofloxacin 30ml , sup. iron folic acid 200ml , susp. domperidone (30ml) , susp. cough syrup adult100ml bottle , susp. cough syrup child60 ml bottle , susp. co trimoxazole 50ml , susp. cetrizine 30ml , susp. cefixime 50mg 30ml , susp. albendazole 10mg 15ml , susp. azithromycin (200 mg ) 30 ml , susp. antacid 100 ml , susp. amoxycilline 60ml , susp. levocetrizine 60ml , salbutamol inhaler each , ciprofloxacine eye / ear drop 10ml , m.c. lotion400ml , lysol 500ml , lotion. benzyl benzoate (1000ml) , formalin solution 500ml , ec (agrawal)400 ml , g.v. paint lotion 400ml , lindone & cetrimide lotion 100 ml , spirit 01 ltrs , spirit 100 ml , antifungal skin cream 20gm , diclofenacgel 30 gm (diclofenac 1.0 % +linseed oil 3.0%+bezyle alochol 1.0%+menthol 5.0%+methyl salicylate 10.0%) , analgesic cream(30 mg tube) , neaomycine oint.15 gm. , fradiomycin cream 15 gm , betamathson ditrotionate oint. 15 gm , silverex ointmet (burning) (20 gram) , silverex ointmet (burning) (500 gram) , neospsrin powder 10 gm. , stritching thread , savlon 1 liter. , saline set , prolene 1 0 (100 pc) , prolene 1(100 pc) , phenyl 5 ltrs , needle straight (100 pc) , needle curved (100 pc) , mucus sucker 100 pcs , leucoplast 4(100 pc) , leucoplast 3(100 pc) , lecopore 3(100 pc) , leclyete p(100ml) , leclyete m(100 ml) , isolyte p(500ml) , intestinal catgut 2 0(100 pc) , intestinal catgut 2(100 pc) , intestinal catgut 1 0(100 pc) , intestinal catgut 1(100 pc) , water for injection , handiplast 100 pcs. per box , gloves 7.5 surgical pair , gloves 7 surgica pair , gloves 6.5 surgical pair , gloves 6 surgical pair , gauge than (18m x 90cm) , folly’s catheter 20 two way 100pc , folly’s catheter 18 two way 100pc , folye’s catheter 16 two way 100pc , folly’s catheter 10 two way 100pc , disposable syring 0.5 ml 100pc , disposable syring 1 ml 100pc , disposable syring 2ml 100pc , disposable syring 3ml 100pc , disposable syring 5ml 100pc , disposable syring 10ml 100pc , disposable syring 20 ml 100pc , disposable syring 50ml 100pc , insuline syring 1 ml. 100 pcs. , chromic catgut plain 2 100pc , chromic catgut plain 2 0 100pc , chromic catgut with needle 1 0 100pc , chromic catgut with needle 1 100pc , cotton thread 100pc , cotton roll 400gm nett , cord clamp 100pc , butter fly scalp vein set (24 no.) 100pc , butter fly scalp vein set (23no.) 100pc , povidine iodine lotion 500ml , neaomycinepowder 10gm , bandage than (18m x 90cm) , b.p. blade no. 22 (100pc) , b.p. blade no. 15 (100pc) , b.p. blade no. 11 (100pc) , adhesive micropore 2 100pc , adhesive micropore 1/2100pc , adhesive micropore 1100pc , bleaching powder 25kg bag , plaster of paris 5kg. bag , uro bag pic. , ryles tube 6 no. , ryles tube10 no. , ryles tube 12 no. , ryles tube14 no. , ryles tube16 no. , mersyl 2 0 withcurvedneedle 100 pcs. , mersyl 2 0 withstraight needle 100 pcs. , xylocaine jelly2% 30 gm , lidfast jelly30gm , b.t. set100 pcs. , burn patti100 pcs. , crep bandage 4100 pcs. , budecort0.5mg 2ml packet , duolin100 pcs. , catgut no. 1 with needle100 pcs. , catgut no. 2 with needle100 pcs. , vicryl no. 1 90 cm.round body 100 pcs. , vicryl no. 1 180 cm.100 pcs. , pop roll100 pcs. , dispo mask 100 pcs. , dispo cap 100 pcs. , cidex 5lt. jar. , leucopore 0.5 100 pcs. , gluco one kit (sugar test strip) , mersilk no. 1 cutting(100 pcs.) , mersilk no. 2(100 pcs.) , mersilk no. 3(100 pcs.) , silk thread (100 pcs.) , vain flam no. 18 (100 pcs.) , vain flam no. 20 (100 pcs.) , vain flam no. 22 (100 pcs.) , vain flamno. 24 (100 pcs.) , spinal needle 100 pcs , sanitary pad (cotton) (100 pcs.) , triple layer surgical mask , n 95 mask , hand sanitzer 100 ml , hand sanitzer 500 ml , hand sanitzer 1 liter. , oxygen mask adult per pic , oxygen mask childpic , ppe kit per pic , hydrogen peroxide solution 100 ml , disposel head cap. 100 pcs , diaper (born baby) 10 pics pack. , first aid kit. (100 pcs.) (pcm 500 mg. 10 tab., ors 5 pac., tab. norfloxacin 400 mg+ tinidazole 600 mg. 10 tab., bandage 1 roll, cotton 1 roll, betadine onintment 1tube, handiplast 5 pic, cipro. 500 mg. 10 tab., domperidom 10 mg. 10 tab., dicyclomine 10 tab. diclofenac 50 mg 10 tab., savlone 50 ml.)...

Health Department - Jharkhand

37890677 rate contract for instruments at sadar hospital deoghar , items : , baby warmer machine , stainless steel abdominal hysterectomy set , n.s.v set(s.s) , g.v set , self abdominal detractor , m.t.p set. , vaccine carrier (small size) , x ray digitalisation with high end cr system (with installation & 1 yers. warrenty) console software with mulitmodality work station the cr system should have advances workstation provided with 17 high resolution monitor, keyboard & ouse, with the fol. , digital ultrasound machine colour dopler(high resolution ) with 4 probe , eye checkup machine , auto analyzer , hotair oven , binocular microscope , centri fuge machin , micropipette (0 50 microliter) , micropipette (0 500 microliter) , micropipette (0 1000 microliter) , microtips(0 50 microliter) , microtips(0 1000 microliter) , bed side screen with cloth1round pipe with wheel , sponge holding 8 , sponge holding 6 , artery forceps 6 curved , artery forceps 6straight. , artery forceps 8 curved , artery forceps 8straight. , artery forceps 4straight. , alliys tissue forcep 8 , mosquito forcep 6 , scissor 6 curved , scissor 6 straight , scissor mosquito straight. 5 straight , diatheromy (machine) , laparoscopic instrument , needle holder 8 curved , needle holder 8 straight , needle holder 6 curved , needle holder 6 straight , needle holder 4 curved , needle holder 4 straight , doner couch (3 motor) , blood weighting mechine , digital bp mechine , blood band refrigerator (300 bag) temp.display outside , elisa mechne e printer. , blood collection monitor (with battery backup) , boyls appratus , gas pipe line n2o , gas pipe line o2 , electral dental chair 1.should be electricly operated with zero programme. 2. should have a switch operated operating light with minimum 2 steps of intensity control. 3. should have a auto water connection for spitoon, and tumbler with auto filling senssor. , detal forcep set , detal cortraie machine , infusion pam machine , bed side trolly table , patient table , ecg machine 12 leading , dressing table with instrument , alice tooth forcep , alice plane forcep , plane forcep , sponge holding forcep , b.p blade. , artery forcep curved , artery forcep plane , stitch cutting night. , scissor curved , scissor plane , multiparamoniter , table sterilazation machine , pulse oximeter (table top) bulit in rechargeable li polymer battery for uniterrupted monitorig compact and flexible appearance, easy and be suitable fo indoor and outdoor(in ambulnce monitoringwith user friendly interface disply , syringe pump , foetal doppler , refrigerater 290 ltr. , blood warmer machine , airpurifier , allis tissue , artery forcep (long) , tooth forcep , needle holder , sponge holder , bp handle , scissor straight , allies tissue forceps 6 (tungston carbide coated) german. , ambu bag (adult) , ambu bag (baby) , artery forceps 4 curved (tungston carbide coated) german. , artery forceps 5 curved (tungston carbide coated) german. , artery forceps 7 curved (tungston carbide coated) german. , artery forceps curve 140 mm 180 mm(german) , artery forceps straight 140 mm 180 mm(german) , auto reflectometer with table , doyens retractor , b.p. holder , bad pan plastic , bauel 10 , bed side locker , bed side screen with curtain. , boils appratus with gas clinder , boul stand. , bowl, metal, sponge, 600 ml. , bp instrument (diamond) , bp instrument dial , bp instrument digital , bp instrument stand(diamond) , cardiac monitor , cord cutting scissor(tungston carbide coated) german. , curved cutting needle (tungston carbide coated) german. , diathermy , dilator utrenne double , dressing table , dressing tray with cover 310* 200* 600 mm ss , drug trolley , drum , steritizing cylindrical 275 mm dies 132 mm (dressing drum) , drum stand clinical , g.v set , electricauto clave big3 drums , electric auto clave medium 1 drum , electric auto clave medium 2 drums , electric hub cutter big , electric instrument strlizer , electric needle cutter , electric sterlizationbig , electric sterlization medium , electric sterlization small , episiotomy or curved scissor , episiotomy scissors 6 (tungston carbide coated) german. , episiotomy scissors 8 (tungston carbide coated) german. , examination table , femaly planning operation scissor set. 01 set. , feotoscope , flower bed 18 mm steel. , foammattress for labour table , food trolly big wheel , foot step , forceps hemostatic, halsteads mosquito strcight, 125mm ss (german) , forceps obstetiric, wrigleys 280 mm, stainless stand (german) , forceps uterine neleton solid tip one eye (german) , forceps vulselium dubty borble carved 280 mm ss (german) , forceps, spongs holding, 228 mm(german) , froceps, bucplaus towel, 130 mm(german) , glucometer , hospital bed 18 mm steel. , hospital bed with adjustable back rest 18 mm steel. , hub cutter big , hub cutter small , hydraulic ottable , hydrocele operation scissor set 01 set. , hysterectomy operationset 01 set. , self abdominal detectorset , auto clave (big. verticle) , eye checkup machine , cbc machine (5 part blood cell counter machine) 1. should have throughput 50 samples/hour 2.system should use cation exchange hplc principle for estimation of stable a1c. 3. system should have built in computer with the system software and must be able to work independent of exte. , m.t.p set. , i.v. stand , ilr medium with stabilizer , infusion pump , ingramometermeasures , kidney tray (big) , kidney tray (medium) , kidney tray (small) , knife blade surgicalsize 11, 15 for minor surgery , knife blade surgicalsize 22 no.for major surgery . , knife handel surgical for minor & major surgery 3 & 4(german) , labour table , larengoscop adult , larengoscop child , ledo.t light single dome dia 22 no. led 48, linght intensity 100000 lux, +10%, cri>90, colour temperature>4300k, life of led minimum 50000 working hours. , no of dome heads 4, fully laminar flow compatible disigned dome. , lifter , matress for examination table , mattress for bed , mayos scissors 5 curved(tungston carbide coated) german. , mayos scissors 5 straight (tungston carbide coated) german. , mayos scissors 7 curved (tungston carbide coated) german.. , mayos scissors 7 straight (tungston carbide coated) german. , mosquito artery forceps curved (tungston carbide coated) german. , mosquito artery forceps straight (tungston carbide coated) german. , multi para monitor , nebuliser , needle holder , needle holder big (tungston carbide coated) german. , needle holder mayo strainght, nagrouthaw, 175 mm ss (german) , needle holder small (tungston carbide coated) german. , needle suture round body 3/8 circle no. 12 , needle suture triangular point size 7.3 , o.t light mutible double dome72 led, 130000 lux, central focusing focus point 15cm, penentrapion depth 8 10 intensity controlar. , oxygen concentrator , oxygen cylinder regulator , oxygen cylinder , oxygen trolley , oxygen key , oxygen maskadult , oxygen mask child , plain forceps 7 (tungston carbide coated) german. , pump sunction , radient warmer , revolving sitting stool , round body needle , rubber sheat , sahlis hemolglobinometer. , scissor big(gauge+ bandag cutting) , scissor opreting curved mayo blunt pointed 17 mm german. , semi follower bed 18 mm steel. , shadowless lamp led , souce pan with lid. , sound uterine simpson 300 mm (german) , sound uterine simpson blunt (german) , sponge holder 5straight(tungston carbide coated) german. , sponge holder 5curved (tungston carbide coated) german. , stethoscope diamond(adult) , stethoscope diamond(child) , stitch removal scissors 6 (tungston carbide coated) german. , stitch removal scissors 8 (tungston carbide coated) german. , stretcher folding , stretcher on trolleybig wheel 5.5 , stritch cuttingscissor , stritch removing instrument (eye) , suction machineelectric with pump power supply 230 240 volt, 50hz, vaccum capiity 18 lter./ mini max. depression 75 kpa( 263hg.) vaccum is created by a plastic piston and cylinder system with four vaccum creating modules. , thermometer digital , tooth forcep big , tooth forcep medium (tungston carbide coated) german. , tooth forcep small (tungston carbide coated) german. , towel clips forceps , tray, instruned cover, 310, 200, 600 mm ss , tube sealer (solid statef) , urine pot steel. , utrain sound , weighing machine for adult , weighing machine for child (electronic) , wheel chair , durm, sterilizing cylindrical (275 mm oiax 132 mm ss as per is) , tcdc count apparatus , esr stand with tubes , test tube stand , test tube rack , test tube holders , spirit lamp , sami auto analiser (with installation(specifications attached) , hydrolic stretcher on trolly big wheel...

Employees State Insurance Corporation - Jharkhand

37760141 bids are invited for disposables items mse cloth adhesive tape 5 cm , paper adhesive tape , bandage roller 2 inch , bandage roller 4 inch , bandage roller 6 inch , cotton roll 400gm , suction catheter 8fg , suction catheter 12fg , suction catheter 14fg , suction catheter 16fg , b p blade no 15 , b p blade no 22 , b p blade 23 , ecg electrode , intravenous canula size 20 g , intravenous canula22 g , intravenous canula 24 g , intravenous canula 16 g , intravenous canula size 26 g , mtp canula size 07 , mtp canula size 4 , mtp canula size 08 , mtp canula size 10 , oxygen mask adult , oxygen mask paed , nebulizer mask paed , nebulizer mask adult , needle disposablesize 18g , needle disposable size 24 g , gloves surgical size 7 , examination gloves plastic , nitrile examination gloves unsterile large , syringe disposable single use with needle 10ml 21g , syringe disposable single use with needle 2ml 24g , syringe disposable single use with needle 5ml 23g , blood set drip chamber with filter 18g needle , dispoable spinal needle size 23g , disposable spinal needle 25g , disposable spinal needle 26g , disposable spinal needle 27g , cotton crepe bandage 10cm x 4m , cotton crepe bandage 15cm x 4m , handloom cotton gauze 18m x 90cm , measured volume infusion set paed drip , abgel haemostatic sponge 1x5x8cm , two way folleys catheter 16fr , dyanplast 4 , knee brace m total quantity : 267465...

Health Department - Jharkhand

37709206 group b rate contract for medicine at sadar hospital koderma , items : , tab. paracetamol ( 250 mg ) , tab. azithromycin ( 250 mg ) , tab. fluconazole ( 150 mg ) , tab. losartan potassium ( 50 mg ) , tab. ofloxacin ( 100 mg ) , tab. ofloxacin ( 200 mg ) , tab. ofloxacin + ornidazole , tab. calcium carbonate ( 500 mg ) &vitamin d3 , tab. clopidogrel ( 75 mg ) , tab. atorvastatin ( 10 mg ) , tab. erythromycin estolate ( 500 mg ) , tab. metformin ( 500 mg ) , tab. calcium & vit d3 250 mg ( each ) , tab. ciprofloxacin ( 250 mg. ) , tab. domperidone ( 10 mg. ) , tab. paracetamol ( 500 mg ) , tab. prednlsolone ( 5 mg ) , tab. prednlsolone ( 10 mg ) , tab. prednlsolone ( 20 mg ) , tab. azithromycin ( 500 mg ) , tab. famotidine ( 20 mg ) , tab. ibuprofen ( 200 mg ) , tab. ibuprofen ( 400 mg ) , tab. metronidazole ( 200 mg ) , tab. metronidazole ( 400 mg ) , tab. multivitamins ( as per schedule v of drugs and cosmetics rules ) ( 1 tab ) , tab. ciprofaloxacin ip + tinidazole ( 500 mg.+600 mg ) , tab. ciprofloxacin ( 500 mg. ) , tab. co trimoxazole ds ( 160 mg.+800 mg. ) , tab. co trimoxazole ss ( 80 mg.+400 mg. ) , tab. norfloxacin ip + tinidazole ( 400 mg+600 mg. ) , tab. cetirzine ( 10 mg ) , tab. nimesulide + paracitamole ( 100mg+325mg ) , tab. accelofenace+ para ( 100 mg + 325 mg ) , tab. ibuprofen ip+ paracetamol ip ( 400 mg.+325 mg ) , tab. ranitidine ( 150 mg. ) , tab. amoxycillin+ clavulanic acid ( 500+125 mg ) , tab. amoxycillin+ clavulanic acid ( 250+125 mg ) , tab .paracetamol + diclofenac sodium ( 325 mg.+50 mg ) , tab. dicyclomine hydrocloride.+ paracetamol ( 20 mg.+325 mg. ) , tab. misoprostal ( 200 gm ) , tab. salbutamol ( 4 mg ) , tab. folic acid 400 microgram , tab. norfloxacin 400 mg , tab. enalapril maleate 5 mg , tab. phenoxymethylpenicillin potassium 250 mg , tab. zinc sulphate 50 mg , tab. chloroquine 150 mg , tab. albendazole ( 400 mg ) , tab. amlodipine ( 5 mg ) , tab. cephalexin ( 500 mg. ) , tab. ondansetron ( 4 mg ) , tab. tinidazole 600mg , tab. allopurinol 100 mg , tab. rabiprazole 20+ domperidome 10 mg , tab. cefexime 200 mg , tab. doxycycline 100 mg , tab. vitamin c 500 mg , tab. paracetamol ( 650 mg ) , cap. amoxicillin ( 250 mg ) , cap. amoxicillin ( 500 mg ) , cap. tramadol 100 mg , cap. omeprazole ( 20 mg ) , cap. iron folic acid , cap. iron , cap. amoxy 250 + cloxy 250 , cap ampi 250 + cloxy 250 , cap. ampicillin 500 mg , cap tramadole 50 mg , syrup domperidom ( 30 ml ) , syrup ofloxacin ( 30 ml ) , syrup salbutamol sulphate ( 100 ml ) , syrup metoclopramide ( 5mg / 30ml ) , syrup. b complex 100 ml ( each ) , syrup paracetamol ip 125 mg ( 60 ml ) , syrup. cough supressent ( dextromethorphan based ) dextromethorphan hyd, chlophenical maleate&phenylephrine hyd ( 60ml ) , syrup. cough supressent dextromethorphan hyd, chlophenical maleate&phenylephrine hyd. ( 100ml ) , syrup. diphenhydramine hydrochloride ammounium chloride sodium citrate &menthol100 ml , syrup. cotrimoxazole ( 50 ml ) , syrup. amoxicillin 125 mg / 30 ml , syrup. nimesulide + para 60 ml , syrup potassium chloride solution , syrup. azithromycin 200 mg / 15ml , syrup. chlorphenatamin + dhenylephrione 60 ml , syrup. anti allergical cough suppresent 60 ml , syrup. metronidazole 60ml , syrup multivitamin , syrup ondemsetron , syrup hemfer , syrup. carbamazepine , syrup promethazine 60 ml , syrup. norbin power 30ml , syrup. zinc sulphate 100 ml , syrup. erythromycin 60 ml , syrup. ibuprofen 60 ml 100 mg , syrup. ibuprofen & paracetamol 60 ml , syrup do 60ml. , syrup carbamazepinesyrup , syrup. vitamin a 100ml , syrup promethazine 30ml , syrup. glyceryl trinitrate , syrup cetrizine ( 30 ml ) , syrup. carbamazepine , scabe lotion 100 ml , drop flurabifrofen eye5 ml , drop tropicamide with phenylephrine ( eye drop ) , drop homid ( eye drop ) , drop nephafenac ( eye drop ) , drop paracain ( eye drop ) , drop paracetamol 15 ml , drop ondenstron , drop cough 15 ml , drop multivitamin 15 ml , drop oflox oz 30 ml , drop azithromycin 100 mg susp. 30 ml , drop enzyme 15 ml , drop enzyme 100 ml , drop amoxicillin 10 ml , drop cefexime oral susp. 30 ml , drop domperidone , drop butrodol , drop moxifloxcin eye ( 5ml ) , drop lubricant eye ( 5 ml ) , drop. amoxycillin & potassium clavulanate oral 30ml , drop. cefpodoxime proxetil oral 30ml , drop dicyclomine , drop gentamycin eye / ear , drop ciprofloxacin eye ( 5ml ) , drop gentamycin ear ( 5ml ) , drop suspension albendazole ( 200 mg / 15 ml ) , drop suspension albendazole ( 100 mg / 15 ml ) , drop vitamin d3 15 ml , lens power number 21 to 24.5 ( each any number ) , sachet bifilac 0.5 gm , inj. ranitidine ( 25 mg / 2ml ) , inj. amlkacin ( 250 mg / 2 ml ) , inj. gentamicin ( 40 mg / ml ) , inj. ceftriaxone ( 1 gm ) with water , inj. ceftriaxone ( 125 mg. / 5 ml ) with water , inj. ceftriaxone ( 250 mg. ) with water , inj. ceftriaxone ( 500 mg. ) with water , inj. tramadol ( 50 mg ) , inj. gentamicin ( 80 mg / ml ) , inj. paracetamol 10 ml , inj. metoclopramide5mg , inj. amikacin ( 500 mg ) , inj. diclofenac ( 25 mg / 1ml ) , inj. ondansetron ( 4mg ) , inj. dicyclomine ( 10 mg ) , inj. human rabies immunoglobulin ( 300 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 250 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 500 iu ) , inj. human tetanus immunoglobulin ( 1000 iu ) , inj. hepatitis b immunoglobulin ( 200iu / 1ml ) notavl , inj. hepatitis b immunoglobulin ( 100iu / 1ml ) , inj. anti imnuoglobin 250 mg , inj. anti imnuoglobin 1 gm , inj. pentazosin ( amp ) , inj. equine rabies immunoglobulin ( 1500 iu / 5 ml ) , inj. ampicillin 500 mg , inj. ampicillin 250 mg , inj. benzathine penicillin ( 6 lakh units ) 450 mg , inj. benzathine penicillin ( 12 lakh units ) , inj. anti rabies vaccine with 5 syringe ( multi dose intra dermal 1 ml ) , inj. dexamethasone 4 mg , inj. oxytocin 2 ml , inj. anti rabies vaccine withsyringe ( single dose intra muscular 0.5 ml ) , inj. desferal , inj. effcorlin , inj. cefotexime 125 mg , inj. cefotexime 250 mg , inj. amikacin 100 mg , inj. aminofylin 10 ml , inj. meropenum 1000 mg , inj. meropenum 500 mg , inj. meropenum 125 mg , inj. nikethamide each , inj. pipracillin 4000mg + tazobactom 500mg , inj. phenobarbiton , inj. phenytoin 100 mg , inj. caffirate , inj. livipil , inj. doubutamine , inj. xylocain 2% with adrinaline 30ml , inj. efipres each , inj ampicillin 125mg , inj.chromostate , inj. medazolam , inj. propofol 10 ml , inj. phenargan , inj. fentanyle , inj. kcl , inj. heaparin , inj. pethedin , inj. glycopyrolet , inj. butrodol 1 ml , inj. butrodol 2 ml , inj. suceinyle cholene , inj. calmpose , inj. noloxone , inj. butorphanal , inj. vecurouium , inj. adrenaline , inj. lignocaine hydrochloride& adrenaline 30ml vials , inj. triamcinolone acetonide 31ml , inj. defrioxamine 500 mg , inj. calcium gluconateiv 1gm , inj. aminophyline each , inj. mephentine , inj. spasmocare , inj. ketamin 10 mg , inj. streptomycin injection 0.750 grm , inj. streptomycin injection 0.500 grm , inj. streptomycin injection 1.000 grm , inj. capreomycin 01 grm , inj. cepromycin 750 mg , inj. kanamycine 01 grm , inj. kanamycine 500 mg , inj. hydrocortsione 100mg , inj. anawin ( 5% ) 30 ml , inj. insulin 40 units / 10 ml , inj. insulin zinc suspension 40 unit / 10 ml , inj. betamethasone4mg / ml , inj. furosemide 10 mg / ml , inj. diazepam5 mg , inj. etophyllin + theophylline ( deriphyllin ) , inj. cloxacillin 250 mg , inj. prostodine , inj. hydrocortisone 100mg , inj. drotaverin2 ml , inj. atropine 0.6 mg , inj. tranexamic acid , inj. vitamin k ( phytomenadione ) , inj. vitamin k 3 ( menadione ) , inj. xylocain 2%30ml , inj. xylocain 5%30ml , inj. phenylphrine ( 1ml ) , inj. camolol , inj. methergin , inj. sodium chloride ivi.p 0.9% w 1 v 500 ml , inj. aminophiline , inj. prostaglandin 205 mg , inj. prostadine each , inj. pipracillin + tazobactum 4.5 gm , inj. donperidone , inj ondacetron 2ml , inj. azithromycin 500 mg , inj augmentin 1.2 gm , inj paracetamol 1 gm , inj mvi , inj dobutamine , inj lasix , inj termin , inj nitroglycerine , inj esmolol , inj amzodarone 300 mg , inj. anti snake venum , inj. hydrocortisone sucoinate 100mg , inj. promethazine 25 mg / 2 ml , inj. magsulph magnisium sulphate i.p 50% , inj. oxytocin inj. , inj. phenytoin sodium 2 ml , inj. sodium bicarbonat iv 7.5% 10 ml , inj. sodibicarb 10 ml amp ( 7.5% ) , inj. anti d300 mg , inj. labetalol 100 mg , inj. labetalol 50 mg , inj. potassium chloride , inj. prostaglandin 205 mg , inj. dopamine 200 mg 10 ml , inj. betamethasone sodium phosphate , inj. plasma volume expender 500 ml bottle , inj. bupivaccine 0.5% 20 ml , inj. ropin 0.75% ( ropivacain ) ( neon ) , inj. dexmedine 100 ug , inj. atacurium ( atracurium ) , inj. anemol ( paracetamol 1 gm 100 ml ) , inj. midfast ( misazolam ) , inj. iflurane ( isoflrane ) 100 ml , inj. avil each , inj. hydrocortisone succinate ( efcorlin ) each , inj. dopamine each , inj. calcium sandoz each , inj. neostigmine each , inj. iron sukroj amp each , inj. ondacetron 2ml , inj. azithromycin 500 mg , inj. pentoprazole , ini. streptomycin injection 0.500 gram ( per vials ) , inj augementine 1.2gm , inj atracurium , inj noradrenaline , inj. digoxin , inj. insulin regular , inj. insulin intermediate , inj. aminophylline , inj. benzathine benzyl penicillin , inj. lignocaine hydrochloride , inj. streptokinase 7.5 lac vial , inj. streptokinase 15 lac vial , inj.mixed human insulin 30 / 70 , inj. mixed human insulin 50 / 50 , inj. penidure la6, la 12 , inj. pantaprazole 40mg , inj. hepatitis b immunoglobulin 100 iu / 0.5ml. , inj. heaparin 25000iu , inj. heparin sod 5000 iu , inj. heparin sod 10000 iu , inj. heparin sod 1000 iu , inj. hynidase , inj atracurium 2.5ml. , inj. diazepam , inj. promethazine , inj. promethazine , inj.glyceryl trinitrate , inj. tetvac vial 5ml , inj. tetvac vial 1ml , inj. rabis immunoglobin 1500 iu , inj. methylcobalamin , nicotinamind, pyridoxine hcl&d panthenol.2ml , inj. hydroxyprogesterone caproate 250 mg , inj. hydroxyprogesterone caproate 500 mg , inj. amikacine 100mg , ors powder ( 21.8 gm. pkt. ) , 2% xylocain jelly 30 gm , luliconazole cream 10gm , luliconazole lotion 15gm , diclofenac spry , ketokonazole soap , enteroglemina , oint. povidine iodine oint15 gm , oint. clotrimazole 15 gm , cream. clobetasol propionate, neomycin sulphate&miconazole nitrate , oint. clotrimazole + gentamycin + beclometasone ointment 15gm , oint. silverex ( 250 gm ) jar , drops. ciprofloxacine & betamethasone sodium phasphate e / e , drops. gentamicin & betamethasone sodium phasphate e / e , drops. ofloxacine & betamethasone sodium phasphate e / e , drops. moxifloxacine & dexamethasone sodium phasphate e / e , gamma benzene hexachhloride &cetrimide lotion 100ml , oint. clotrimezole oint. 15 gm , tab.glyceryl trinitrate , tab.alprazolam 0.25 mg , tab.alprazolam 0.50 mg , tab.cephalexine 250 mg , tab.drotavarin , tab.defrijet 250 ( each uncoted tab. for oral suspension contains deferarirox 250 mg ) , tab.defrijet 500 ( deferasirox 500 mg ) , tab.darcolex 500 mg , tab.digoxin 0.5 mg , tab. metoprolol 25 xl mg , tab. metoprolol 50 xl mg , tab. aspirin 75mg , tab. hydrochlorthiazide 12.5 mg , tab. hydrochlorthiazide 25 mg , tab. enalapril 2.5 mg , tab. enalapril 5 mg , tab. captopril , tab. clopidogrel , tab. isosorbidedinitrate ( sorbitrate ) , tab. glyceryl trinitrat , tab. verapamil ( isoptin ) , tab. potasium ip ( pencylin v ) , tab. carbamazepine , hiv rti / sti kit kit 1 grey a ) tab. azithromycin 1 gm tab. b ) tab. cefixime 400gm. 1 tab. , hiv rti / sti kit kit 2 green a ) tab. secnidazole 1 gm 2 tabs. b ) tab. fluconazole 150 mg1 tab. , hiv rti / sti kit ( kit 3 white a ) inj. benzathine penicillin 2.4 mu 1 no. b ) tab azithromycin 1gm. 1 tab. c ) sterile disposable syringe 10ml.21 g needle 1 no. d ) sterile water 10 ml. 1 no. ) , hiv rti / sti kit kit 4 blue a ) cap. doxyccline 100 mg. 30 caps. b ) tab. azithromycin 1gm. 1 no. , hiv rti / sti kit kit 5 red a ) tab. acyclovir 400 mg. 21 tab. , hiv rti / sti kit kit 6 yellow a ) tab. cefixime 400 mg 1 tab b ) tab metronidazole 400 mg. 28 tabs c ) cap. doxycycline 100 mg 2 tab , hiv rti / sti kit kit 7 black a ) cap. doxycycline 100mg 42 caps b ) tab. azithromycin 1 gm 1 no. , tab. azithromycin 100mg , tab. atenol 100 mg , tab. glimepride 5 mg , tab. premaquine 2.5 mg , tab. misoprostol 200 mg , tab. isoniazid 100 mg. , tab. isoniazid 300 mg. , tab. pyridoxine 100 mg , tab. pyrazinamide 750 mg , tab. pyridoxine 50 mg , tab. pyridoxine 25 mg. , mma drugs for safe abortion services ( in combi pack 1 tab mifepristone 200 mg and 2 tab misoprostol 200 mcg each tab ) , respule salbutamol + iprapropiun , respule budenocide , tab. methyldopa 250 mg , tab. pan 40 ( pantotrazole ) , tab. methyl dopa each , tab linezolid 600 mg , tab amlodeepine at , tab deriphyllin 50 mg , tab dexamethasone , tab enzyme , tab hcqs 200 mg , tab hcqs 400 mg , tab wysolone 10 mg , tab. glimepride 1 mg , tab. chlroquine 250 mg , tab. premaquine 7.5 mg , tab. erythromycin 250 mg , tab. trimethoprim 80mg & sulphamethoxazole 400 mg ( adults ) , tab. atenolol ( 25 mg ) , tab. atenolol ( 50 mg ) , tab. cefexime 100 mg , tab. pentoprazole 40mg , tab. favi piravir , tab. ivermectin , tab. asprin ( 75 mg ) , tab. captopril 2.5 mg , tab. methyldopa 500 mg , tab.atorvastatin 10 mg , tab. digoxin , tab. potasium ip ( penicillin v ) , tab. nifedipine 5 mg , tab. nifedipine 10 mg , tab.folic acid , tab. carbamazepine , tab prednisolone , tab promethazine , tab atenolol 25 , tab. metoprolol 25 , tab methyldopa 250 mg , tab. frusemide 40 mg , tab. issorbide dinitrate ( sorbitrate ) 10 mg , tab. issorbide dinitrate ( sorbitrate ) 5 mg , tab pioglitazone ( 15mg ) , tab. vildagliptin ( 50 ) , tab b complex , tab. methylcobalamine 1500 &alpha lupic acid &pyridoxine&folic acid , tab. telmisatan 40 mg , tab. escitelopam 5 mg , tab. pantaprazole ( 400 ) , tab. pantaprazole + domeperidone , tab. ondacetron ( ondem ) , tab atorvastatin 10 mg+ecosprin 75 ( combined ) , tab. epselin ( 100 mg ) . , tab. amlodipine2.5 mg, , tab. amlodipine 5mg , tab. amlodipine 10mg , tab ondencetron 4 mg , tab. nifedipine ( 5mg ) , tab. telmisartan 20 mg , tab. telmisartan 40 mg , tab metron 500mg , caps promethazine , cap hydroxyurea 500 mg , cap. rifampicin 150 mg , cap. rifabutine 150 mg , cap. clofazimine 100 mg. , cap. ampicillin 250 mg , cap depin 5 mg , cap depin 10 mg , cap chloramphenicol eye ointment 250 mg , cap vitamin bcomplex , cap. clofazimine 100mg , formalin500ml , oxygen nesal set paed , oxygen nesal set adult , oxygen nesal set ( neonetal ) , oxygen hood , corogated drain disposable , corogated drain rubber , vac set ( closewoundsuction ) size size 14 18 , adk set ( abdominal drain ) size 20 32 , cautery pencil , cotery pad disposable , pmo line ( 100 / 150 / 200 cm ) , 3 way line connector , senitizer 5 liter jar , pedia set 110 ml , pedia mask 0, 1 , feeding tube no. 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 , foleys catheter no. 14, 16 , ryles tube adult no. 6, 8, 10, 12, 14, 16, 18 , permethrin lotion 30 ml , plain catheter no. 10 , plain rubber urinary catheter each , hernia kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , mva / eva for safe aboration sevice kit , ec lotion 100 ml , crepe bandage 4x 4mtr , crepe bandage 6x 4mtr , french chalk powder 1 kg , viscoelastic hypersole , bitadin hand scrab , sprit 1 ltr. , soft cotton 4x 3mtr , soft cotton 6x 3mtr , roller bandege 2”x 3mtr , roller bandege 3”x 3mtr , roller bandage 4x 3mtr , roller bandage 6x 3mtr , gypsona 6x 2.7mtr , gypsona 4x 2.7mtr , leucoplastroll 4 x 6mtr , leucoplast roll 2x 6mtr , bandage than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , needle 26g , needle 24g , vicryl no:1 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no:1 0 ( 1 / 2 rc , 90 cm lenth ) , vicryl no. 2 0 curved round body needle ( 90 cm lenth ) , vicryl no. 3 0 curved round body needle ( 90 cm lenth ) , vicryl no. 4 0 curved round body needle ( 90 cm lenth ) , vicryl no. 6 0 curved round body needle ( 90 cm lenth ) , vicryl no:1 0 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no: 1 ( 40 mm1 / 2 rb tc 180 cm double needle ) , chromic catgut no:1 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:1 0 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:2 ( 45 mm1 / 2 rb, 100 cm lenth ) , chromic catgut no: 2 0 ( 30 mm 1 / 2 rb 76 cm lenth ) , prolene 1 0 curved round body , prolene 2 0 curved round body , prolene 3 0 curved round body , prolene 3 0 curved cutting needle , pds 5 0 curved round body , pds 6 0 curved round body , ethilon 3 0 curved cutting needle , ethilon 4 0 curved cutting needle , silk thred 3 0 curved round body , silk thred 4 0 curved round body , suture 10.0 , cresent knife 2.5 mm , keratome knife 2.8 mm , respirometer ( 3 ball ) disposable , prolene mesh size 6 x 11 cm , prolene mesh size 8 x 15 cm , prolene mesh size15 x 15 cm , trimmer ( per pcs ) , deshnet 1 ltr. jar , bt set ( sigle chamber ) disposable , tamophose 50 ec ( 5 ltr. jar ) , distil water 7.4 5 ltr. jar , perineal sheet , sodium metabisulfate 500 gm , gentian violet 500 ml , glass slide ( per box ) 100 pcs , saving blade , ecg gel 1 kg , usg gel 1 kg , ab gel , sticking plaster ( surgical tape ) 2.5 cm x 9.10 m , cotton thred no. 10 , surgical uncals utility gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves ( non sterile ) all size ( no. 6.5, 7, 7.5 ) pair , gloves ( nitrile ) all size ( 100 pc / 50 pair ) , shoe covers. ( disposable ) , service gloves 400 mm , mask surgical 3 lyer ( with nose clip ) , mask surgical 3 lyer ( without nose clip ) , n95 mask ( with nose clip ) , n95 mask ( without nose clip ) , mask cotton cloth , duoline repsules , umbilical cathether ( 100 pc ) , nenaton cathether no. ( 6 to 18 any each no. ) , iv set ( disposable ) , povidine iodine solution ( 500 ml ) 5% , povidine iodine solution ( 100 ml ) 5% , povidine iodine gargile ( 100 ml ) , gouze than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , plaster of paris 5 kg jar , surgical sprit 100 ml , urobag disposable 2000 ml , endotracheal tube 2.5 4.5 plain , endotracheal tube couved5 to 12 , hydrogan pyroxide 100 ml , priking needle len set , sanitizer 500ml litre , i v canula size no: 18, 20 & 22 , i v canula no: 24 , savlon ( 100 ml ) each , band aid , malaria kit , bleaching powder ( 25 kg beg ) , kelleys pad each , blood bag , sodium hypochloride , umbilical cord clamp , suction tube plain size no:6 16 , mersilk 2.0, 1.0 cutting needle 90 cm lenth , n / g tube 5, 6 no. , silk thred ( reel ) no: 0 1, 0 2 , pregency kit , spinal needle no: 23 , 24, 25, 26, 27 , ryles tube infant size all , microdrip set , nosogastric tube no. 6 , spirit ( 100% ) ( per 5 ltrs ) , surgical spirit ( 100% ) 5 ltrs jar , nosogastric tube no. 6 feeding tube , plain rubber urinary catheter , curved cutting needle each , gentian violet 30 ml 0.5% , ecg paper ( schller ) ( per pkt. ) , sodium hypo chloride ( 5 ltr jar ) , disposable syring 1 ml , disposable syring 2 ml , disposable syring 3 ml , disposable syring 5 ml , disposable syring10 ml , disposable syringe 20 ml , disposable syringe 50 ml , insuline syringe 40 u , cotton400 gm , micropore 2x9mtr , mucus exatractor , bp blade all size , lysol 400 ml , oxygen mask set ( complete set ) , infusion set with hypodermic needle 21g 1.5 , disposable delivery kit ( ddk kit ) ( content of the kit2 pair of glove blade 1 pc carbolic soap 1 cord clamp 1 plastic sheets 2x2 mtr. ) , intera kit, size 18 / 20 / 22 ( infusion therapy kit ) iv canulla 1 pc, canulla fixatar 1pc, syringe 5 ml 1pc, sterile alcohol swab 1pc, infusion set 1 pc , micro scalp veinset no. 26 ( buterfly ) , formalin ( 5 ltr. jar ) , plain rubber urinary catheter each , mosquito repellent each , curved cutting needle each , cidex 5 ltr. jar , nsv kit , casete with inensifying screen 12x15 ( konica ) , casete with inensifying screen 12x12 ( konica ) , casete with inensifying screen 12x10 ( konica ) , casete with inensifying screen 8x10 ( konica ) , developing tank ( 13.5 ltr. ) , appendectomy bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , developer13.5 ltr , fixture13.5 kg , chest stand flour model , safe flight 8x10 , clip big , half flim bloker 12x15 , half flim bloker 12x12 , half flim bloker 12x10 , half flim bloker 8x10 , x ray film 8x10 ( blue ) ( 50 pc pkt. ) , x ray film 10x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x15 ( blue ) ( 50 pc pkt. ) , cr x ray film 8x10 ( 125 sheet ) make konika , crx ray film 10x12 ( 125 sheet ) make konika , dve x ray film 8x10 ( 125 sheet ) make carestream , dve x ray film 10x12 ( 125 sheet ) make carestream , halothen i.p 0.01%ww , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , ambubag with zero size ( infant ) , triple dye lotion , lead apron , inj. metronidazole iv 100 ml , iv amninovein 10% ( 500 ml ) , iv dextrose 10% 500 ml , iv dextrose 25% 100 ml , iv isolyte p 500 ml , iv n / 4 ns 500 ml , iv dns 0.45% , iv dns 10% , iv dns ( 500 ml ) , iv ns ( 500 ml ) , iv 5% dextrose ( 500 ml ) , iv rl 500 ml , iv rl glass 500 ml , inj. ciprofloxacine iv 100 ml , inj. mannitol 20% 300 ml , hydrocele operation kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalne , cold box with ice pack 6 ltr , cvc catheter uno4, 5, 6 fr lenth 15 / 16, 20 cm , cvc catheter duo7 fr lenth 15 / 16, 20 cm , cvc catheter trio 7 fr lenth 15 / 16, 20 cm , cvc catheter trio 5 fr lenth8 cm , epidural minipacksize no: 16 g, 18g , av fistula needle size no: 15g, 16g, 17g , av fistula needle size no: 15g, 16g, 17g pair , three way stop cock with extention 10, 25, 50 cm , heamodilysis kitdouble size :12fr x13 cm , heamodilysis kittriplesize :12fr x13 cm , sample cup , allicote ( bullete tube ) , liga clip lt 300 , liga clip lt 400 , tube ciller , refrigertor graph paper , calpol suppository , duphalac suppository , ecg lead neonate , paraffin wax , xylene 5 ltr. jar , 100% absolute alcohol 5 ltr. jar , hematoxylene stain , scotts tap water , eosin tap water , hcl 1% , dpx mount 250 ml , scalpel for hpe , blades for scalpel , water bath ( small ) 2 ltr. , staining jar ( coplin jar ) 250 ml , glycerine ( 500 ml ) , glass marker ) , hmf sachet 1 gm , sodium choride ( nacl ) 500 grmper pkt. ) n / 1o , disodium hydrogen phosphgate ( na2hpo4 ) , 500 gm per pkt. , sodium dihydogen phosphate ( nah2po4, 2h2o ) 500 gm pkt. , anthydrous ( k2 hp04 ) 500 gm pkt. ( potassium phosphate dibasci anhydrous , sponin 1000 gm per pkt. , micropippet 200 1000 ul. , micropippet 5 50 ul. , variant ii control ( for hplc machine ) , variant ii sample ( 100x1.5 ml ) vial ( for hplc machine ) , cal a and cal b ( for electrolyte machine ) ( tulip ) , sodium fluoride vail ( non vacuum ) 2 ml ( 100 pc ) , citrate 3.2% vail ( non vacuum ) ( 100 pc pkt ) , urineanalyzer strip ( 10 para ) ( urit 50 biogeny ) , hi aid ( medicated dressing ) 22 mm diameter , vidas t3 1x60 t ( mini vidas ) , vidas t4 1x60 t ( mini vidas ) , vidas tsh 1x60 t ( mini vidas ) , vidas fsh 1x60 t ( mini vidas ) , vidas lh 1x60 t ( mini vidas ) , prolactin 1x60 t ( mini vidas ) , vit d 1x60 t ( mini vidas ) , d dimer 1x60 t ( mini vidas ) , ns troponin i ( mini vidas ) , covid ig g ( mini vidas ) , covid ig m ( mini vidas ) , p.t. vail 1x100 ( mini vidas ) , urine analyzer print paper roll ( urit 50 biogeny ) , cuvette ( for coagulation analyzer ) ( make sysmex ) , p.t. test kit ( for coagulation analyzer ) ( make sysmex ) , control kit ( for coagulation analyzer ) ( make sysmex ) , p.m. kit elx 640 ( erba ) , caliberator kit ( erba ) ( cbc 5 part ) , elite h clean ( erba ) ( cbc 5 part ) , nutrient agar ( 100 ml bottle ) , mackoney agar ( 100 ml bottle ) , grams iodine 250 ml , suffranine 250 ml , ethyle alchohal 95% 250 ml , crystal voilet 250 ml , antibviotic sensitivity dises, amikacine , antibviotic sensitivity dises, cotrimoxazole , antibviotic sensitivity dises, ciprofloxacin , antibviotic sensitivity dises, gentamycin , antibviotic sensitivity dises, bentamycin , antibviotic sensitivity dises, lomefloxacin , antibviotic sensitivity dises, levofloxacin , antibviotic sensitivity dises, norfloxacin , antibviotic sensitivity dises, ofloxacin , antibviotic sensitivity dises, cephalixin , antibviotic sensitivity dises, tobramycine , antibviotic sensitivity dises, moxifloxacin , antibviotic sensitivity dises, ceftodoxime , antibviotic sensitivity dises, nitrofurantion , antibviotic sensitivity dises, clindamycin , antibviotic sensitivity dises, sefeazidime / clavulanic acid , antibviotic sensitivity dises, cefuroxine , antibviotic sensitivity dises, imipenem , turniquat , syrup phenobarbitone , cutting and round body needle medium size each , ctg paper ( per pkt. ) , carbolic lotion 2% , esr tube disposable , cover slip small ( 100x1 pkt ) , rh view box , vial rack , bovine albumin 20% 100 ml , anti h , immerssion oil ( bottle ) , hemosafe sls 1 ltr , test tube 12x75 mm , test tube rack , triglyeerides kit 2x150 ml , esr tube disposable with cap , tri sodium citrate 3.8% ( 500ml ) , a.b.d. ( 3x10ml ) , micro tips yellow ( 1000 pcs ) , micro tips blue ( 1000 pcs ) , widal antigen slide methed ( 4x5ml ) , urea kit 300 ml , tips ( 100 1000ul ) , petridish , tsh ( 1x96 test ) , t4 ( 1x96 test ) , t3 ( 1x96 test ) , liquiplastin ( 5 ml ) , liquicelin e ( 5 ml ) , calcium chloride ( 5 ml ) , hcv kit ( 50 test ) , amylase ( 50 test ) , lipase ( 50 test ) , recombinant factor viii ( 3rd generation dna origin ) 500 iu , recombinant factor viii ( 3rd generation dna origin ) 1000 iu , lh ( 1x96 test ) , fsh ( reagent ) , uric acid ( 5x20 ml ) , call counting machine , esr stand 6 tube capacity , bleading time test , helix pcd test ( conform to iso 13485 1class 2, 121c / 20 min, 134c / 3.5 min, shelf life 3 years after production, clear transition of pink into brown for steam, easy to interpret, easy to document, non toxic / lead free ) , chemical indicator ( shelf life 3 years after production, packed in an easy dispensing carton, clear colour transition of the emulator, non toxic / lead free ) , documentation labels ( process indicators ( steam ) , for steam 121 c 20 min & 134 c for 3.5 min, conform to iso 11140 1 class 1, clear transition of indicatorinto its end color, easy to use labe gun, double labels serve for an easy traceability and document , blood gas analyser card ( edan ) , blood gas analyser paper roll ( for printer ) , iv albumin 100 ml , hcb card test ( 50 test ) kit , rpr card test kit , whole blood finger prick test for hiv ( card test ) kit , sputum container ( per pcs ) , drop bottle ( per 200 ml ) , filter paper ( per 100 pcs pkts ) , cyrstol phenol ( per 500 gram pack ) , ethanol ( per 500 ml pack ) , liquid praffine ( per 500 ml pack ) , basic fuchin powder ( per 25 gram pack ) , urine strip 2 para meter ( 100 test ) , urine strip 4 para meter ( 100 test ) , urine strip 10 para meter ( 100 test ) , tarpin oil ( 400 ml ) , bt filter ( bacteria filter ) , ferittin estimatiry elisa reagent , dropper 3ml plastic , savlon ( 500 ml ) , optimal test kit for malaria test of pv , anti d 10 ml , anti a 1 lactin , anti a 10 ml , anti b 10 ml , anti ab sera 10 ml , edta ( k3 ) non vaccutenor ( 100 pc pkt. ) , plain vial non vaccutenor ( 100 pc pkt ) , cloride vial non vaccutenor ( 100 pc pkt. ) , rh view box , vdrl ( rpr test 100 ) , blood grouping kit , bovine serum albumin , test tube 3 / 4 inch ( 100 pcs ) , calcium 2x150 ml , w.b.c. diluting fluid 500 ml , test tube rack , widal koit span 4x5 ml , v.d.r.l ( shippils test strip one step ) , r.a. ( 1x50 test ) , s.g.pt kit ( 50 ml ) , uric acid kit ( 5x20 ml ) , triglyecride desgpopap ( 25 ml ) , alkaline phospohate ( 5x15 ml ) , leishman stain solution 500 ml , leishman stain solution 250 ml , sodium citrate 3.8% ( 500 ml ) , r.a. antigen ( 100 test ) , glucose antigen ( 2x200 ml ) , uric acid kit ( 20x2 ml ) , distilled water ( 5 ltr. ) , urea bun urease gldh ( 20x5 ) , urea dam mannual kit ( 125 ml ) , cholestral antiigen / kit ( 75 ml ) , hdl kit 50 ml , sgot 150 ml x 2 , total protien 25 test , albumin 25 test , microprotein kit 25 test , crp test kit 25 test , aso titre kit 25 test , urine pot , tips ( 100 1000ul ) , tissue paper ( each roll ) , cretinnine kit ( 50 test ) , billirubin kit ( 50 test ) , e.d.t.a vail 2 ml. ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction , halothen i.p 0.01%ww , thiopentone sodium 500 , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , triple dye lotion , fulcon tube ( 50ml pot ) , mathylene blue ( 25 gram bottle ) , sulphuric acid conc. ( 500 ml bottle ) , phenol crystal ( 500 gram bottle ) , lense cleaning paper ( 100 pcs packet ) , ethanol ( ethyle alcohal ) 100% ( 500 ml bottle ) , sodium hypo chloride ( 5 ltr jar ) , slide staning trey aluminium , slide staining tray plastic , glass staning rode , drop bottle ( 500 ml ) , spirit lamp glass , water bath , slide stand , stain jsb 1 , stain jsb 2 , temephos 50% ec 1 liter , diflubenzuron 25% wp 1 kg , anixide h , spyrometer , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , sputum container ( 50 ml pot ) , glass slide , fulcon tube ( 50 ml pot ) , mathylene blue ( 25 gram bottle ) , sulphric acid conc. ( 500 ml bottle ) , phenyle liquid ( 40% ) ( 5 ltrs jar ) , phenol crystal ( 500 gram bottle ) , d.m. water ( 5 ltrs. jar ) , lense cleaning paper ( 100 pcs packet ) , filter paper ( 100 pcs per packet ) , tissue paper roll , auramin o ( 25 gram pack ) , ethanol ( ethyle alcohal ) 100% , hydro chloric acid conc. ( 500 ml bottle ) , potassium per manganate ( 500 gram bottle ) , basic fuchin ( 25 gram pack ) , liquid parafin ( 500 ml bottle ) , sodium hypo chlorite ( 5 ltr jar ) , slide staning trey plastic , staning stand , drop bottle ( 125ml. ) plastic , spirit lamp glass / ss 4oz. , forcap ( 6 ) ss disecting , water bath 2 rack capacity electrically operated , slide box ( 50 pc slide boxes ) plastic , slide boxes ( 100 pc slide boxes ) , scissor ( 8 ) ss , parmanent marker pen , funnel keep big ( glass ) sz 4 , funnel keep big ( glass ) sz 6 , slide stand aluminium , diluent for cbc machine 20 ltr , lyse for cbc machine 500ml. , cleaner for cbc machine, 5 ltr , cbc reporting paper ( per roll ) , mouth gag ss , test tube rack plastic 12.5mmx24hole , test tube rack plastic 12.5mm x48 hole , test tube rack plastic 15mmx24 hole , test tube rack plastic 15mmx48hole , test tube rack plastic 18mmx48hole , test tube rack plastic 18mmx24 hole , call counting machine ( manually ) 5 key , bleading time test capilary tube , plain rubber urinary catheter each , stainless steel small galley pot 20 25ml. capacity , ecg paper ( schller ) ( per pkt. ) , hydro chloric acid conc. ( per 500 ml ) , crescent knife ( 2.6 ) , keratome ( 2.8 ) , side port ( 15 ) , trypan blue , iol lense pamma lense , viscoelastic hypersole , enteroglemina , ferittin estimatiry elisa reagent , umbilical cathether ( 100 pc ) , halothen i.p 0.01%ww, 250ml. , coppersulphate crystal for chemical cautery of umbilical stump 500 mg, 500gm , drop gsb ear ( 10ml. ) , stainless steel small galley pot each , ahg ( antihuman globulin ) , 5ml. , rh view box , measuring cylinder ( glass ) 100 ml , measuring cylinder ( glass ) 1000 ml , measuring cylinder ( glass ) 2000 ml , beaker glass ( 250 ml ) , bovine serum albumin 5ml. , blood bag single adult / paeditric , anti h lectin 5ml. , testube brush big size , mersilk 2.0, 1.0 cutting needle , lab wash ( 500ml ) , distilled water ( 5 ltr. ) , urea dam mannual kit ( 125 ml ) , microprotein kit 1x50ml. , tips ( 100 1000ul ) big size , glucose ( 1x9x50ml ) , serum bilirubin kit ( 35 test ) , micropipette fixed volume , micropipette variable volume , large microtips ( 1000 pc ) , small microtips ( 1000 pc ) , tissue paper ( each roll ) , call counting machine ( manually ) 5 key , bleading time test capillary tube , filtter paper 9 cm ( 100 pc ) , cappillary tube ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction 4x60ml. , plain vials ( 100 pc ) , floride vials ( 100 pc ) , floride vials non vaccum ( 100 pc ) , edta kj tube ( 100 pc pkt ) , plain vials 2 ml non vaccum ( 100 pc ) , elisa ( hiv ) 4th genrationkit 1x96test , elisa ( hbsag ) kit ( 1x96 test ) , elisa ( hcv ) kit ( 1x96 test ) , elisa ( malaria ) kit ( 1x96 test ) , rpr latex kit ( 250 test ) , rapid ( hiv ) kit , rapid ( hbsag ) kit , rapid ( hcv ) kit , rapid ( vdrl ) kit, syphillis card test , rapid ( malaria ) kit , anti ab reagent 10 ml , anti ahg reagent 5ml , cupling jar plastic 5 slide cpacity , shalis method hb meter , gel card , ahg ( for cross match ) , gel card grouping ( forward & reverse ) , gelcard machine 8 card with warmer , gelcard machine 24 card with warmer , liss solution , labozent 500ml. , plastic tub , pasteur pipette , apron ( lab coat ) , tube sealer ( portable ) , glucon d 100gm , emergency medicine box , centifuse machine 16 channel r8c model , chemical balance machine , hot air oven , pap smear ( cyto brush +spetula ) , glass slide pkt of 50 , eosin stain yelllow 100 ml , heamotoxilline harris 500ml , isoprofile ( propen 2 ol 500ml , autoclave lable , tournicate valcro , antibiotic disc , culture plate disposable90 mm , culture plate glass 100 mm , maconkey agarv powder 500gm , maconkey agarv powder 100 ml , grams iodine100ml , grams iodine powder , cristel violate100ml , cristel violate powder 25gm , sodium citrate vial ( pt vial ) non vaccum , sodium citrate vaccum , alliequet vial , trop i , trop t , amkitdw plant , pm kitdw plant , phosphorus 10x12 ml , gamma gt 2x44 / 2x11ml , magnesium 2x44ml , uibc 125ml , ldh 2x44 / 2x11ml , serrum iron 125 ml , lipase 1x44 / 1x11ml , amylase5x22ml , ferritin , ferritin calibrator , ferritin control l , ferritin control h , erythromoietin , urine pot 30 ml , petridish 90 mmg ( titan biotech ) , blood agar ( titan biotech ) , maconekey agar ( titan biotech ) , muller hilton agar ( titan biotech ) , urea broth base ( titan biotech ) , distillwater , conical flask 100 ml , conical flask 500 ml , cotton roll , nichrome loop 2 mm with holder , amikacin antibiotic disc ( titan biotech ) , ampicillin antibiotic disc ( titan biotech ) , ampicillin + sulbactam antibiotic disc ( titan biotech ) , cefoxitin antibiotic disc ( titan biotech ) , ceftazidime antibiotic disc ( titan biotech ) , ciprofloxacin antibiotic disc ( titan biotech ) , colistin antibiotic disc ( titan biotech ) , co trimoxazole antibiotic disc ( titan biotech ) , doxycilline antibiotic disc ( titan biotech ) , erythrmycin antibiotic disc ( titan biotech ) , gentamicin antibiotic disc ( titan biotech ) , imipenem antibiotic disc ( titan biotech ) , levofloxacin antibiotic disc ( titan biotech ) , linezolid antibiotic disc ( titan biotech ) , meropenem antibiotic disc ( titan biotech ) , nitrofuran tion antibiotic disc ( titan biotech ) , norfloxazacin antibiotic disc ( titan biotech ) , piperacillin antibiotic disc ( titan biotech ) , polymyxin b antibiotic disc ( titan biotech ) , teicoplanin antibiotic disc ( titan biotech ) , tetracycline antibiotic disc ( titan biotech ) , vancomycin antibiotic disc ( titan biotech ) , cefazolin antibiotic disc ( titan biotech ) , tobramycin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , aztreonan antibiotic disc ( titan biotech ) , cefepime antibiotic disc ( titan biotech ) , cefoperazone antibiotic disc ( titan biotech ) , sparfloxacin antibiotic disc ( titan biotech ) , azithromycin antibiotic disc ( titan biotech ) , ofloxacin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , triple blood bag , double blood bag , quadruple bag , penta bag , apheresis kit , acd solution for apheresis , total protein kit of colorimeter , iodine solution , height measurement scale , observation table , graph paper and pencil, ( remi, model no br 300 ) , graph paper and pencil, ( penpol, model no br 360 ) , graph paper and pencil df ( 300l ) terumo pcnpof , graph paper and pencil pdv 360 ultra re , double pan balance weight ( non digital ) , urinometer , hydrometer , copper sulphate , prothrombin time reagent , fibrinogen reagent , aptt kit , york scientific ( modal ysi 572 ) , digital weight machine ( 150 200 kg ) , measuring cylinder ( 1000 5000ml ) , gal card machine for blood grouping and cross machine , warmer for gel card machine , weighing scale , wall bp instrument , blood collection monitor , portable donor couch of stainless steel with z mattress , rh view box , protable tube sealer battery operated , stripper for blood withdrawal , carry box for blood ( 50 bags ) , carry box for blood ( 100 bags ) , portable o2 cylinder , reagent refrigerator model number ( br360 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , reagent refrigerator model number ( br300 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , blood culture bottles ( a ) gloucose brothe w / 0.5% sps ( blood culture bottle ) ( b ) glucose broth w / 0.5% sps ( blood culture bottle ) ( titan biotech , anaerobic jar ( titan biotech ) , l.j. medium slant ( 10 slants ) ( titan biotech ) , antibiotic discs , nichrome loop 2mm with holder , petridish 90 mm ( titan biotech ) , grams stain kit ( titan biotech ) , nutrient agar ( titan biotech ) , maconkey agar ( titan biotech ) , zn staining kit, zn acid fast stain kit ( titan biotech ) , sprit 500 ml , betadine solution 500 ml , hand wash 250 ml , mask surgical , hand cap , viscolon 5 ml , lox 2% inj. , anawin inj. , dispoven 3 ml , dispoven 5 ml , dispoven 10 ml , dispoven 3 ml , eye dress eco , eye drape poly , honide ( eye drop ) , moxiflox ( eye drop ) , inj. hyni dase , surgical blades , eye instrument set , surgical instrument trolly , blood gluco test stripes , iol lense 22 no , iol lense 21.50 no , iol lense 23 no , gentamicin inj , dexona inj. , cap. amoxycillin 500 mg , tab. ranitidine 150 mg , tab. dicyclogin ( h ) , tab. calcium d3 , tab. misoprost 200 mg , syp. multivitamin 100 ml , inj. dilona , inj. oxytoxin , betadine ointment , cord clamp ( apex ) , surgical gloves 6.5 , d syringe 5 ml , d syringe 2 ml , inj. ceftrizone + salbactum 1.5 gm , inj. randidine 2 ml , inj. diclofenac sodium 3 ml , inj. ondem 2 ml , tab. amoxicilin + clavunate 625 mg , tab. aceclofenac + pcm+ serratiopeptidase , cap. omeprazole 20 mg , micropore 3 , betadine oint 15 gm , bandage 4 , syringe 10 ml , vicril 1 no. 180 cm with needle , catgut 2 no. , catgut 1 no. , gloves 6.5 no. , gloves 7 no. , folys cathethar 16 no. , urine bag , bp blade 22 no. , inj. ranitidine 3 ml , inj. diclofenac 3 ml , inj. bupicane , inj. perinorm , syringe 5 ml , syringe 3 ml , inj. pantazocin 1 ml , inj. oxytocin 1 ml , intra cath 18 no. , cord clamp ( apex ) , inj. ceftrazone 1 gm , inj. methargin 1 ml , inj. anamine 4 ml , spinal needle 25 no. , edta tube ( double cap ) , sodium fluoride tube ( double cap ) , erba auto wash kit , erba norm kit em 200 , erba multical ( erba path kit code 120221 ) , urine sprip ( 7 parameter ) , erba h 360 lyse , h 360 diluent , microtipes samllest 10 to 100 , anti abo ( arkray ) , widal , erba tsh , blood glucose ( semi autoera ) , blood urea ( semi auto erba ) , uric acid ( semi auto erba ) , alkline ( semi auto erba ) , bilirurin ( semi auto erba ) , crp ( semi auto erba ) , glocose hexokinase ( erba em 200 ) , alkaline ( erba em 200 ) , albumin ( erba em 200 ) , protien ( erba em 200 ) , creatine ( erba em 200 ) , urea ( erba em 200 ) , uric acid ( erba em 200 ) , triglyceride ( erba em 200 ) , hdl ( erba em 200 ) , calcium ( erba em 200 ) , medsource hbsag kit , pop cast 2 inch , pop cast 4 inch , pop cast 6 inch , pop cast 8 inch , soft roll for ortho cases 2 inch , soft roll for ortho cases 4 inch , soft roll for ortho cases 6 inch , soft roll for ortho cases 8 inch , inj. piptaj 4.5 g , inj. rantac , trulon 1 no , trulon 2 0 , mersilk 1 no , dynaplast...

Health Department - Jharkhand

37458029 rate contract for supply of medicine , 0.5% bupivacain (heavy) , 1% gama benzene hexachloride lotion , 3% nacl 100 ml , 3% phenyl (5 litre) , 3.8% sodium citrate solution 500 ml , 5% lysole , abo & rh(anti ab&d) arkary10 ml each pkt. , abo & rh(anti ab&d) tulip10 ml each pkt. , absorbent bandage than 18 m x 90 cm special , absorbent cotton i.p 400gm/roll ( net weight) , absorbent gauze than 18 m x 90 cm special , acyclovir ointment , adenosine , airway 01234 , ambu bag adult , ambu bag pediatric , analgesic cream(30 mg tube) , anteseptic soap 75 gm , anti a1(lactin) serum 5 ml per pc. , anti ab sera arkray 10 ml per pc. , antifungal skin cream 20 gm , antihuman globulin serum 10 ml per pc. , antiseptic liquid 500ml , apron white cloth medium size per pc. , aso latex (span) (100 pcs) , asthalin respules , auto clave electric vertical (pressure &temprature display ) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , b.p. machine (mercury) diamonde per pc. , baby cap , baby dress , baby socks , baby tag , baby towel , barium chlorine 500 ml , bendicts solution 500 ml , betadine ointment , betamethasone dipropionate cream , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blleching powder 25kg bag , blood bag350 ml hl per pc. , blood bag 100 ml hl per pc. , blood bag tube sealer per pc. , blood collection monitor per pc. , botroclot 10ml per pc , bovine albumin 22% (10 ml) per pc. , bt set , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 22 no , cannula 24 no , cannula 26 no , cap. amoxycilline (250 mg) + cloxacilline (250mg) , cap. amoxycilline (250mg) , cap. amoxycilline (500mg) , cap. ampicilline 500mg , cap. cefalamine (250 mg) , cap. cephalamine (500 mg) , cap. cephalexin 250 mg , cap. cephalexine (250 mg) , cap. cephalexine (500mg) , cap. cholicalciferol 2000iu , cap. cholicalciferol 30000iu , cap. cloxacillin 250 mg , cap. cloxacillin 500mg , cap. depin (10 mg) , cap. depin (5 mg) , cap. doxycycline (100 mg) , cap. griseofulvin 250mg , cap. omeprazole (10mg) , cap. omeprazole (20mg) , cap. vitamin a 200000 iu , capillary tube , carbolic acid (500 gm) , chloramphenicol eye ointment , chlorhexidine , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , ciprofloxacine eye / ear drop 10ml , cleansole , clindamycin gel 30 gm , clobetasol fusidic acid cream , clotrimazole ear drops , clotrimazole ointment 30 gm , colorimeter per pc. , copper sulphate crystal 500 gm per pc. , cord clamp , cotton roll 400gm nett , cotton thread , cover slip (100 pcs) , cpr (latex) (20 pcs) , crape bandage 4 , creatinine(creast) (35 pcs) , crepe bandage 6 , crescent blade disposable , crp chemical , cuvet (for colorimeter) per pc. , dextrose 25% (100 ml) , diclofenac gel (30 gm) , dicyclomine hydrochloride + activated semithicone drop 10 ml , digital thermometer , diltiazem , disposable delivery kit for delivery of hiv patient , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1lt , distilled water 5lt per pc. , donepezil , double caps edta tube per pc. , drabkins reagent 500 ml per pc. , duolin respules , ec (700 ml) (agrawal) , ecg jelly , ecg roll , edta powder 25gm per pc. , edta vial per pc. , elisa reader per pc. , elisa washer per pc. , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , eye drop chloramphenicol 5ml 0.50% (5 ml) , eye drop occumox – p (moxifloxacin + prednesolone) (5 ml) , eye drop ofloxacin + dexamethasone , eye drop, flurbiprofen plus (5 ml) , eye drop, ofloxacin / moxifloxacin (5 ml) , eye drop, tropicacyl plus (5 ml) , falcun tube , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , fradiomycin cream 15 gm , fusidic acid cream , g.v. paint lotion 400ml , galamantine , gentamicin dexamethasone ear drops , glacial acetic acid (500 ml) , glass rod per pc. , glass slide (50 pcs) per packet , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer (ozocheck) , glucometer strip , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hand sanitizer 100 ml , hand sanitizer 5 lt , hand sanitizer 500 ml , hand wash liquid form 80ml , handiplast per pc. , handiplast roundper pc. , hbsagelisa 96 per pkt , hbsagrapid card aspen per pc. , hbsag card rapid hepaview per pc. , hcvelisa 96 per pkt , hcv rapid card aspen per pc , hcv rapid card flaviscreenper pc. , heavy duty gloves , hemasyl 500 ml , hiv elisa 96 per pkt. , hiv rapid card aspen per pc. , hiv rapid card qualpro per pc. , inj anti d , inj pcm 2ml , inj pentazocine 30mg , inj pipracilin tazobactum 1.125 gm , inj pipracilin tazobactum 4.5 gm , inj remdesivir 100mg/20ml , inj sevoflurane , inj vancomycin 250 mg , inj. a.r.v. (anti rabies) multi dose , inj. a.r.v. (anti rabies) single dose , inj. adrenaline ampl , inj. amikacin (250mg) vial , inj. amikacin (500mg) vial , inj. amikacine (100mg) , inj. amino phylline ampl , inj. ampicilin 250mg vial , inj. ampicilin 75 mg vial , inj. ampicillin500mg vial , inj. anafortan 2ml , inj. anamin , inj. anaspas , inj. anawin heavy , inj. anawin plain , inj. anti snake venus serum , inj. antitetanus human immunoglobulin , inj. arteether 2ml 50mg , inj. artesunate 1ml 60 mg , inj. atropin (ampoule)ampl , inj. avil ampl , inj. b complex amp , inj. botropase , inj. butodol , inj. caffeine , inj. calcium gluconate amp , inj. cefoperazone (1 gm.) with watervial , inj. cefotaxime with water(1 gram) , inj. cefotaxime with water(125 mg) , inj. cefotaxime with water(500 mg) , inj. ceftriaxone + salbatum with water (1.5 gram) , inj. ceftriaxone 250mg with water vial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone inj 1gram with watervial , inj. chlorpheniramine , inj. chromostat amp , inj. citicholine , inj. compose 2ml , inj. deriphylin , inj. dexamethasonevial , inj. dexamethasone sodium phosphate 2ml/4mg , inj. diazepam (5 mg)2ml , inj. diclofenac aqua (1 ml) , inj. diclofenacc sodium 2ml ampl , inj. dicyclomine ampl , inj. dicyclomine hydrochloride 10 mg 2ml , inj. dilantin sodium100 mg , inj. dizepam , inj. dobutamine , inj. dopamine ampl , inj. drotaverine , inj. e mal , inj. efcorlin 50mg , inj. endpoprost inj , inj. enoxaparin , inj. epitrate , inj. etophylline + theophylline 220mg (169.4+50.6 mg) , inj. fluconazole 100ml , inj. fortwin ampl , inj. furosemide 2ml , inj. fusemide vial , inj. gardinal , inj. gentamicin 10 mg , inj. gentamicin 40 mg , inj. gentamycine 20 mg. vial , inj. gentamycine 80 mg. vial , inj. glycopyrrolate , inj. haloperidol 5mg , inj. hydro cortisone , inj. hydrocort 100mg , inj. hynidase , inj. hyprosol 5ml , inj. i.v. ciprofloxacine , inj. immunoglobin ampl , inj. insulin primixed (30/70) , inj. iron sucrose , inj. kcl , inj. ketamin (2ml) ampl , inj. ketamin inj. (10ml vail) , inj. ketorolac (1 ml) , inj. k nate (phytomenadione) 1ml , inj. labatalol , inj. lasix ampl , inj. levipil , inj. levitiracetam , inj. lignocaine adrenaline , inj. lorazepam 2mg , inj. magnesium sulphate ampl , inj. megazid xp , inj. mephentermine , inj. meropenam 1gm , inj. meropenam 250 mg , inj. meropenem 125 mg , inj. methergin , inj. methyl ergometrine ampl , inj. metochlopramide ampl , inj. metoclopramide 10mg , inj. midazolam , inj. moxifloxacin , inj. multivitamin ampl , inj. nacphin 10 mg , inj. naloxone , inj. neostigmine ampl , inj. netromycin 10 mg , inj. netromycin 25 mg , inj. norad 2mg , inj. ondansetron ( 4 mg) , inj. ondansetron ( 8 mg) , inj. ondem 2mg , inj. ondem 4mg , inj. ondensetron ampl , inj. oxytocin ampl , inj. pam , inj. pantoprazole with watervial(40 mg ) , inj. perinorm ampl , inj. phenargan ampl , inj. phenobarbitone , inj. phenraminemaleate ampl , inj. phenytoinampl , inj. pilocarpine , inj. promethazine 25mg , inj. promethazine 50mg , inj. propofol , inj. prostadin , inj. ranitidine ampl , inj. sensrocain (30 ml) vial , inj. sodium bicarbonate ampl , inj. sodium chloride ampl , inj. termin , inj. tetvac ampl. , inj. tetvac vial , inj. theophyillin + ethophyillin ampl , inj. thiamine , inj. thiopentane 0.5gm/1gm , inj. tramadol ampl/vial , inj. tranexa , inj. vitamin k1 1 mg/0.5 ml (phytonadione) , inj. xylocaine 2% (plain) , inj. xylocard 2 % , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , intravenous paracetamol , iodine test kit , iron drop , isolyte p (500ml) , itraconazole cream , iv ciprofloxacine(100 ml) , iv mannitol (100ml) , iv mannitol (300ml) , iv metronidazole (100 ml) , keratome 2.8mm disposable , khan test tube rack , khantest tubeper pc. , lam/i gel 01234 , lancet (200 pcs) per pkt. , leclyete m(100 ml) , leclyete p(100ml) , leishmans stain (500 ml) , lence paper , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , levipil syrup , lidfast jelly , loperamide , lotion. benzyl benzoate (1000 ml) , lox 2%with adrenaline , luglos iodine solution (100 ml) , luliconazole cream , lysol 500ml , m.c. lotion400ml , m.p pf/pv card antigen abbott per pc. , m.p pf/pv card antigen per pc. , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , marker pen for pulse polio , memantine , mersilk (1 0) , mersilk (1 no) , mersilk (1 no) , mersilk (2 0) , mersilk(8 0) , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , miconazole ointment 10gm , miconazole ointment 30gm , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micro tips per 1000 pc. , micropore 1 inch , micropore 1/2 , micropore 2 , morphine , moxifloxacin eye drop , mucus sucker , multivitamin drop , n/10 hydrochloric acid , n/2 , n/4 , nasal normal saline drop (10 ml) , nasal prongs (neonats) (cannula) , neaomycineoint , neaomycinepowder , nebulizer set , needle curved , needle destroyer (electrical) , needle straight , neomycin (5 mg + 500 iu / g) 15gm , neospsrin powder 100gm , new born diaper , nitroglycerin , noscapine drop1.83 mg/ml , noscapine linct7mg/5ml , ofloxacin + dexamethasone ear drops , ors , ors adult 21 24 gm pack , ors( pedartic pack) , oxygen mask adult , oxygen mask child , oxygen regulator with flow meter , para hit arkray total per pc. , paraffin mesh , parafin liquid 1000 ml , pedia set , permethrin lotion 5% , phenyl 5 litre , phenylephrine , pilocarpine drop , pippet stand per pc. , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial per pc. , plasma volume expendore 500 ml , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , plastic sputum container with sticker , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , potasium per magnate , pottasium permagnate (400gm) , povidone iodine lotion 500ml , prednisolone drops 0.1% , prednisolone drops 1% , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pumping ball / smile ball , pyrethrum extract 2% , pyronate , r.p.r card aspen per pc. , r.p.r strip aspen per pc. , ra latex( span) (20 kits) , rapidor , rbc diluting fluid , refrigerator digital thermameter per pc. , rhyles tube16 no. , rivastigmine , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , salbutamol inhaler , saline d.n.s. (500ml) , saline dextrose 10%(500ml) , saline dextrose 5%(500ml) , saline ns(500ml) , saline rl (500ml) , saline set , sanitary napkin pad , shoe cover disposable , side port disposable , silver sulfadiazine 1% cream 100gm , silver sulfadiazine 1% cream 20gm , silver sulfadiazine 1% cream 500gm , silverex ointmet (burning) (20gm) , silverex ointmet (burning) (500gm) , slide dying rack , sodium calcium hypochloride (5 litre) , sodium hypochlorite solution per 5 lt. , soframycin cream , sofratulle mesh , specimen collection bottle , spinal needle 25 g , spirit (methylated) 1000ml , spirit 100 ml , spirit 1000 ml , sprit lamp , stritching thread , stylet , suction catheter , suction tube6fr , suction tube 8 fr , sulphar powder 100 gm , surgeon cap , susp amoxyclav 228 mg/5ml , susp levosalbutamol ambroxol , susp. albendazole 400mg 10ml , susp. amoxycilline 60ml , susp. antacid 170 ml , susp. antacid 200 ml , susp. azithromycin (200 mg ) 30 ml , susp. bromhexine hydrochloride 4mg/5ml , susp. calciumcarbonate +vitamin d3 calcium 250 mg+vit d3 125 iu/5 ml , susp. cefixime 50mg 30ml , susp. cephalexin 125ml/30ml , susp. cetrizine 30ml , susp. co trimoxazole (trimethoprim 40mg+ sulphamethoxazole 200mg) 100 ml , susp. co trimoxazole 50ml , susp. cough syrup adult 100 ml , susp. cough syrup child60 ml , susp. dexchlorpheniramine maleate 0.5 mg / 5ml , susp. digene , susp. domperidone (30ml) , susp. ibuprofen 100mg/5ml , susp. iron folic acid 200ml , susp. levitiracetam , susp. levocetrizine , susp. methadone , susp. metronidazole 30ml , susp. montelukast , susp. ofloxacin + metronidazole 30 ml , susp. paracetamol 125mg 60ml , susp. pheniramine maleate 15 mg/5ml , susp. phenobarbitone , susp. salbutamol sulphate 100ml , susp. vitamin a 100000 iu/ml , swab , syringe 50ml , syusp. clobazam , t bact ointment , tabmidazolam 500 mg , tab acetazolamide 250 mg , tab favipiravir 200mg , tab favipiravir 400mg , tab midazolam 250mg , tab multi vitamin , tab. aceclofenac (100 mg) , tab. aceclofenac + paracetamol , tab. acetyl salicylic acid 300mg , tab. aciloc, 150mg. , tab. albendazole (400 mg) , tab. alprazolam 0.25 mg , tab. aluminium hydroxide+ magnesium hydroxide 400mg , tab. amitriptyline 25 mg , tab. amlodipine (10mg) , tab. amlodipine (5mg) , tab. amoxy 250 mg dt , tab. amoxycilline + clavulanic acid(325 mg) , tab. amoxycilline + clavulanic acid(625 mg) , tab. anaspas , tab. antacid , tab. anti cold , tab. artesunate 100mg , tab. artesunate 200 mg , tab. artesunate 25 mg , tab. artesunate 50 mg , tab. ascorbic acid 500 mg , tab. atenolol (50mg) , tab. avil (chalpheniramin( 25 mg) , tab. azithromycine250 mg , tab. azithromycine 500mg , tab. bisacodyl5mg , tab. buprenorphine , tab. calcium carbonate 500mg , tab. calcium d3 500mg. , tab. carbamazepine 200mg , tab. carbamezapine 25 mg , tab. cefadroxyl 250mg , tab. cefadroxyl 500mg , tab. cefixime (100mg) , tab. cefixime (200 mg) , tab. cefixime (50 mg) , tab. cefuroxime axetil250mg , tab. cefuroxime axetil500 mg , tab. cephalexin 500 mg , tab. cepodoxime proxetil , tab. cetrizine 10mg. , tab. chloroquine 300mg , tab. chloroquine phosphate 150 mg , tab. chromostat , tab. cipro 500mg + tz 600mg , tab. ciprofloxacin hydrochloride 250mg , tab. ciprofloxacin hydrochloride 500mg , tab. ciprofloxacine (250mg) , tab. ciprofloxacine (500 mg) , tab. clobazam , tab. clomipramine 25mg , tab. clonazepam 0.5 mg , tab. compose , tab. co trimoxazole (trimethoprim 80mg + sulphamethoxazole 400mg) , tab. co trimoxazole ds , tab. co trimoxazole ss , tab. deriphylline 150 mg , tab. deriphylline 300 mg , tab. diamox 250 mg , tab. diazepam (2 mg) , tab. diazepam (5 mg) , tab. diclofenac sodium 100 mg , tab. diclofenac sodium 50 mg , tab. diclofenac sodium 75 mg , tab. dicolofenae sodium (50mg) , tab. dicolofenc + paracetamol , tab. dicyclomine , tab. dicyclomine + paracetamol , tab. dicyclomine hydrochloride 10 mg , tab. diethylcarbamazine citrate 100 mg , tab. dilantoin sodium ( 100 mg) , tab. domperidon (10mg) , tab. domperidone 10mg , tab. doxycycline (100 mg) , tab. drotaverine ( 40 mg) , tab. ecospirin (75 mg) , tab. erythromoycin250 mg , tab. escitalopram 10 mg , tab. escitalopram 5 mg , tab. etophylline + theophylline 100 mg (77+23 mg) , tab. etophylline + theophylline 150 mg sr , tab. etophylline + theophylline 300 mg sr , tab. famotidine(40 mg) , tab. famotidine 20 mg. , tab. fluconazole 150 mg. , tab. fluoxetine 20 mg , tab. folic acid 5mg , tab. folic acid large , tab. furosemide 40mg , tab. glibenclamide 5mg , tab. glimepride ( 2 mg) , tab. glyceryl trinitrate 0.5 mg , tab. griseofulvin 250mg , tab. haloperidol 5mg , tab. hydrochlorothiazide 12.5 mg , tab. hydrochlorothiazide 25 mg , tab. ibuprofen 200mg , tab. ibuprofen 400mg , tab. ibuprofen 400mg + paracetamole 325mg , tab. imipramine25mg , tab. ketrolac ( 50 mg) , tab. labetalol 100mg , tab. lanoxin0.25mg , tab. lasix 40 mg , tab. levitiracetam , tab. levocetrizine 5mg , tab. levofloxacin (500mg) , tab. levofloxacine 250mg , tab. lithium carbonate 300mg , tab. lorazepam 2mg , tab. losartan potassium 50mg. , tab. metformin(500 mg) sr , tab. methyl prednisolone 4mg , tab. methyl prednisolone 8mg , tab. metoclopramide 10mg , tab. metronidazole (200mg) , tab. metronidazole (400mg) , tab. mifepristone 200mg , tab. misoprostol 200?g , tab. naltrex1one , tab. nefedipine 20 mg , tab. nitrocontin (2.6 mg) , tab. norfloxacin 400 mg+ tinidazole 600 mg , tab. ofloxacin100mg. , tab. ofloxacin 200mg , tab. ofloxacin 200mg + ornidazole (500mg) , tab. ofloxacin 400mg , tab. olanzapine 10mg , tab. olanzapine 5 mg , tab. olanzapine 7.5 mg , tab. ondansetron ( 4 mg) , tab. ondansetron ( 8 mg) , tab. ornidazole 500mg , tab. p.c.m. d.t.( 250 mg) , tab. p.c.m. d.t.( 500 mg) , tab. p.c.m. d.t.( 600 mg) , tab. pantoprazole 40mg , tab. paracetamol (500mg) , tab. paracetamol (650mg) , tab. pheniramine maleate 25mg , tab. pheniramine maleate 50mg , tab. phenytoin sodium 100 mg , tab. primaquine 2.5mg , tab. primaquine 7.5mg , tab. ranitidine (150mg) , tab. risperidone 2mg , tab. risperidone 4mg , tab. roxythromycine 150mg , tab. roxythromycine 300mg , tab. salbutamol 4mg , tab. sodium valproate 200mg , tab. sodium valproate 500mg , tab. sorbitrate ( 5 mg) , tab. stemetil m.d , tab. telmisarten ( 20 mg) , tab. telmisarten ( 40 mg) , tab. terbinaffine 250mg , tab. thiamine , tab. tinidazole 500mg , tab. tramadol , tab. tranaxaemic acid + mefenamic acid , tab. tranexamic acid 250 mg , tab. tranexamic acid 500 mg , tab. trihexyphenidyl 2mg , tab. vitamin b complex , tab. voglibose ( 2mg) , tab. voglibose ( 3mg) , tab. wysolone 10mg , tab. wysolone 20 mg , tab. wysolone 5 mg , tab. zinc sulfate 20mg , tab. zinc sulphate ( 20 mg) , tab. zolpidem 10mg , tab.resperidone 1 mg , tab.resperidone 2 mg , tab.resperidone 4 mg , tarpin oil 1000 ml , temophos 25 ltr , test tube holding clamp , test tube rack , thermameter body per pc. , thiopentone , thrombophob ointment , tissue paper roll per pc. , tourniquet , trece ostomy tube set , tripane blue (blue day , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , urinometer with measuring cylinder per pc. , uro bag , vdrl (strip) per pc. , vicryl(1 0) with needle , vicryl1no 140 cm with needle , vicryl1no 45 cm with needle , vicryl1no 70 cm with needle , vicryl1no 90 cm with needle , vicryl1no with needle , vicryl (2 0) with needle , vitamin d drop , water for injection 5ml , wax ear drop , wbc diluting fluid , weight machine per pc. , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , xylocain jelly 5% , xylocaine jelly2% , xylometazoline nasal drop adult , yellow tips for micropipette , zipper pouch...

Health Department - Jharkhand

36578739 supply of medicine surgical equipment acetazolamide tablet 250 mg, acriflavin+glycerin, albendazole 400 mg tab, amiodarone tablet 100 mg, amoxicillin capsule 250 mg, ascorbic acid tablet , cefixime tablet, cefazolin powder for injection 500 mg, cefotaxime powder for inj 250 mg with diluant, ceftriaxone powder for injection 2gm with diluant, clarithromycin tablet 250 mg, cetrizine 10mg tab, dexamethasone tab 0.5 mg, digoxin ip 0.25 mg tab, sodium bicarbonate inj as per ip, bandage than, chromic catgut, cord clamp, cotton roll, depin, cut cutting needle10 no, crp kit, ecg jelly, etda vial, hcg kit, hiv kit, glass pipette,inj. anaforten, inj. avil, inj. haemaccel 500ml, inj. ketamine, inj. perinorm, intracath 24 g, iv set, lancet, plain vail, r a factor kit, rena plus, s.creatinine, sodium citrate 3.8%(esr), spinal needil 24 no., syring pump, tab anafortan, tab maftal, tab metoclopramide, et tube, oxygen mask, n95 mask, p.p.e. kit, face shield, gloves loose, stabil gloves 7, stetho scope, face shield, asthalin nebulizer, duolin, etc....

Health Medical Education And Family Welfare Department - Jharkhand

36338798 bids are invited for rehabilitation and life saving equipment multiparameter cardiac monitor , combination therapy tens ms , alpha bed air bed , urinal pot , electrical suction apparatus , bed side screen , bed side locker , bed pan , intubation kit , ift with russian current , parallel walking bars , biomedical collection setup 4 bin system , chairs , almirah , tv , foot step , walker arm support , bed side spitting bowl , wheel chair self , uro bag , rayels tube , hydro collator packs , standing frame physiotherapy , slipper , oxygen mask , air conditioner one point five ton branded total quantity : 110...

Health Medical Education And Family Welfare Department - Jharkhand

36115030 bids are invited for rehabilitation and life saving equipment multiparameter cardiac monitor , combination therapy tens ms , alpha bed air bed , urinal pot , electrical suction apparatus , bed side screen , bed side locker , bed pan , intubation kit , ift with russian current , parallel walking bars , biomedical collection setup 4 bin system , chairs , almirah , tv , foot step , walker arm support , bed side spitting bowl , wheel chair self , uro bag , rayels tube , hydro collator packs , standing frame physiotherapy , slipper , oxygen mask , air conditioner one point five ton branded total quantity : 110...

Health Department - Jharkhand

35419239 rate contract for supply of medicine and other consumables at sadar hospital khunti , items : , aceclofenac + paracetamol , albendazole , albendazole , amikacin , amikacin , amikacin , amlodipine , amoxicillin+clavulanic acid , amoxicillin+clavulanic acid (tab) , amoxicillin+cloxacillin , amoxycillin , amoxycillin , amoxycillin , amoxycillin , amoxycillin+ clavulanic acid , amoxycillin 250 + cloxacillin 250 , ampicillin , antisnake venom , arteether , artesunate , atenolol , atenolol , azithromycin , azithromycin , azithromycin , betamethasone , calcium with d3 , cefixime , cefixime , cefixime , cefixime , cefotaxime , cefotaxime , cefotaxime , cefotaxime , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone+salbactum , ceftriaxone+salbactum , cetrizine , cetrizine , chloroquine phosphate , chloroquine phosphate , chlorpheniramine maleate , chlorpheniramine maleate , ciprofloxacin , ciprofloxacin , ciprofloxacin +tinidazole , ciprofloxacin eye/ear drops , ciprofloxacin hcl , co trimoxazole , co trimoxazole ds , co trimoxazole pead. , co trimoxazole ss , cough expectorant , cough suppressant , dexamethasone , dextrose 25% , diazepam , diazepam , diclofenac , diclofenac , diclofenac , dicyclomine hcl , dicyclomine hcl , dicyclomine hcl+paracetamol , diethylcarbamazine citrate , domperidon , domperidon , doxycycline , enalapril maleate 5 mg , ethamsylate , ethamsylate , fluconazole , folic acid , framycetin hydrochloride , frusamide , gamma benzene hexachloride , gentamicin , gentamicin ear/eye drop , ibuprofen , ibuprofen , ibuprofen , iron , iron folic acid (large) , iron folic acid (small) , iron folic acid (syrup) , levocetrizine , levocetrizine , lysol , mafloquin , magnesium sulphate , mefenamic acid , metformin , methyl ergometrine , metoclopramide , metoclopramide , metoclopramide , metronidazole , metronidazole , metronidazole , metronidazole , misoprostol , multivitamins , norfloxacin + tinidazole , normal saline , ofloxacin , ofloxacin , ofloxacin (eye/ear drop) , ofloxacin+ ornidazole , ofloxacin+ ornidazole , ondansetron , ondansetron , ondansetron , oral rehydration salts , pantoprazole , paracetamol , paracetamol , paracetamol , paracetamol , paracetamol , pentazocine , povidone iodine , povidone iodine , prednlsolone , primaquine , primaquine , primaquine , promethazine , rabeprazole , rabeprazole + domperidon dsr , rabeprazole hydrocholoride , rabies vaccine (arv) , rabies vaccine (arv) , ranitidine , ranitidine , ringer lactate , salbutamol , savlon , sulfadoxine +pyrimethamine , syrup. b complex 100 ml , tramadol hcl , tramadol hcl , tranexamic acid , tranexamic acid , vitamin b complex (for prophylactic use only) , zinc sulphate , zinc sulphate , 10% dextrose , 10% dextrose + 0.9% sodium chloride inj. , 5% dextrose , 5% dextrose + 0.9% sodium chloride inj. , abgel , aceclofenac + paracetamol + sersiopetidose , acetyl salicylic acid (aspirin) , activated charcoal , adhesive tape , adhesive tape , adrenaline bitartrate , airway , alprazolam , alprazolam , ambubag with zero size , amino acid solution , aminophilineinj. , aminophylline , amlodipine 2.5 mg , amlodipine 5 mg , anti scorpion venom , anti allergical cough suppresent 60 ml , anti d immunoglobulin (human) , anti d immunoglobulin (human) , anti imunoglobin 1 gm , antitetanus human immunoglobin , antitetanus human immunoglobin , antifungal cream , atropine sulphate , b.p. blade assorted size , b.t. set , bandage , bandage , bandage , bandage than , bandaid , bleaching powder , brown paper bag (large size) , budesonide respiratory suspension 1 mg (for inhalation only) , bupivacaine hcl (for spinal anaesthesia) heavy , butorphanol tartrate , calcium 2x150 ml , calcium gluconate , carboprost250mg , care free extralarge/ safe care extra large, total length of sanitary napkin 538 mm (+/ ) , catgut , catgut , catgut , catgut , catgut chromic , catgut chromic , catgut chromic , ceasirian kit , cell counting machine (manually) , chloramphenicol 1% eye applicacaps , chlorinated lime water (ec lotion) , clotrimazole + gentamycin + beclometasone ointment , compound sodiume lactate iv 500 ml , cord calmp , cotton (absorbent) , cotton (absorbent) , cotton thread no. 1, 3, 4 , crepe bandage 4 , crepe bandage 6 , cretinnine kit(35 test) , disposable delivery kit (ddk kit) , disposable surgical head cap , disposalmask triple layer (without nose pin) , dobutamine , dopamine hcl , dropper 3ml plastic , drotaverine , e c lotion , e.d.t.a vail 2 ml.(100 pc) , ear drop (neomycin + beclometasone + clotrimazole + lidocaine) , ecg gel 250ml , ecg gel 5 kg jar , edta 100 vial , emergency obstetric care drug kit , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , esr stand 6 tube capacity , esr tube (all size) , etophylline +theophylline , etophylline +theophylline , eye drops ciprofloxacin , eye drops ciprofloxacin d , eye drops oflaxacian , eye drops oflaxacian d , eye drops moxifloxacin , ear drops candibiotic , face shield , filtter paper 9 ca (100 pc) , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , frusemide tab. , gauze than , gauze than , gentian violet , glass slide (per box) 50 pcs , gloves (nitrile) sterile , gloves (non sterlite isi) large size , gloves (non sterlite isi) medium size , gloves (sterlite isi) , gloves (sterlite isi) , gloves (sterlite isi) , gloves (sterlite isi) , glucose (1x9x50ml) , glucose antigen (2x200 ml) , glucose kit good/pod (4x250) test , glucose powder 1 kg jar , glucose powder 1/2 kg jar , glycopyrrorlate , gypsona (readymade plaster of paris roll) , gypsona (readymade plaster of paris roll) , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hydrochlorothiazide , hydrocortisone sodium succinate , hydrogen peroxide , hydrogen peroxide , i.v. set , immerssion oil (bottle) , infusion set with hypodermic needle 21g 1.5 , inj. betamethasone4mg/ml , inj. efcorlin , inj. mephentine , inj. noradrenaline , inj. pam , inj. piperacillin + tazobactam 4.5 gm , inj. piperacillin + tazobactam 1.5 gm , inj. reteplase , inj. sodibicarb 10 amp , inj. tenectaplase , inj. vitamin k (phytomenadione) , inj. vitamin k 3 (menadione) , inj.plasama substitude 500ml bottle , inracath/safety canula , inracath/safety canula , inracath/safety canula , inracath/safety canula , inracath/safety canula , insulin injection (soluble) , iron drop , iron sucrose , isolyte (m,g,p) , itroconazole capsule 200 mg , itroconazole capsule 100 mg , iv catheter (jelco) 25 no , ketamine hydrochloride , labetalol 100 mg , lancet (200 pcs) , large microtips (1000 pc) , lead apron , lecopore 3 , lignocaine hydrochloride , lignocaine hydrochloride , lignocaine hydrochloride+adrenaline , lotion. benzyl benzoate (100ml) , lubricant eye drop , luliconazole cream , luliconazole cream , lysol (cresol with soap) , lysol (cresol with soap) , mannitol , mask n 95 , mask n95 (respirator) , medical abortion kit (mifepristone misoprostol) , mersilk (1 no) , mersilk (2 no) , mersilk 0.3 , mersilk 2.0, 1.0 cutting needle , mersilk 2.0, 1.0, 0.5 cuttingneedle , methyl dopa 250 mg , methyl ergometrine , micro scalp veinset , micro tips blue (1000 pcs) , micro tips yellow (1000 pcs) , mma drugs kit , mother & child name tag wrist band , moxifloxacin eye drop , mtp tray , mucus sucker , multivitamin drop , mva kit , n/2 dns , n/g tube 5,6 no , nasal normal saline drop , nasal prongs (neonatal) , neaomycineoint , neaomycinepowder , nebuliser solution (salbutamol,ipratopium bromide) , needle curve, streght , needle curve cutting & round body , needle straight , new born diaper , new born baby kit (containt of baby sheet, towel, cap, t shirt, diaper) , nifedipine 10 mg , nifedipine 5 mg , nitroglycerin , d 9 % , nsv kit , ofloxacin + dexamethasone ear drops , oint. silver sulphadizine 20gm , oint. silver sulphadizine 500gm , ot cap , oxygen mask adult , oxygen mask set (complete set) , oxytocin , peadiaset , pheniramine maleate , phenobarbitone , phenobarbitone , phenobarbitone inj. 2 ml , phentoin inj. 2 ml , phenyl 5 liter jar , phenytoin sodium , phenytoin sodium , plain catgut 1no , plain vial , plasma volume expendore 500 ml , plastic appron , pop bandage 4 inch , pop bandage 6 inch , potassium chloride , potassium chloride , potassium chloride solution , povidine iodine ointment 5gm , povidine iodine solution 50 ml , pralidoxine chloride (pam) , prednisolone , prednisolone , priking needle len set , rabies immunoglobulin , rabies immunoglobulin , ready made adhesive , ready made adhesive traction kit bothfor adult and child , ready made adhesive traction kit adult , ready made adhesive traction kit child , rhyles tube16 no. , roll bandage 4 , roll bandage 6 , rubber turniquite , ryles tube assorted size , s.g.p.t kit(25 ml) , s0076 sanitary towels , safe flight 8x10 , salbutamol inhaler , salbutamol sulphate , salbutamol sulphate , salbutamol sulphate , sanetary pad (best quality) big , sanetary pad extra large/ safe care extra large (sanitary napkins with adjustable loop emds, made by non woven febric 2 pulp for absorbency and three side leak proff, total length of sanitary napkin 538 mm (+/ )) , sanetary pad extra large/ safe care extra large (with belt 10 s pack) , sanitizer 100 ml bottle , sanitizer 200 ml bottle , sanitizer 5 ltr jar , sanitizer 50 ml bottle , saving blade , savlon 50 ml , scalpvain set , scalven set 24 no. , 20 no. , shoe cover , shoe covers. (disposable) , silk thread (make j&j) , silver sulphadiazine , skeltal traction kit , slide (100 pc) , small microtips (1000 pc) , sodium bicarbonate , sodium chloride iv inj sodium chloride i.p 0.9% w 1 v 500 ml folic bottle , sodium citrate 3.8% (500 ml) , sodium hypochloride , sodium hypochlorite 1% , sodium hypochlorite solution , sodium metabisulfate 500 gm , sofratulle mesh , spinal needle , spinal needle , spinal needle , spinal needle , spirit 100 ml , spirit 400ml , sterile water for inj. i.p 5 ml , surgical paper tape , surgical paper tape , surgical paper tape , surgical paper tape , surgical paper tape , surgical spirit 500 ml , syringe 50ml , syringe disposable 1cc , syringe disposable 2cc , syringe disposable 3cc , syringe disposable 5cc , syringe disposable 10cc , syringe disposable 20cc , syringe disposable 50cc , syrp. azithromycin 15 ml/600mg , syrp. azithromycin 200 mg/15ml , tab. azithromycin 100mg , tab. chromostat , tab. clopidogrel 75 mg , tab. dicolofenae potassium (50mg) , tab. dicolofenae sodium (50mg) , tab. ecosprine 150 mg , tab. glimepride ( 2 mg) , tab. glimepride 5 mg , tab. glimipride 1mg , tab. glimipride 2mg , tab. ivermectin 4mg , tab. labetalol 100mg , tab. levocetrizine 5mg + montelukast 10mg , tab. p.c.m. d.t.( 250 mg) , tab. pentoprazole , tab. telmisartan 10 mg , tab. telmisarten ( 20 mg) , tab. telmisarten ( 40 mg) , tab. tranaxaemic acid + mefenamic acid , tab. vitamin b complex , tab. voglibose ( 2mg) , tab. voglibose ( 3mg) , tab.ascorbic acid , tab.losartan potassium 25mg. , tab.losartan potassium 50mg. , tarpin oil (50 ml) , teicoplanin , teicoplanin , terbinaforce plus 250 mg , test tube 12x75 mm , test tube 3/4 inch (100 pcs) , test tube rack , testube brush , tetanus toxoid , themometer (body) , thiopentene 500 mg , thrombophob ointment (20 gm) , tips (100 1000ul) , tissue paper , total protien , traction kit both for adult and child , tri sodium citrate 3.8% (500 ml) , triglyecide desgpopap25 ml , triglyeerides kit 2x150 ml , triple dye lotion , triple layer mask (with nose pin) , twin bore nasal oxygen set (with 2 mtr. long multichannel kink resistant tube) adult , twin bore nasal oxygen set (with 2 mtr. long multichannel kink resistant tube) pediatric , umbilical cathether (100 pc) , urea bun urease gldh (20x5) , urea dam mannual kit (125 ml) , urea kit 300 ml , uric acid kit (20x2 ml) , uric acid kit (5x20 ml) , urine pot , urine strip (100 test) , urinometer with measuring cylinder , urobag , v.d.r.l (shippils test strip one step) , v.d.r.l. (shippils test strip one step) , vicril no. 1 , vicryl 910 both side needle no. 1 , vitamin d drop , w.b.c. diluting fluid 500 ml , water for injection , wax ear drop , widal antigen slide methed (4x5ml) , widal koit span 4x5 ml , x ray film 10x12 (green) , x ray film 12x12 (green) , x ray film 12x15 (green) , x ray film 8x10(green) , xylometazoline nasal drop adult...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

33200402 supply of surgical items for rims, ranchi. supply of surgical items for rims, ranchi. , surgical item , asorable gelatin sponge (abgel) , adhesive plaster 10m*7.5cm(lecoplast) , air way , artherial sheth , arificial kidney , aumbu bag adlut & child & neonatal , b.p blade all size , b.p machine digital , b.t set , bain circuit , bandage than , bone wax , c.v.c triple lumen kit , cabg kit , cardiac ballon , care stream dr film size 10*12 , care stream dr film size 14*17 , care stream dr film size 08*10 , certiofix deo central lin adult , certiofix deo central lin child , chatheter mount , cotton , cr film sdp10*12 , cr film sdp08*10 , crape bandage 4 , crape bandage 6 , disposable cap , disposable gown , disposable needle , disposable syringe 10 ml , disposable syringe 20 ml , disposable syringe 2ml , disposable syringe 3 ml , disposable syringe 50 ml , disposable syringe 5 ml , dry view films ct/mri (14*17) , dynaplast , ecg electrode , ecg jelly (tube) , ecg paper , endothraheal tube (e.t) , epidural kit , ethilon 2 0© , ethilon 3 0© , extention tube 3 way stop cock , foley cathether all size , fuj dry laser film 10*12 , fuj dry laser film 08*10 , gauze than , gluco strip , gluco meter machine , high concentration mask , hiv protection kit , hme filter , i.v cannula (ad) , i.v cannula 24 , i.v cannula 26 , i.v cannla fixtor , i.v set , infant feeding tuube , infant feeding tuube , intestinal 1 , intestinal 1 0 , intestinal 2 0 , intestinal 3 0 , intra kit , laryangoscope , liga clip 100 , liga clip 200 , liga clip 300 , liga clip 400 , liner cutter , manifold 2 port , mersilk 1 (c.) , mersilk 1 0(c.) , mersilk 1 0® , mersilk 2 0 (c.) , mersilk 2 0(rb.) , mersilk 3 0 (c.) , mersilk 3 0(rb) , mesh size 7*15 , micropore tape , mini vax set , monocryle 3 0 , mucus extractor set , n 95 mask , nasal prong set (oxy set) , nebilizer t pice , nebulizer machine , nebulizer mask , niv mask , oxygen mask , pds 1 , pds 3 0 , pds 4 0 , pds 5 0 , pds 6 0 , pediadrip set , pediatric circuit , plain sheet , powder free gloves , prolene 1 c , prolane 1 0 c , prolene 2 0 c , prolene 3 0 c , prolene 3 0 r , prolene 4 0 c , prolene 4 0 r , prolene 5 0 c , prolene 5 0 r , prolene 6 0 c , prolene 6 0 r , prolene 7 0 c , prolene 7 0 r , reloaded for lin ar cutter , romo adk , romo vac set , rubber sheet(makintosh sheet) , ryles tube , shoe cover , skin stepler , skin spapler remover , spinal needle , stethoscope , suction catheter plain , suction catheter thumb control , surgical musk surgigel 4*8 , surgicel 4*3 , surgicel 4*8 , surgicel fibrillar 2*4 , surgicel nu knit 3*4 , thermameter , three way stocp cock , tracheostomy tube , tuberculin syringe 1 ml , ultrasound jelly , urine collecting bag , urin collecting bag with meter (urometer) , v.p shunt , vaccum suction set , ventilator circuit , ventury mask adult , vicryl 1 r , vicryl 1 0 r , vicryl 2 0 r , vicryl 3 0 r , vicryl 4 0 r , vicryl 5 0 r , y connector kit...

Department Of Health - Jharkhand

32975489 rate contract for medicine rate contract for medicine , items : , tab. paracetamol ( 250 mg ) , tab. azithromycin ( 250 mg ) , tab. fluconazole ( 150 mg ) , tab. losartan potassium ( 50 mg ) , tab. ofloxacin ( 100 mg ) , tab. ofloxacin ( 200 mg ) , tab. ofloxacin + ornidazole , tab. calcium carbonate ( 500 mg ) &vitamin d3 , tab. clopidogrel ( 75 mg ) , tab. atorvastatin ( 10 mg ) , tab. erythromycin estolate ( 500 mg ) , tab. metformin ( 500 mg ) , tab. calcium & vit d3 250 mg ( each ) , tab. ciprofloxacin ( 250 mg. ) , tab. domperidone ( 10 mg. ) , tab. paracetamol ( 500 mg ) , tab. prednlsolone ( 5 mg ) , tab. prednlsolone ( 10 mg ) , tab. prednlsolone ( 20 mg ) , tab. azithromycin ( 500 mg ) , tab. famotidine ( 20 mg ) , tab. ibuprofen ( 200 mg ) , tab. ibuprofen ( 400 mg ) , tab. metronidazole ( 200 mg ) , tab. metronidazole ( 400 mg ) , tab. multivitamins ( as per schedule v of drugs and cosmetics rules ) ( 1 tab ) , tab. ciprofaloxacin ip + tinidazole ( 500 mg.+600 mg ) , tab. ciprofloxacin ( 500 mg. ) , tab. co trimoxazole ds ( 160 mg.+800 mg. ) , tab. co trimoxazole ss ( 80 mg.+400 mg. ) , tab. norfloxacin ip + tinidazole ( 400 mg+600 mg. ) , tab. cetirzine ( 10 mg ) , tab. nimesulide + paracitamole ( 100mg+325mg ) , tab. accelofenace+ para ( 100 mg + 325 mg ) , tab. ibuprofen ip+ paracetamol ip ( 400 mg.+325 mg ) , tab. ranitidine ( 150 mg. ) , tab. amoxycillin+ clavulanic acid ( 500+125 mg ) , tab. amoxycillin+ clavulanic acid ( 250+125 mg ) , tab .paracetamol + diclofenac sodium ( 325 mg.+50 mg ) , tab. dicyclomine hydrocloride.+ paracetamol ( 20 mg.+325 mg. ) , tab. misoprostal ( 200 gm ) , tab. salbutamol ( 4 mg ) , tab. folic acid 400 microgram , tab. norfloxacin 400 mg , tab. enalapril maleate 5 mg , tab. phenoxymethylpenicillin potassium 250 mg , tab. zinc sulphate 50 mg , tab. chloroquine 150 mg , tab. albendazole ( 400 mg ) , tab. amlodipine ( 5 mg ) , tab. cephalexin ( 500 mg. ) , tab. ondansetron ( 4 mg ) , tab. tinidazole 600mg , tab. allopurinol 100 mg , tab. rabiprazole 20+ domperidome 10 mg , tab. cefexime 200 mg , tab. doxycycline 100 mg , tab. vitamin c 500 mg , tab. paracetamol ( 650 mg ) , cap. amoxicillin ( 250 mg ) , cap. amoxicillin ( 500 mg ) , cap. tramadol 100 mg , cap. omeprazole ( 20 mg ) , cap. iron folic acid , cap. iron , cap. amoxy 250 + cloxy 250 , cap ampi 250 + cloxy 250 , cap. ampicillin 500 mg , cap tramadole 50 mg , syrup domperidom ( 30 ml ) , syrup ofloxacin ( 30 ml ) , syrup salbutamol sulphate ( 100 ml ) , syrup metoclopramide ( 5mg / 30ml ) , syrup. b complex 100 ml ( each ) , syrup paracetamol ip 125 mg ( 60 ml ) , syrup. cough supressent ( dextromethorphan based ) dextromethorphan hyd, chlophenical maleate&phenylephrine hyd ( 60ml ) , syrup. cough supressent dextromethorphan hyd, chlophenical maleate&phenylephrine hyd. ( 100ml ) , syrup. diphenhydramine hydrochloride ammounium chloride sodium citrate &menthol100 ml , syrup. cotrimoxazole ( 50 ml ) , syrup. amoxicillin 125 mg / 30 ml , syrup. nimesulide + para 60 ml , syrup potassium chloride solution , syrup. azithromycin 200 mg / 15ml , syrup. chlorphenatamin + dhenylephrione 60 ml , syrup. anti allergical cough suppresent 60 ml , syrup. metronidazole 60ml , syrup multivitamin , syrup ondemsetron , syrup hemfer , syrup. carbamazepine , syrup promethazine 60 ml , syrup. norbin power 30ml , syrup. zinc sulphate 100 ml , syrup. erythromycin 60 ml , syrup. ibuprofen 60 ml 100 mg , syrup. ibuprofen & paracetamol 60 ml , syrup do 60ml. , syrup carbamazepinesyrup , syrup. vitamin a 100ml , syrup promethazine 30ml , syrup. glyceryl trinitrate , syrup cetrizine ( 30 ml ) , syrup. carbamazepine , scabe lotion 100 ml , drop flurabifrofen eye5 ml , drop tropicamide with phenylephrine ( eye drop ) , drop homid ( eye drop ) , drop nephafenac ( eye drop ) , drop paracain ( eye drop ) , drop paracetamol 15 ml , drop ondenstron , drop cough 15 ml , drop multivitamin 15 ml , drop oflox oz 30 ml , drop azithromycin 100 mg susp. 30 ml , drop enzyme 15 ml , drop enzyme 100 ml , drop amoxicillin 10 ml , drop cefexime oral susp. 30 ml , drop domperidone , drop butrodol , drop moxifloxcin eye ( 5ml ) , drop lubricant eye ( 5 ml ) , drop. amoxycillin & potassium clavulanate oral 30ml , drop. cefpodoxime proxetil oral 30ml , drop dicyclomine , drop gentamycin eye / ear , drop ciprofloxacin eye ( 5ml ) , drop gentamycin ear ( 5ml ) , drop suspension albendazole ( 200 mg / 15 ml ) , drop suspension albendazole ( 100 mg / 15 ml ) , drop vitamin d3 15 ml , lens power number 21 to 24.5 ( each any number ) , sachet bifilac 0.5 gm , inj. ranitidine ( 25 mg / 2ml ) , inj. amlkacin ( 250 mg / 2 ml ) , inj. gentamicin ( 40 mg / ml ) , inj. ceftriaxone ( 1 gm ) with water , inj. ceftriaxone ( 125 mg. / 5 ml ) with water , inj. ceftriaxone ( 250 mg. ) with water , inj. ceftriaxone ( 500 mg. ) with water , inj. tramadol ( 50 mg ) , inj. gentamicin ( 80 mg / ml ) , inj. paracetamol 10 ml , inj. metoclopramide5mg , inj. amikacin ( 500 mg ) , inj. diclofenac ( 25 mg / 1ml ) , inj. ondansetron ( 4mg ) , inj. dicyclomine ( 10 mg ) , inj. human rabies immunoglobulin ( 300 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 250 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 500 iu ) , inj. human tetanus immunoglobulin ( 1000 iu ) , inj. hepatitis b immunoglobulin ( 200iu / 1ml ) notavl , inj. hepatitis b immunoglobulin ( 100iu / 1ml ) , inj. anti imnuoglobin 250 mg , inj. anti imnuoglobin 1 gm , inj. pentazosin ( amp ) , inj. equine rabies immunoglobulin ( 1500 iu / 5 ml ) , inj. ampicillin 500 mg , inj. ampicillin 250 mg , inj. benzathine penicillin ( 6 lakh units ) 450 mg , inj. benzathine penicillin ( 12 lakh units ) , inj. anti rabies vaccine with 5 syringe ( multi dose intra dermal 1 ml ) , inj. dexamethasone 4 mg , inj. oxytocin 2 ml , inj. anti rabies vaccine withsyringe ( single dose intra muscular 0.5 ml ) , inj. desferal , inj. effcorlin , inj. cefotexime 125 mg , inj. cefotexime 250 mg , inj. amikacin 100 mg , inj. aminofylin 10 ml , inj. meropenum 1000 mg , inj. meropenum 500 mg , inj. meropenum 125 mg , inj. nikethamide each , inj. pipracillin 4000mg + tazobactom 500mg , inj. phenobarbiton , inj. phenytoin 100 mg , inj. caffirate , inj. livipil , inj. doubutamine , inj. xylocain 2% with adrinaline 30ml , inj. efipres each , inj ampicillin 125mg , inj.chromostate , inj. medazolam , inj. propofol 10 ml , inj. phenargan , inj. fentanyle , inj. kcl , inj. heaparin , inj. pethedin , inj. glycopyrolet , inj. butrodol 1 ml , inj. butrodol 2 ml , inj. suceinyle cholene , inj. calmpose , inj. noloxone , inj. butorphanal , inj. vecurouium , inj. adrenaline , inj. lignocaine hydrochloride& adrenaline 30ml vials , inj. triamcinolone acetonide 31ml , inj. defrioxamine 500 mg , inj. calcium gluconateiv 1gm , inj. aminophyline each , inj. mephentine , inj. spasmocare , inj. ketamin 10 mg , inj. streptomycin injection 0.750 grm , inj. streptomycin injection 0.500 grm , inj. streptomycin injection 1.000 grm , inj. capreomycin 01 grm , inj. cepromycin 750 mg , inj. kanamycine 01 grm , inj. kanamycine 500 mg , inj. hydrocortsione 100mg , inj. anawin ( 5% ) 30 ml , inj. insulin 40 units / 10 ml , inj. insulin zinc suspension 40 unit / 10 ml , inj. betamethasone4mg / ml , inj. furosemide 10 mg / ml , inj. diazepam5 mg , inj. etophyllin + theophylline ( deriphyllin ) , inj. cloxacillin 250 mg , inj. prostodine , inj. hydrocortisone 100mg , inj. drotaverin2 ml , inj. atropine 0.6 mg , inj. tranexamic acid , inj. vitamin k ( phytomenadione ) , inj. vitamin k 3 ( menadione ) , inj. xylocain 2%30ml , inj. xylocain 5%30ml , inj. phenylphrine ( 1ml ) , inj. camolol , inj. methergin , inj. sodium chloride ivi.p 0.9% w 1 v 500 ml , inj. aminophiline , inj. prostaglandin 205 mg , inj. prostadine each , inj. pipracillin + tazobactum 4.5 gm , inj. donperidone , inj ondacetron 2ml , inj. azithromycin 500 mg , inj augmentin 1.2 gm , inj paracetamol 1 gm , inj mvi , inj dobutamine , inj lasix , inj termin , inj nitroglycerine , inj esmolol , inj amzodarone 300 mg , inj. anti snake venum , inj. hydrocortisone sucoinate 100mg , inj. promethazine 25 mg / 2 ml , inj. magsulph magnisium sulphate i.p 50% , inj. oxytocin inj. , inj. phenytoin sodium 2 ml , inj. sodium bicarbonat iv 7.5% 10 ml , inj. sodibicarb 10 ml amp ( 7.5% ) , inj. anti d300 mg , inj. labetalol 100 mg , inj. labetalol 50 mg , inj. potassium chloride , inj. prostaglandin 205 mg , inj. dopamine 200 mg 10 ml , inj. betamethasone sodium phosphate , inj. plasma volume expender 500 ml bottle , inj. bupivaccine 0.5% 20 ml , inj. ropin 0.75% ( ropivacain ) ( neon ) , inj. dexmedine 100 ug , inj. atacurium ( atracurium ) , inj. anemol ( paracetamol 1 gm 100 ml ) , inj. midfast ( misazolam ) , inj. iflurane ( isoflrane ) 100 ml , inj. avil each , inj. hydrocortisone succinate ( efcorlin ) each , inj. dopamine each , inj. calcium sandoz each , inj. neostigmine each , inj. iron sukroj amp each , inj. ondacetron 2ml , inj. azithromycin 500 mg , inj. pentoprazole , ini. streptomycin injection 0.500 gram ( per vials ) , inj augementine 1.2gm , inj atracurium , inj noradrenaline , inj. digoxin , inj. insulin regular , inj. insulin intermediate , inj. aminophylline , inj. benzathine benzyl penicillin , inj. lignocaine hydrochloride , inj. streptokinase 7.5 lac vial , inj. streptokinase 15 lac vial , inj.mixed human insulin 30 / 70 , inj. mixed human insulin 50 / 50 , inj. penidure la6, la 12 , inj. pantaprazole 40mg , inj. hepatitis b immunoglobulin 100 iu / 0.5ml. , inj. heaparin 25000iu , inj. heparin sod 5000 iu , inj. heparin sod 10000 iu , inj. heparin sod 1000 iu , inj. hynidase , inj atracurium 2.5ml. , inj. diazepam , inj. promethazine , inj. promethazine , inj.glyceryl trinitrate , inj. tetvac vial 5ml , inj. tetvac vial 1ml , inj. rabis immunoglobin 1500 iu , inj. methylcobalamin , nicotinamind, pyridoxine hcl&d panthenol.2ml , inj. hydroxyprogesterone caproate 250 mg , inj. hydroxyprogesterone caproate 500 mg , inj. amikacine 100mg , ors powder ( 21.8 gm. pkt. ) , 2% xylocain jelly 30 gm , luliconazole cream 10gm , luliconazole lotion 15gm , diclofenac spry , ketokonazole soap , enteroglemina , oint. povidine iodine oint15 gm , oint. clotrimazole 15 gm , cream. clobetasol propionate, neomycin sulphate&miconazole nitrate , oint. clotrimazole + gentamycin + beclometasone ointment 15gm , oint. silverex ( 250 gm ) jar , drops. ciprofloxacine & betamethasone sodium phasphate e / e , drops. gentamicin & betamethasone sodium phasphate e / e , drops. ofloxacine & betamethasone sodium phasphate e / e , drops. moxifloxacine & dexamethasone sodium phasphate e / e , gamma benzene hexachhloride &cetrimide lotion 100ml , oint. clotrimezole oint. 15 gm , tab.glyceryl trinitrate , tab.alprazolam 0.25 mg , tab.alprazolam 0.50 mg , tab.cephalexine 250 mg , tab.drotavarin , tab.defrijet 250 ( each uncoted tab. for oral suspension contains deferarirox 250 mg ) , tab.defrijet 500 ( deferasirox 500 mg ) , tab.darcolex 500 mg , tab.digoxin 0.5 mg , tab. metoprolol 25 xl mg , tab. metoprolol 50 xl mg , tab. aspirin 75mg , tab. hydrochlorthiazide 12.5 mg , tab. hydrochlorthiazide 25 mg , tab. enalapril 2.5 mg , tab. enalapril 5 mg , tab. captopril , tab. clopidogrel , tab. isosorbidedinitrate ( sorbitrate ) , tab. glyceryl trinitrat , tab. verapamil ( isoptin ) , tab. potasium ip ( pencylin v ) , tab. carbamazepine , hiv rti / sti kit kit 1 grey a ) tab. azithromycin 1 gm tab. b ) tab. cefixime 400gm. 1 tab. , hiv rti / sti kit kit 2 green a ) tab. secnidazole 1 gm 2 tabs. b ) tab. fluconazole 150 mg1 tab. , hiv rti / sti kit ( kit 3 white a ) inj. benzathine penicillin 2.4 mu 1 no. b ) tab azithromycin 1gm. 1 tab. c ) sterile disposable syringe 10ml.21 g needle 1 no. d ) sterile water 10 ml. 1 no. ) , hiv rti / sti kit kit 4 blue a ) cap. doxyccline 100 mg. 30 caps. b ) tab. azithromycin 1gm. 1 no. , hiv rti / sti kit kit 5 red a ) tab. acyclovir 400 mg. 21 tab. , hiv rti / sti kit kit 6 yellow a ) tab. cefixime 400 mg 1 tab b ) tab metronidazole 400 mg. 28 tabs c ) cap. doxycycline 100 mg 2 tab , hiv rti / sti kit kit 7 black a ) cap. doxycycline 100mg 42 caps b ) tab. azithromycin 1 gm 1 no. , tab. azithromycin 100mg , tab. atenol 100 mg , tab. glimepride 5 mg , tab. premaquine 2.5 mg , tab. misoprostol 200 mg , tab. isoniazid 100 mg. , tab. isoniazid 300 mg. , tab. pyridoxine 100 mg , tab. pyrazinamide 750 mg , tab. pyridoxine 50 mg , tab. pyridoxine 25 mg. , mma drugs for safe abortion services ( in combi pack 1 tab mifepristone 200 mg and 2 tab misoprostol 200 mcg each tab ) , respule salbutamol + iprapropiun , respule budenocide , tab. methyldopa 250 mg , tab. pan 40 ( pantotrazole ) , tab. methyl dopa each , tab linezolid 600 mg , tab amlodeepine at , tab deriphyllin 50 mg , tab dexamethasone , tab enzyme , tab hcqs 200 mg , tab hcqs 400 mg , tab wysolone 10 mg , tab. glimepride 1 mg , tab. chlroquine 250 mg , tab. premaquine 7.5 mg , tab. erythromycin 250 mg , tab. trimethoprim 80mg & sulphamethoxazole 400 mg ( adults ) , tab. atenolol ( 25 mg ) , tab. atenolol ( 50 mg ) , tab. cefexime 100 mg , tab. pentoprazole 40mg , tab. favi piravir , tab. ivermectin , tab. asprin ( 75 mg ) , tab. captopril 2.5 mg , tab. methyldopa 500 mg , tab.atorvastatin 10 mg , tab. digoxin , tab. potasium ip ( penicillin v ) , tab. nifedipine 5 mg , tab. nifedipine 10 mg , tab.folic acid , tab. carbamazepine , tab prednisolone , tab promethazine , tab atenolol 25 , tab. metoprolol 25 , tab methyldopa 250 mg , tab. frusemide 40 mg , tab. issorbide dinitrate ( sorbitrate ) 10 mg , tab. issorbide dinitrate ( sorbitrate ) 5 mg , tab pioglitazone ( 15mg ) , tab. vildagliptin ( 50 ) , tab b complex , tab. methylcobalamine 1500 &alpha lupic acid &pyridoxine&folic acid , tab. telmisatan 40 mg , tab. escitelopam 5 mg , tab. pantaprazole ( 400 ) , tab. pantaprazole + domeperidone , tab. ondacetron ( ondem ) , tab atorvastatin 10 mg+ecosprin 75 ( combined ) , tab. epselin ( 100 mg ) . , tab. amlodipine2.5 mg, , tab. amlodipine 5mg , tab. amlodipine 10mg , tab ondencetron 4 mg , tab. nifedipine ( 5mg ) , tab. telmisartan 20 mg , tab. telmisartan 40 mg , tab metron 500mg , caps promethazine , cap hydroxyurea 500 mg , cap. rifampicin 150 mg , cap. rifabutine 150 mg , cap. clofazimine 100 mg. , cap. ampicillin 250 mg , cap depin 5 mg , cap depin 10 mg , cap chloramphenicol eye ointment 250 mg , cap vitamin bcomplex , cap. clofazimine 100mg , formalin500ml , oxygen nesal set paed , oxygen nesal set adult , oxygen nesal set ( neonetal ) , oxygen hood , corogated drain disposable , corogated drain rubber , vac set ( closewoundsuction ) size size 14 18 , adk set ( abdominal drain ) size 20 32 , cautery pencil , cotery pad disposable , pmo line ( 100 / 150 / 200 cm ) , 3 way line connector , senitizer 5 liter jar , pedia set 110 ml , pedia mask 0, 1 , feeding tube no. 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 , foleys catheter no. 14, 16 , ryles tube adult no. 6, 8, 10, 12, 14, 16, 18 , permethrin lotion 30 ml , plain catheter no. 10 , plain rubber urinary catheter each , hernia kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , mva / eva for safe aboration sevice kit , ec lotion 100 ml , crepe bandage 4x 4mtr , crepe bandage 6x 4mtr , french chalk powder 1 kg , viscoelastic hypersole , bitadin hand scrab , sprit 1 ltr. , soft cotton 4x 3mtr , soft cotton 6x 3mtr , roller bandege 2”x 3mtr , roller bandege 3”x 3mtr , roller bandage 4x 3mtr , roller bandage 6x 3mtr , gypsona 6x 2.7mtr , gypsona 4x 2.7mtr , leucoplastroll 4 x 6mtr , leucoplast roll 2x 6mtr , bandage than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , needle 26g , needle 24g , vicryl no:1 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no:1 0 ( 1 / 2 rc , 90 cm lenth ) , vicryl no. 2 0 curved round body needle ( 90 cm lenth ) , vicryl no. 3 0 curved round body needle ( 90 cm lenth ) , vicryl no. 4 0 curved round body needle ( 90 cm lenth ) , vicryl no. 6 0 curved round body needle ( 90 cm lenth ) , vicryl no:1 0 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no: 1 ( 40 mm1 / 2 rb tc 180 cm double needle ) , chromic catgut no:1 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:1 0 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:2 ( 45 mm1 / 2 rb, 100 cm lenth ) , chromic catgut no: 2 0 ( 30 mm 1 / 2 rb 76 cm lenth ) , prolene 1 0 curved round body , prolene 2 0 curved round body , prolene 3 0 curved round body , prolene 3 0 curved cutting needle , pds 5 0 curved round body , pds 6 0 curved round body , ethilon 3 0 curved cutting needle , ethilon 4 0 curved cutting needle , silk thred 3 0 curved round body , silk thred 4 0 curved round body , suture 10.0 , cresent knife 2.5 mm , keratome knife 2.8 mm , respirometer ( 3 ball ) disposable , prolene mesh size 6 x 11 cm , prolene mesh size 8 x 15 cm , prolene mesh size15 x 15 cm , trimmer ( per pcs ) , deshnet 1 ltr. jar , bt set ( sigle chamber ) disposable , tamophose 50 ec ( 5 ltr. jar ) , distil water 7.4 5 ltr. jar , perineal sheet , sodium metabisulfate 500 gm , gentian violet 500 ml , glass slide ( per box ) 100 pcs , saving blade , ecg gel 1 kg , usg gel 1 kg , ab gel , sticking plaster ( surgical tape ) 2.5 cm x 9.10 m , cotton thred no. 10 , surgical uncals utility gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves ( non sterile ) all size ( no. 6.5, 7, 7.5 ) pair , gloves ( nitrile ) all size ( 100 pc / 50 pair ) , shoe covers. ( disposable ) , service gloves 400 mm , mask surgical 3 lyer ( with nose clip ) , mask surgical 3 lyer ( without nose clip ) , n95 mask ( with nose clip ) , n95 mask ( without nose clip ) , mask cotton cloth , duoline repsules , umbilical cathether ( 100 pc ) , nenaton cathether no. ( 6 to 18 any each no. ) , iv set ( disposable ) , povidine iodine solution ( 500 ml ) 5% , povidine iodine solution ( 100 ml ) 5% , povidine iodine gargile ( 100 ml ) , gouze than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , plaster of paris 5 kg jar , surgical sprit 100 ml , urobag disposable 2000 ml , endotracheal tube 2.5 4.5 plain , endotracheal tube couved5 to 12 , hydrogan pyroxide 100 ml , priking needle len set , sanitizer 500ml litre , i v canula size no: 18, 20 & 22 , i v canula no: 24 , savlon ( 100 ml ) each , band aid , malaria kit , bleaching powder ( 25 kg beg ) , kelleys pad each , blood bag , sodium hypochloride , umbilical cord clamp , suction tube plain size no:6 16 , mersilk 2.0, 1.0 cutting needle 90 cm lenth , n / g tube 5, 6 no. , silk thred ( reel ) no: 0 1, 0 2 , pregency kit , spinal needle no: 23 , 24, 25, 26, 27 , ryles tube infant size all , microdrip set , nosogastric tube no. 6 , spirit ( 100% ) ( per 5 ltrs ) , surgical spirit ( 100% ) 5 ltrs jar , nosogastric tube no. 6 feeding tube , plain rubber urinary catheter , curved cutting needle each , gentian violet 30 ml 0.5% , ecg paper ( schller ) ( per pkt. ) , sodium hypo chloride ( 5 ltr jar ) , disposable syring 1 ml , disposable syring 2 ml , disposable syring 3 ml , disposable syring 5 ml , disposable syring10 ml , disposable syringe 20 ml , disposable syringe 50 ml , insuline syringe 40 u , cotton400 gm , micropore 2x9mtr , mucus exatractor , bp blade all size , lysol 400 ml , oxygen mask set ( complete set ) , infusion set with hypodermic needle 21g 1.5 , disposable delivery kit ( ddk kit ) ( content of the kit2 pair of glove blade 1 pc carbolic soap 1 cord clamp 1 plastic sheets 2x2 mtr. ) , intera kit, size 18 / 20 / 22 ( infusion therapy kit ) iv canulla 1 pc, canulla fixatar 1pc, syringe 5 ml 1pc, sterile alcohol swab 1pc, infusion set 1 pc , micro scalp veinset no. 26 ( buterfly ) , formalin ( 5 ltr. jar ) , plain rubber urinary catheter each , mosquito repellent each , curved cutting needle each , cidex 5 ltr. jar , nsv kit , casete with inensifying screen 12x15 ( konica ) , casete with inensifying screen 12x12 ( konica ) , casete with inensifying screen 12x10 ( konica ) , casete with inensifying screen 8x10 ( konica ) , developing tank ( 13.5 ltr. ) , appendectomy bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , developer13.5 ltr , fixture13.5 kg , chest stand flour model , safe flight 8x10 , clip big , half flim bloker 12x15 , half flim bloker 12x12 , half flim bloker 12x10 , half flim bloker 8x10 , x ray film 8x10 ( blue ) ( 50 pc pkt. ) , x ray film 10x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x15 ( blue ) ( 50 pc pkt. ) , cr x ray film 8x10 ( 125 sheet ) make konika , crx ray film 10x12 ( 125 sheet ) make konika , dve x ray film 8x10 ( 125 sheet ) make carestream , dve x ray film 10x12 ( 125 sheet ) make carestream , halothen i.p 0.01%ww , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , ambubag with zero size ( infant ) , triple dye lotion , lead apron , inj. metronidazole iv 100 ml , iv amninovein 10% ( 500 ml ) , iv dextrose 10% 500 ml , iv dextrose 25% 100 ml , iv isolyte p 500 ml , iv n / 4 ns 500 ml , iv dns 0.45% , iv dns 10% , iv dns ( 500 ml ) , iv ns ( 500 ml ) , iv 5% dextrose ( 500 ml ) , iv rl 500 ml , iv rl glass 500 ml , inj. ciprofloxacine iv 100 ml , inj. mannitol 20% 300 ml , hydrocele operation kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalne , cold box with ice pack 6 ltr , cvc catheter uno4, 5, 6 fr lenth 15 / 16, 20 cm , cvc catheter duo7 fr lenth 15 / 16, 20 cm , cvc catheter trio 7 fr lenth 15 / 16, 20 cm , cvc catheter trio 5 fr lenth8 cm , epidural minipacksize no: 16 g, 18g , av fistula needle size no: 15g, 16g, 17g , av fistula needle size no: 15g, 16g, 17g pair , three way stop cock with extention 10, 25, 50 cm , heamodilysis kitdouble size :12fr x13 cm , heamodilysis kittriplesize :12fr x13 cm , sample cup , allicote ( bullete tube ) , liga clip lt 300 , liga clip lt 400 , tube ciller , refrigertor graph paper , calpol suppository , duphalac suppository , ecg lead neonate , paraffin wax , xylene 5 ltr. jar , 100% absolute alcohol 5 ltr. jar , hematoxylene stain , scotts tap water , eosin tap water , hcl 1% , dpx mount 250 ml , scalpel for hpe , blades for scalpel , water bath ( small ) 2 ltr. , staining jar ( coplin jar ) 250 ml , glycerine ( 500 ml ) , glass marker ) , hmf sachet 1 gm , sodium choride ( nacl ) 500 grmper pkt. ) n / 1o , disodium hydrogen phosphgate ( na2hpo4 ) , 500 gm per pkt. , sodium dihydogen phosphate ( nah2po4, 2h2o ) 500 gm pkt. , anthydrous ( k2 hp04 ) 500 gm pkt. ( potassium phosphate dibasci anhydrous , sponin 1000 gm per pkt. , micropippet 200 1000 ul. , micropippet 5 50 ul. , variant ii control ( for hplc machine ) , variant ii sample ( 100x1.5 ml ) vial ( for hplc machine ) , cal a and cal b ( for electrolyte machine ) ( tulip ) , sodium fluoride vail ( non vacuum ) 2 ml ( 100 pc ) , citrate 3.2% vail ( non vacuum ) ( 100 pc pkt ) , urineanalyzer strip ( 10 para ) ( urit 50 biogeny ) , hi aid ( medicated dressing ) 22 mm diameter , vidas t3 1x60 t ( mini vidas ) , vidas t4 1x60 t ( mini vidas ) , vidas tsh 1x60 t ( mini vidas ) , vidas fsh 1x60 t ( mini vidas ) , vidas lh 1x60 t ( mini vidas ) , prolactin 1x60 t ( mini vidas ) , vit d 1x60 t ( mini vidas ) , d dimer 1x60 t ( mini vidas ) , ns troponin i ( mini vidas ) , covid ig g ( mini vidas ) , covid ig m ( mini vidas ) , p.t. vail 1x100 ( mini vidas ) , urine analyzer print paper roll ( urit 50 biogeny ) , cuvette ( for coagulation analyzer ) ( make sysmex ) , p.t. test kit ( for coagulation analyzer ) ( make sysmex ) , control kit ( for coagulation analyzer ) ( make sysmex ) , p.m. kit elx 640 ( erba ) , caliberator kit ( erba ) ( cbc 5 part ) , elite h clean ( erba ) ( cbc 5 part ) , nutrient agar ( 100 ml bottle ) , mackoney agar ( 100 ml bottle ) , grams iodine 250 ml , suffranine 250 ml , ethyle alchohal 95% 250 ml , crystal voilet 250 ml , antibviotic sensitivity dises, amikacine , antibviotic sensitivity dises, cotrimoxazole , antibviotic sensitivity dises, ciprofloxacin , antibviotic sensitivity dises, gentamycin , antibviotic sensitivity dises, bentamycin , antibviotic sensitivity dises, lomefloxacin , antibviotic sensitivity dises, levofloxacin , antibviotic sensitivity dises, norfloxacin , antibviotic sensitivity dises, ofloxacin , antibviotic sensitivity dises, cephalixin , antibviotic sensitivity dises, tobramycine , antibviotic sensitivity dises, moxifloxacin , antibviotic sensitivity dises, ceftodoxime , antibviotic sensitivity dises, nitrofurantion , antibviotic sensitivity dises, clindamycin , antibviotic sensitivity dises, sefeazidime / clavulanic acid , antibviotic sensitivity dises, cefuroxine , antibviotic sensitivity dises, imipenem , turniquat , syrup phenobarbitone , cutting and round body needle medium size each , ctg paper ( per pkt. ) , carbolic lotion 2% , esr tube disposable , cover slip small ( 100x1 pkt ) , rh view box , vial rack , bovine albumin 20% 100 ml , anti h , immerssion oil ( bottle ) , hemosafe sls 1 ltr , test tube 12x75 mm , test tube rack , triglyeerides kit 2x150 ml , esr tube disposable with cap , tri sodium citrate 3.8% ( 500ml ) , a.b.d. ( 3x10ml ) , micro tips yellow ( 1000 pcs ) , micro tips blue ( 1000 pcs ) , widal antigen slide methed ( 4x5ml ) , urea kit 300 ml , tips ( 100 1000ul ) , petridish , tsh ( 1x96 test ) , t4 ( 1x96 test ) , t3 ( 1x96 test ) , liquiplastin ( 5 ml ) , liquicelin e ( 5 ml ) , calcium chloride ( 5 ml ) , hcv kit ( 50 test ) , amylase ( 50 test ) , lipase ( 50 test ) , recombinant factor viii ( 3rd generation dna origin ) 500 iu , recombinant factor viii ( 3rd generation dna origin ) 1000 iu , lh ( 1x96 test ) , fsh ( reagent ) , uric acid ( 5x20 ml ) , call counting machine , esr stand 6 tube capacity , bleading time test , helix pcd test ( conform to iso 13485 1class 2, 121c / 20 min, 134c / 3.5 min, shelf life 3 years after production, clear transition of pink into brown for steam, easy to interpret, easy to document, non toxic / lead free ) , chemical indicator ( shelf life 3 years after production, packed in an easy dispensing carton, clear colour transition of the emulator, non toxic / lead free ) , documentation labels ( process indicators ( steam ) , for steam 121 c 20 min & 134 c for 3.5 min, conform to iso 11140 1 class 1, clear transition of indicatorinto its end color, easy to use labe gun, double labels serve for an easy traceability and document , blood gas analyser card ( edan ) , blood gas analyser paper roll ( for printer ) , iv albumin 100 ml , hcb card test ( 50 test ) kit , rpr card test kit , whole blood finger prick test for hiv ( card test ) kit , sputum container ( per pcs ) , drop bottle ( per 200 ml ) , filter paper ( per 100 pcs pkts ) , cyrstol phenol ( per 500 gram pack ) , ethanol ( per 500 ml pack ) , liquid praffine ( per 500 ml pack ) , basic fuchin powder ( per 25 gram pack ) , urine strip 2 para meter ( 100 test ) , urine strip 4 para meter ( 100 test ) , urine strip 10 para meter ( 100 test ) , tarpin oil ( 400 ml ) , bt filter ( bacteria filter ) , ferittin estimatiry elisa reagent , dropper 3ml plastic , savlon ( 500 ml ) , optimal test kit for malaria test of pv , anti d 10 ml , anti a 1 lactin , anti a 10 ml , anti b 10 ml , anti ab sera 10 ml , edta ( k3 ) non vaccutenor ( 100 pc pkt. ) , plain vial non vaccutenor ( 100 pc pkt ) , cloride vial non vaccutenor ( 100 pc pkt. ) , rh view box , vdrl ( rpr test 100 ) , blood grouping kit , bovine serum albumin , test tube 3 / 4 inch ( 100 pcs ) , calcium 2x150 ml , w.b.c. diluting fluid 500 ml , test tube rack , widal koit span 4x5 ml , v.d.r.l ( shippils test strip one step ) , r.a. ( 1x50 test ) , s.g.pt kit ( 50 ml ) , uric acid kit ( 5x20 ml ) , triglyecride desgpopap ( 25 ml ) , alkaline phospohate ( 5x15 ml ) , leishman stain solution 500 ml , leishman stain solution 250 ml , sodium citrate 3.8% ( 500 ml ) , r.a. antigen ( 100 test ) , glucose antigen ( 2x200 ml ) , uric acid kit ( 20x2 ml ) , distilled water ( 5 ltr. ) , urea bun urease gldh ( 20x5 ) , urea dam mannual kit ( 125 ml ) , cholestral antiigen / kit ( 75 ml ) , hdl kit 50 ml , sgot 150 ml x 2 , total protien 25 test , albumin 25 test , microprotein kit 25 test , crp test kit 25 test , aso titre kit 25 test , urine pot , tips ( 100 1000ul ) , tissue paper ( each roll ) , cretinnine kit ( 50 test ) , billirubin kit ( 50 test ) , e.d.t.a vail 2 ml. ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction , halothen i.p 0.01%ww , thiopentone sodium 500 , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , triple dye lotion , fulcon tube ( 50ml pot ) , mathylene blue ( 25 gram bottle ) , sulphuric acid conc. ( 500 ml bottle ) , phenol crystal ( 500 gram bottle ) , lense cleaning paper ( 100 pcs packet ) , ethanol ( ethyle alcohal ) 100% ( 500 ml bottle ) , sodium hypo chloride ( 5 ltr jar ) , slide staning trey aluminium , slide staining tray plastic , glass staning rode , drop bottle ( 500 ml ) , spirit lamp glass , water bath , slide stand , stain jsb 1 , stain jsb 2 , temephos 50% ec 1 liter , diflubenzuron 25% wp 1 kg , anixide h , spyrometer , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , sputum container ( 50 ml pot ) , glass slide , fulcon tube ( 50 ml pot ) , mathylene blue ( 25 gram bottle ) , sulphric acid conc. ( 500 ml bottle ) , phenyle liquid ( 40% ) ( 5 ltrs jar ) , phenol crystal ( 500 gram bottle ) , d.m. water ( 5 ltrs. jar ) , lense cleaning paper ( 100 pcs packet ) , filter paper ( 100 pcs per packet ) , tissue paper roll , auramin o ( 25 gram pack ) , ethanol ( ethyle alcohal ) 100% , hydro chloric acid conc. ( 500 ml bottle ) , potassium per manganate ( 500 gram bottle ) , basic fuchin ( 25 gram pack ) , liquid parafin ( 500 ml bottle ) , sodium hypo chlorite ( 5 ltr jar ) , slide staning trey plastic , staning stand , drop bottle ( 125ml. ) plastic , spirit lamp glass / ss 4oz. , forcap ( 6 ) ss disecting , water bath 2 rack capacity electrically operated , slide box ( 50 pc slide boxes ) plastic , slide boxes ( 100 pc slide boxes ) , scissor ( 8 ) ss , parmanent marker pen , funnel keep big ( glass ) sz 4 , funnel keep big ( glass ) sz 6 , slide stand aluminium , diluent for cbc machine 20 ltr , lyse for cbc machine 500ml. , cleaner for cbc machine, 5 ltr , cbc reporting paper ( per roll ) , mouth gag ss , test tube rack plastic 12.5mmx24hole , test tube rack plastic 12.5mm x48 hole , test tube rack plastic 15mmx24 hole , test tube rack plastic 15mmx48hole , test tube rack plastic 18mmx48hole , test tube rack plastic 18mmx24 hole , call counting machine ( manually ) 5 key , bleading time test capilary tube , plain rubber urinary catheter each , stainless steel small galley pot 20 25ml. capacity , ecg paper ( schller ) ( per pkt. ) , hydro chloric acid conc. ( per 500 ml ) , crescent knife ( 2.6 ) , keratome ( 2.8 ) , side port ( 15 ) , trypan blue , iol lense pamma lense , viscoelastic hypersole , enteroglemina , ferittin estimatiry elisa reagent , umbilical cathether ( 100 pc ) , halothen i.p 0.01%ww, 250ml. , coppersulphate crystal for chemical cautery of umbilical stump 500 mg, 500gm , drop gsb ear ( 10ml. ) , stainless steel small galley pot each , ahg ( antihuman globulin ) , 5ml. , rh view box , measuring cylinder ( glass ) 100 ml , measuring cylinder ( glass ) 1000 ml , measuring cylinder ( glass ) 2000 ml , beaker glass ( 250 ml ) , bovine serum albumin 5ml. , blood bag single adult / paeditric , anti h lectin 5ml. , testube brush big size , mersilk 2.0, 1.0 cutting needle , lab wash ( 500ml ) , distilled water ( 5 ltr. ) , urea dam mannual kit ( 125 ml ) , microprotein kit 1x50ml. , tips ( 100 1000ul ) big size , glucose ( 1x9x50ml ) , serum bilirubin kit ( 35 test ) , micropipette fixed volume , micropipette variable volume , large microtips ( 1000 pc ) , small microtips ( 1000 pc ) , tissue paper ( each roll ) , call counting machine ( manually ) 5 key , bleading time test capillary tube , filtter paper 9 cm ( 100 pc ) , cappillary tube ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction 4x60ml. , plain vials ( 100 pc ) , floride vials ( 100 pc ) , floride vials non vaccum ( 100 pc ) , edta kj tube ( 100 pc pkt ) , plain vials 2 ml non vaccum ( 100 pc ) , elisa ( hiv ) 4th genrationkit 1x96test , elisa ( hbsag ) kit ( 1x96 test ) , elisa ( hcv ) kit ( 1x96 test ) , elisa ( malaria ) kit ( 1x96 test ) , rpr latex kit ( 250 test ) , rapid ( hiv ) kit , rapid ( hbsag ) kit , rapid ( hcv ) kit , rapid ( vdrl ) kit, syphillis card test , rapid ( malaria ) kit , anti ab reagent 10 ml , anti ahg reagent 5ml , cupling jar plastic 5 slide cpacity , shalis method hb meter , gel card , ahg ( for cross match ) , gel card grouping ( forward & reverse ) , gelcard machine 8 card with warmer , gelcard machine 24 card with warmer , liss solution , labozent 500ml. , plastic tub , pasteur pipette , apron ( lab coat ) , tube sealer ( portable ) , glucon d 100gm , emergency medicine box , centifuse machine 16 channel r8c model , chemical balance machine , hot air oven , pap smear ( cyto brush +spetula ) , glass slide pkt of 50 , eosin stain yelllow 100 ml , heamotoxilline harris 500ml , isoprofile ( propen 2 ol 500ml , autoclave lable , tournicate valcro , antibiotic disc , culture plate disposable90 mm , culture plate glass 100 mm , maconkey agarv powder 500gm , maconkey agarv powder 100 ml , grams iodine100ml , grams iodine powder , cristel violate100ml , cristel violate powder 25gm , sodium citrate vial ( pt vial ) non vaccum , sodium citrate vaccum , alliequet vial , trop i , trop t , amkitdw plant , pm kitdw plant , phosphorus 10x12 ml , gamma gt 2x44 / 2x11ml , magnesium 2x44ml , uibc 125ml , ldh 2x44 / 2x11ml , serrum iron 125 ml , lipase 1x44 / 1x11ml , amylase5x22ml , ferritin , ferritin calibrator , ferritin control l , ferritin control h , erythromoietin , urine pot 30 ml , petridish 90 mmg ( titan biotech ) , blood agar ( titan biotech ) , maconekey agar ( titan biotech ) , muller hilton agar ( titan biotech ) , urea broth base ( titan biotech ) , distillwater , conical flask 100 ml , conical flask 500 ml , cotton roll , nichrome loop 2 mm with holder , amikacin antibiotic disc ( titan biotech ) , ampicillin antibiotic disc ( titan biotech ) , ampicillin + sulbactam antibiotic disc ( titan biotech ) , cefoxitin antibiotic disc ( titan biotech ) , ceftazidime antibiotic disc ( titan biotech ) , ciprofloxacin antibiotic disc ( titan biotech ) , colistin antibiotic disc ( titan biotech ) , co trimoxazole antibiotic disc ( titan biotech ) , doxycilline antibiotic disc ( titan biotech ) , erythrmycin antibiotic disc ( titan biotech ) , gentamicin antibiotic disc ( titan biotech ) , imipenem antibiotic disc ( titan biotech ) , levofloxacin antibiotic disc ( titan biotech ) , linezolid antibiotic disc ( titan biotech ) , meropenem antibiotic disc ( titan biotech ) , nitrofuran tion antibiotic disc ( titan biotech ) , norfloxazacin antibiotic disc ( titan biotech ) , piperacillin antibiotic disc ( titan biotech ) , polymyxin b antibiotic disc ( titan biotech ) , teicoplanin antibiotic disc ( titan biotech ) , tetracycline antibiotic disc ( titan biotech ) , vancomycin antibiotic disc ( titan biotech ) , cefazolin antibiotic disc ( titan biotech ) , tobramycin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , aztreonan antibiotic disc ( titan biotech ) , cefepime antibiotic disc ( titan biotech ) , cefoperazone antibiotic disc ( titan biotech ) , sparfloxacin antibiotic disc ( titan biotech ) , azithromycin antibiotic disc ( titan biotech ) , ofloxacin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , triple blood bag , double blood bag , quadruple bag , penta bag , apheresis kit , acd solution for apheresis , total protein kit of colorimeter , iodine solution , height measurement scale , observation table , graph paper and pencil, ( remi, model no br 300 ) , graph paper and pencil, ( penpol, model no br 360 ) , graph paper and pencil df ( 300l ) terumo pcnpof , graph paper and pencil pdv 360 ultra re , double pan balance weight ( non digital ) , urinometer , hydrometer , copper sulphate , prothrombin time reagent , fibrinogen reagent , aptt kit , york scientific ( modal ysi 572 ) , digital weight machine ( 150 200 kg ) , measuring cylinder ( 1000 5000ml ) , gal card machine for blood grouping and cross machine , warmer for gel card machine , weighing scale , wall bp instrument , blood collection monitor , portable donor couch of stainless steel with z mattress , rh view box , protable tube sealer battery operated , stripper for blood withdrawal , carry box for blood ( 50 bags ) , carry box for blood ( 100 bags ) , portable o2 cylinder , reagent refrigerator model number ( br360 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , reagent refrigerator model number ( br300 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , blood culture bottles ( a ) gloucose brothe w / 0.5% sps ( blood culture bottle ) ( b ) glucose broth w / 0.5% sps ( blood culture bottle ) ( titan biotech , anaerobic jar ( titan biotech ) , l.j. medium slant ( 10 slants ) ( titan biotech ) , antibiotic discs , nichrome loop 2mm with holder , petridish 90 mm ( titan biotech ) , grams stain kit ( titan biotech ) , nutrient agar ( titan biotech ) , maconkey agar ( titan biotech ) , zn staining kit, zn acid fast stain kit ( titan biotech ) ...

Mecon Limited - Jharkhand

32337130 supply of misc hospital items for ispat hospital mecon ranchi 20 gloves powder 13 i. m. needle disposable ( size 1.5 ) 1 cotton wool 400mg nett ( zig zag ) 21 adhesive plaster 7.5cm x10mtr 5 rolled bandage 2”x5mtrs 6 gauge cloth 18mtrsx90cm 7 i.v. saline set ( disposable & presterilised ) with metallic bottle piecer adult 2 cotton wool 400mg nett 3 rolled bandage 6” x5mtrs 4 rolled bandage 4”x 5mtrs 11 pre sterilised disposable syringe with needle 10 cc 12 pre sterilised disposable syringe with needle 20 cc 8 urine bag –adult 9 pre sterilised disposable syringe with needle 2 cc 10 pre sterilised disposable syringe with needle 5 cc 17 i. m. needle disposable ( size 22 1.5 ) 18 i. m. needle disposable ( size 24 1 ) 19 i. m. needle disposable ( size 24 1.5 ) 14 i. m. needle disposable ( size 21 1 ) 15 i. m. needle disposable ( size 21 1.5 ) 16 i. m. needle disposable ( size 22 1 ) 22 glucostrip42 spinal needle disposable 25g , 3.5” 43 thermometer oral ( oval shape ) 44 thermometer rectal ( akutum shape ) 23 gelco intracath ( two way ) size 18 g 1 / 4 24 gelco intracath ( two way ) size 20 g 1 1 / 4 25 gelco intracath ( two way ) size 22 g 3 / 4 28 scalp vein set size 24 27 scalp vein set size 22 26 gelco intracath ( two way ) size 24 g 1 1 / 4 29 fiber glass casting tape ( combi pack ) 4 30 fiber glass casting tape ( combi pack ) 5 31 surgeon‘s cap ( disposable ) 38 bd vac set size 10 32 b.p. blade size 10 33 b.p. blade size 11 34 b.p. blade size 15 35 b.p. blade size 22 36 stethoscope 37 ecg electrode disposable 39 bd vac set size 12 40 bd vac set size 14 41 bd vac set size 16 45 vaccu suck 46 tourniquet set ( adult ) latex tube 1mtr 47 tourniquet set ( child ) 48 chest drainage with trocar&cannula 49 airway pvc oropharmynegeal adult size 1, 2, 3 & 451 gelco sponge 58 ecg paper for 6208 r 59 ecg paper for 6108 t 50 airway pvc oropharmynegeal child size 0 &1 52 micropore / leukopore 1 / 2 53 micropore / leukopore 1 56 crape bandage 15cmx4 / 6 mtr 57 dynaplast 10cm x 4mtr 54 micropore / leukopore 3 55 crape bandage 10cmx4 / 6 mtr 60 folley ‘ s catheter two way ( balloon 30cm ) presterlised & disposable size 12 61 folley ‘ s catheter two way ( balloon 30cm ) presterlised&disposable size 14 62 folley ‘ s catheter two way ( balloon 30cm ) presterlised & disposable size 16 63 folley ‘ s catheter two way ( balloon 30cm ) presterlised & disposable size 18 64 ryles tube size 12 65 ryles tube size 14 66 ryles tube size 16 67 ryles tube size 18 68 infant feeding tube size 6 69 infant feeding tube size 8 70 infant feeding tube size 10 71 insulin needle disposable 40 iu 72 insulin syringe disposable 1ml 78 suction catether size 16 73 umblical cord clamp disp. 74 suction catether size 8 75 suction catether size 10 76 suction catether size 12 77 suction catether size 1485 dettol liquid 86 disposable skin blade 87 formaldehyde tab 88 formaldehyde soln. 400ml 89 b.p.rubber bulb with valve 91 cuff ( cloth ) for b.p. apparatus 93 vicryl 1 code ( nw2360 ) 94 vicryl 1 0 code ( nw2346 ) 95 vicryl 2 0 code ( nw2317 ) 96 vicryl 3 0 code ( nw2437 ) 97 ethilon 2 0 code ( nw 3336 ) 98 ethilon 10 0 code ( nw 3719 ) 99 mersilk 1 code ( nw5062 ) 100 mersilk 1 0 code ( nw5037 ) 101 mersilk 2 0 code ( nw5036 ) 102 mersilk 3 0 code ( nw5003 ) 103 mersilk 4 0 code ( nw5000 ) 104 intestinal catgut 1 code ( nw4226 ) 105 intestinal catgut 1 0 code ( nw4246 ) 106 prolene 1 code ( nw843 ) 107 prolene 1 / 0 code ( nw846 ) 109 plaster of paris bandage 15cm 110 plaster of paris bandage 10cm 11 eye drape poly d601 112 ecg valve ( rubber ) 113 ecg clip ( fiber ) 114 ecg chest cable wire for 6108t 115 ecg chest cable wire for 6208r 116 ecg gel 250ml 117 u.s.g gel 250ml 79 carbolic acid 400gm 80 lysol 400gm 81 isopropyl rubbing alcohol 70 % v / ( for hospital use ) 82 environment & surface disinfectant by fumigation 1 lit. ( for operation theater ) 83 glutihyde soln. 84 sodalime ( for anaesthetic use ) 90 rubber bag for b.p. 92 cotton buds 108 povidone iodine 7.5% ( 500ml ) 118 pedia drip set 119 micro drip set 120 i.v line set with dial flow meter 121 blood transfusion set ( disposable&presterilised ) 128 tissue paper 148 tongue depressure s.s 149 rebreathing bag 2.0 lit. 150 rebreathing bag 1.0 lit. 151 rebreathing bag 0.5 lit. 152 ambu bag silicon ( adult ) 153 ambu bag silicon ( child ) 154 face mask rubber antistatic size 4 155 face mask rubber antistatic size 5 137 endotrachial tube size 8 138 hydrogen peroxide 400ml 139 mucus succur 132 endotrachial tube size 4 133 endotrachial tubesize 6 134 endotrachial tubesize 6.5 135 endotrachial tubesize 7 136 endotrachial tube size 7.5 122 larengeal mask size 3&4 123 three way canula 140 oxygen flow meter with humidifier 124 keratone 2.8mm 125 lance tip 15 degree 126 lance blade green handle 45 degree 127 crescent knife 2.6mm 129 liq. paraffin 400ml 130 endotrachial tube size 2 131 endotrachial tube size 3 143 oxygen nasal mask ( adult ) 147 venturi mask 144 oxygen nasal mask ( child ) 145 oxygen mask / oxy set ( adult ) 146 oxygen mask / oxy set ( paed ) . 141 nebulizer mask set ( adult ) 142 nebulizer mask set ( paed ) . 148 tongue depressure s.s 149 rebreathing bag 2.0 lit. 150 rebreathing bag 1.0 lit. 151 rebreathing bag 0.5 lit. 152 ambu bag silicon ( adult ) 153 ambu bag silicon ( child ) 154 face mask rubber antistatic size 4 155 face mask rubber antistatic size 5 143 oxygen nasal mask ( adult ) 147 venturi mask 144 oxygen nasal mask ( child ) 145 oxygen mask / oxy set ( adult ) 146 oxygen mask / oxy set ( paed ) .157 vitaliya electro surgical pencil 158 sodium hypochloride solution 159 latex examination gloves 160 eye pad 161 oxygen mox regulator 162 external nasal splint 163 mackintosh sheet rubber 164 merocel for nasal packing ( size 4 ) 175 nitrile gloves 179 aceptic ( hospital concentrate ) 180 ethilon 3 0 code ( nw 3328 ) 183 towel clip 184 spong holder 8 185 needle holder size 6 186 plain scissor size 6 187 curved fine dressing scissor size 7 188 curved fine dressing scissor size 8 189 disecting forcep with tooth size 6 190 plain disecting forcep size 6 191 mosquito forcep size 4 192 artery forcep curved size 6 182 high flow oxygen mask ( child ) 176 biopsy gun with coaxial needle 181 high flow oxygen mask ( adult ) 169 rubber gloves surgical ( electronically tested ) sterile 170 sriuzbe b6er gloves surgical ( electronically tested ) sterile size6.5 171 rubber gloves surgical ( electronically tested ) sterile size 7 172 rubber gloves surgical ( electronically tested ) sterile size 7.5 173 rubber gloves surgical ( electronically tested ) sterile 174 ssiuzreg e8o n mask ( disposable ) 177 plain rubber catheter size 6 to 12 178 sanitizer ( isopropyl alcohol not less than 70 % ) [ 500ml bottle ] 156 e.c. lotion 400ml 165 rubber gloves surgical ( nonsterile ) size 6 166 rubber gloves surgical ( nonsterile ) size6.5 167 rubber gloves surgical ( nonsterile ) size 7 168 rubber gloves surgical ( nonsterile ) size 7.5193 stich cutting scissor 194 mayo scissor size 6 195 mayo scissor size 7 196 tmt chest cable wire 197 silicon suction pipe 198 fluoro touch 199 plastic apron 200 merocel for nasal packing ( size8 ) ...

Health Department - Jharkhand

30557704 rate contract for medicine and other consumables rate contract for medicine and other consumables , items : , aceclofenac + paracetamol , albendazole , albendazole , amikacin , amikacin , amikacin , amlodipine , amoxicillin+clavulanic acid , amoxicillin+clavulanic acid (tab) , amoxicillin+cloxacillin , amoxycillin , amoxycillin , amoxycillin , amoxycillin , amoxycillin+ clavulanic acid , amoxycillin 250 + cloxacillin 250 , ampicillin , antisnake venom , arteether , artesunate , atenolol , atenolol , azithromycin , azithromycin , azithromycin , betamethasone , calcium with d3 , cefixime , cefixime , cefixime , cefixime , cefotaxime , cefotaxime , cefotaxime , cefotaxime , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone+salbactum , ceftriaxone+salbactum , cetrizine , cetrizine , chloroquine phosphate , chloroquine phosphate , chlorpheniramine maleate , chlorpheniramine maleate , ciprofloxacin , ciprofloxacin , ciprofloxacin +tinidazole , ciprofloxacin eye/ear drops , ciprofloxacin hcl , co trimoxazole , co trimoxazole ds , co trimoxazole pead. , co trimoxazole ss , cough expectorant , cough suppressant , dexamethasone , dextrose 25% , diazepam , diazepam , diclofenac , diclofenac , diclofenac , dicyclomine hcl , dicyclomine hcl , dicyclomine hcl+paracetamol , diethylcarbamazine citrate , domperidon , domperidon , doxycycline , enalapril maleate 5 mg , ethamsylate , ethamsylate , fluconazole , folic acid , framycetin hydrochloride , frusamide , gamma benzene hexachloride , gentamicin , gentamicin ear/eye drop , ibuprofen , ibuprofen , ibuprofen , iron , iron folic acid (large) , iron folic acid (small) , iron folic acid (syrup) , levocetrizine , levocetrizine , lysol , mafloquin , magnesium sulphate , mefenamic acid , metformin , methyl ergometrine , metoclopramide , metoclopramide , metoclopramide , metronidazole , metronidazole , metronidazole , metronidazole , misoprostol , multivitamins , norfloxacin + tinidazole , normal saline , ofloxacin , ofloxacin , ofloxacin (eye/ear drop) , ofloxacin+ ornidazole , ofloxacin+ ornidazole , ondansetron , ondansetron , ondansetron , oral rehydration salts , pantoprazole , paracetamol , paracetamol , paracetamol , paracetamol , paracetamol , pentazocine , povidone iodine , povidone iodine , prednlsolone , primaquine , primaquine , primaquine , promethazine , rabeprazole , rabeprazole + domperidon dsr , rabeprazole hydrocholoride , rabies vaccine (arv) , rabies vaccine (arv) , ranitidine , ranitidine , ringer lactate , salbutamol , savlon , sulfadoxine +pyrimethamine , syrup. b complex 100 ml , tramadol hcl , tramadol hcl , tranexamic acid , tranexamic acid , vitamin b complex (for prophylactic use only) , zinc sulphate , zinc sulphate , 10% dextrose , 10% dextrose + 0.9% sodium chloride inj. , 5% dextrose , 5% dextrose + 0.9% sodium chloride inj. , abgel , aceclofenac + paracetamol + sersiopetidose , acetyl salicylic acid (aspirin) , activated charcoal , adhesive tape , adhesive tape , adrenaline bitartrate , airway , alprazolam , alprazolam , ambubag with zero size , amino acid solution , aminophilineinj. , aminophylline , amlodipine 2.5 mg , amlodipine 5 mg , anti scorpion venom , anti allergical cough suppresent 60 ml , anti d immunoglobulin (human) , anti d immunoglobulin (human) , anti imunoglobin 1 gm , antitetanus human immunoglobin , antitetanus human immunoglobin , atropine sulphate , b.p. blade assorted size , b.t. set , bandage , bandage , bandage , bandage than , bandaid , bleaching powder , brown paper bag (large size) , budesonide respiratory suspension 1 mg (for inhalation only) , bupivacaine hcl (for spinal anaesthesia) heavy , butorphanol tartrate , calcium 2x150 ml , calcium gluconate , carboprost250mg , care free extralarge/ safe care extra large, total length of sanitary napkin 538 mm (+/ ) , catgut , catgut , catgut , catgut , catgut chromic , catgut chromic , catgut chromic , ceasirian kit , cell counting machine (manually) , chloramphenicol 1% eye applicacaps , chlorinated lime water (ec lotion) , clotrimazole + gentamycin + beclometasone ointment , compound sodiume lactate iv 500 ml , cord calmp , cotton (absorbent) , cotton (absorbent) , cotton thread no. 1, 3, 4 , crepe bandage 4 , crepe bandage 6 , cretinnine kit(35 test) , disposable delivery kit (ddk kit) , disposable surgical head cap , disposalmask triple layer (without nose pin) , dobutamine , dopamine hcl , dropper 3ml plastic , drotaverine , e c lotion , e.d.t.a vail 2 ml.(100 pc) , ear drop (neomycin + beclometasone + clotrimazole + lidocaine) , ecg gel 250ml , ecg gel 5 kg jar , edta 100 vial , emergency obstetric care drug kit , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , esr stand 6 tube capacity , esr tube (all size) , etophylline +theophylline , etophylline +theophylline , face shield , filtter paper 9 ca (100 pc) , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , frusemide tab. , gauze than , gauze than , gentian violet , glass slide (per box) 50 pcs , gloves (nitrile) sterile , gloves (non sterlite isi) large size , gloves (non sterlite isi) medium size , gloves (sterlite isi) , gloves (sterlite isi) , gloves (sterlite isi) , gloves (sterlite isi) , glucose (1x9x50ml) , glucose antigen (2x200 ml) , glucose kit good/pod (4x250) test , glucose powder 1 kg jar , glucose powder 1/2 kg jar , glycopyrrorlate , gypsona (readymade plaster of paris roll) , gypsona (readymade plaster of paris roll) , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hiv rti/sti kit , hydrochlorothiazide , hydrocortisone sodium succinate , hydrogen peroxide , hydrogen peroxide , i.v. set , immerssion oil (bottle) , infusion set with hypodermic needle 21g 1.5 , inj. betamethasone4mg/ml , inj. efcorlin , inj. mephentine , inj. noradrenaline , inj. pam , inj. piperacillin + tazobactam 4.5 gm , inj. piperacillin + tazobactam 1.5 gm , inj. reteplase , inj. sodibicarb 10 amp , inj. tenectaplase , inj. vitamin k (phytomenadione) , inj. vitamin k 3 (menadione) , inj.plasama substitude 500ml bottle , inracath/safety canula , inracath/safety canula , inracath/safety canula , inracath/safety canula , inracath/safety canula , insulin injection (soluble) , iron drop , iron sucrose , isolyte (m,g,p) , iv catheter (jelco) 25 no , ketamine hydrochloride , labetalol 100 mg , lancet (200 pcs) , large microtips (1000 pc) , lead apron , lecopore 3 , lignocaine hydrochloride , lignocaine hydrochloride , lignocaine hydrochloride+adrenaline , lotion. benzyl benzoate (100ml) , lubricant eye drop , luliconazole cream , lysol (cresol with soap) , lysol (cresol with soap) , mannitol , mask n 95 , mask n95 (respirator) , medical abortion kit (mifepristone misoprostol) , mersilk (1 no) , mersilk (2 no) , mersilk 0.3 , mersilk 2.0, 1.0 cutting needle , mersilk 2.0, 1.0, 0.5 cuttingneedle , methyl dopa 250 mg , methyl ergometrine , micro scalp veinset , micro tips blue (1000 pcs) , micro tips yellow (1000 pcs) , mma drugs kit , mother & child name tag wrist band , moxifloxacin eye drop , mtp tray , mucus sucker , multivitamin drop , mva kit , n/2 dns , n/g tube 5,6 no , nasal normal saline drop , nasal prongs (neonatal) , neaomycineoint , neaomycinepowder , nebuliser solution (salbutamol,ipratopium bromide) , needle curve, streght , needle curve cutting & round body , needle straight , new born diaper , new born baby kit (containt of baby sheet, towel, cap, t shirt, diaper) , nifedipine 10 mg , nifedipine 5 mg , nitroglycerin , d 9 % , nsv kit , ofloxacin + dexamethasone ear drops , oint. silver sulphadizine 20gm , oint. silver sulphadizine 500gm , ot cap , oxygen mask adult , oxygen mask child , oxygen mask set (complete set) , oxytocin , peadiaset , pheniramine maleate , phenobarbitone , phenobarbitone , phenobarbitone inj. 2 ml , phentoin inj. 2 ml , phenyl 5 liter jar , phenytoin sodium , phenytoin sodium , plain catgut 1no , plain vial , plasma volume expendore 500 ml , plastic appron , pop bandage 4 inch , pop bandage 6 inch , potassium chloride , potassium chloride , potassium chloride solution , povidine iodine ointment 5gm , povidine iodine solution 50 ml , pralidoxine chloride (pam) , prednisolone , prednisolone , priking needle len set , rabies immunoglobulin , rabies immunoglobulin , ready made adhesive , ready made adhesive traction kit bothfor adult and child , ready made adhesive traction kit adult , ready made adhesive traction kit child , rhyles tube16 no. , roll bandage 4 , roll bandage 6 , rubber turniquite , ryles tube assorted size , s.g.p.t kit(25 ml) , s0076 sanitary towels , safe flight 8x10 , salbutamol inhaler , salbutamol sulphate , salbutamol sulphate , salbutamol sulphate , sanetary pad (best quality) big , sanetary pad extra large/ safe care extra large (sanitary napkins with adjustable loop emds, made by non woven febric 2 pulp for absorbency and three side leak proff, total length of sanitary napkin 538 mm (+/ )) , sanetary pad extra large/ safe care extra large (with belt 10 s pack) , sanitizer 100 ml bottle , sanitizer 200 ml bottle , sanitizer 5 ltr jar , sanitizer 50 ml bottle , saving blade , savlon 50 ml , scalpvain set , scalven set 24 no. , 20 no. , shoe cover , shoe covers. (disposable) , silk thread (make j&j) , silver sulphadiazine , skeltal traction kit , slide (100 pc) , small microtips (1000 pc) , sodium bicarbonate , sodium chloride iv inj sodium chloride i.p 0.9% w 1 v 500 ml folic bottle , sodium citrate 3.8% (500 ml) , sodium hypochloride , sodium hypochlorite 1% , sodium hypochlorite solution , sodium metabisulfate 500 gm , sofratulle mesh , spinal needle , spinal needle , spinal needle , spinal needle , spirit 100 ml , spirit 400ml , sterile water for inj. i.p 5 ml , surgical paper tape , surgical paper tape , surgical paper tape , surgical paper tape , surgical paper tape , surgical spirit 500 ml , syringe 50ml , syringe disposable 1cc , syringe disposable 2cc , syringe disposable 3cc , syringe disposable 5cc , syringe disposable 10cc , syringe disposable 20cc , syringe disposable 50cc , syrp. azithromycin 15 ml/600mg , syrp. azithromycin 200 mg/15ml , tab. azithromycin 100mg , tab. chromostat , tab. clopidogrel 75 mg , tab. dicolofenae potassium (50mg) , tab. dicolofenae sodium (50mg) , tab. ecosprine 150 mg , tab. glimepride ( 2 mg) , tab. glimepride 5 mg , tab. glimipride 1mg , tab. glimipride 2mg , tab. ivermectin 4mg , tab. labetalol 100mg , tab. levocetrizine 5mg + montelukast 10mg , tab. p.c.m. d.t.( 250 mg) , tab. pentoprazole , tab. telmisartan 10 mg , tab. telmisarten ( 20 mg) , tab. telmisarten ( 40 mg) , tab. tranaxaemic acid + mefenamic acid , tab. vitamin b complex , tab. voglibose ( 2mg) , tab. voglibose ( 3mg) , tab.ascorbic acid , tab.losartan potassium 25mg. , tab.losartan potassium 50mg. , tarpin oil (50 ml) , teicoplanin , teicoplanin , test tube 12x75 mm , test tube 3/4 inch (100 pcs) , test tube rack , testube brush , tetanus toxoid , themometer (body) , thiopentene 500 mg , thrombophob ointment (20 gm) , tips (100 1000ul) , tissue paper , total protien , traction kit both for adult and child , tri sodium citrate 3.8% (500 ml) , triglyecide desgpopap25 ml , triglyeerides kit 2x150 ml , triple dye lotion , triple layer mask (with nose pin) , twin bore nasal oxygen set (with 2 mtr. long multichannel kink resistant tube) adult , twin bore nasal oxygen set (with 2 mtr. long multichannel kink resistant tube) pediatric , umbilical cathether (100 pc) , urea bun urease gldh (20x5) , urea dam mannual kit (125 ml) , urea kit 300 ml , uric acid kit (20x2 ml) , uric acid kit (5x20 ml) , urine pot , urine strip (100 test) , urinometer with measuring cylinder , urobag , v.d.r.l (shippils test strip one step) , v.d.r.l. (shippils test strip one step) , vicril no. 1 , vicryl 910 both side needle no. 1 , viscomet kit , vitamin d drop , w.b.c. diluting fluid 500 ml , water for injection , wax ear drop , widal antigen slide methed (4x5ml) , widal koit span 4x5 ml , x ray film 10x12 (green) , x ray film 12x12 (green) , x ray film 12x15 (green) , x ray film 8x10(green) , xylometazoline nasal drop adult , n 95 mask , ppe kit , developer for xray 13.5 litre , fixerfor xray 13.5 litre , rapid test card for pregnancy kit , rapid test card for malaria a/g , rapid test card for chiakngunia , rapid test card for dengue , rapid test card for hbsag , rapid test card for hiv , rapid test card for hcv , rapid test card for covid 19 ag , rapid test card for syphillis , rapid test card combo (hiv & syphlis) , urine test strip 2p , urine test strip 3p , urine test strip 4p , urine test strip 5p , urine test strip 10p , idbracelet for chiidren,written type , idbracelet for adult,written type , idbracelet for chiidren,card insert type , idbracelet for aduit,card insert type , idbracelet for adult & chiid,card insert type , idbracelet for adult & chiid,card bar code type , ppe kit , surgeon cap , 3 ply face mask , n 95 mask , shoe cover disposable , bouffant cap , disposable apron , new born diaper , needle straight , needle curved , mucus sucker , roller crepe bandage 2 , roller crepe bandage 3 , roller crepe bandage 4 , roller crepe bandage 6 , cotton thread , cord clamp , burn patti , bleaching powder 25 kg , b.p. blade no. 20 (all size) , b.p. blade no. 15 , b.p. blade no. 12 , lab , albumin , albumin , alkaline phosphatase , alkaline phosphatase , a amylase , a amylase , a amylase , sgot (uv kinetic) , sgot (uv kinetic) , sgot (uv kinetic) , sgot (uv kinetic) , sgpt (uv kinetic) , sgpt (uv kinetic) , sgpt (uv kinetic) , sgpt (uv kinetic) , bilirubin total &direct , bilirubin total &direct , bilirubin total &direct , bilirubin direct , bilirubin direct , bilirubin direct , bilirubin total , bilirubin total , bilirubin total , calcium , calcium , calcium , cholesterol + hdl ppt , cholesterol , cholesterol , cholesterol , ck nac (kinetic) , ck nac (kinetic) , chloride , chloride , ck mb (kinetic) , ck mb (kinetic) , cleaning solution (semi auto analyser) , creatinine (3affe’s 2p kinetic) , creatinine (3affe*s 2p kinetic) , creatinine (3affe’s 2p kinetic) , ggt (kinetic) , ggt (kinetic) , glucose , glucose , ldh (kinetic) , ldh (kinetic) , micro protein , micro protein , phosphorus , phosphorus , triglycerides , triglycerides , triglycerides , total protein , total protein , uric acid , uric acid , uric acid , urea uv (2p kinetic) , urea uv (2p kinetic) , acid phosphatase (kinetic) , acid phosphatase (kinetic) , cholesterol direct(ep), hdl , cholesterol direct(ep}, hdl , cholesterol direct(ep}, ldl , cholesterol direct(ep), ldl , lipase (kinetic) , lipase (kinetic) , sgpt (uv kinetic 30 days) , sgpt (uv kinetic 30 days) , sgpt (uv kinetic 30 days) , sgpt (uv kinetic 30 days) , sgot (uv kinetic 30 days) , sgot (uv kinetic 30 days) , sgot (uv kinetic 30 days) , sgot (uv kinetic 30 days} , cholesterol (ep90 days) , cholesterol (ep90 days) , cholesterol (ep90 days) , glucose (ep60 days) , triglycerides (ep 30 days) , triglycerides (ep 30 days) , triglycerides (ep 30 days) , uric acid (ep30 days) , uric acid (ep30 days) , uric acid (ep30 days) , urea berthelot (ep21 days) , urea uv (2p kinetic 30 days) , urea uv (2p kinetic 30 days) , urea uv (2p kinetic 30 days) , plain, vacutainer tubes, 4mired , edtak2(k3},2mi purple , edtanaf,2mi, grey , sodiumheparin,4mi,green , sodium citrate 3.2*/a, 2mi blue , sodium citrate 3.8*/a,2mi black , gel & clot activator,sml yellow , blue tips gilson type 1000ui , white tips gilson type 1000ui , yellow tips, gilson type 200ui , white tipsgilson type 200ui , white tipsgilson type 10 ul , white tips 1000ui with filter , white tips 200ui with filter , white tips 10ui with filter , white tips 1000ui rna/dna free , white tips 200ui rna/dna free , white tips 10u rna/dna free , white tips 1000ui (with filter) in rack , white tips 200ui (with filter) in rack , cover glass square 18x18mm () , cover glass square 22x22mm() , microslides 75mmx25mmx1.25mm() , microslides 75mmx25mmx1.30mm() , esr pipette westergreen(glass) , haemometer pipette 20pi(glass) , haemometer tube round(glass) , hb square tube(glass) , rbc pipette pvc tubing(glass) , wbc pipette pvc tubing(glass) , winthrobe tube(glass) , coverglasses, 18x18mm,100pcs, #1 (imported) , coverglasses, 22x22mm 100pcs, #1(imported) , cover glass 22 x 50 mm 100pcs, # 1(imported) , microslides 75mmx25mmx1.25mm(imported) , microslides 75mmx25mmx1.25mm(imported) frosted one end , test tube glass disposable 12x75mm , test tube glass disposable 12x100mm , haematocrit capillariesheparinised , haematocrit capillariesnon heparinised , petridish 90mm eto sterilized , urine container 30mi eto steriiized , urine container 50mi eto steriiized , urine container 60mi eto steriiized , urine container 120 ml , stool container 30 ml pp , stool container 30 ml ps , centrifuge tube 15mi(sterilised) , centrifuge tube 50mi(sterilised) , pasteur pipettes3mi(sterilised) , test tube (ria tube) 1zx75mm ps , microcentrifuge tube 0.5mi conical (dna/rna free} , microcentrifuge tube 1.5mi conical (dna/rna free} , microcentrifuge tube 2.0mi conical (dna/rna free} , microcentrifuge tube 0.5mi conical , microcentrifuge tube 1.5mi conical , microcentrifuge tube 2.0mi conical , centrifuge tube 15mi conical , centrifuge tube 50 ml conical , cryovial tube 1.8mi , sample cups hitachi , pasteur pipettes3mi , aserological pipette 1mi , ‘grserological pipette 2mi , 6serological pipette 5mi , 6 serological pipette 10mi , serological @ipette 25mi , micropipette fixed 10pl , micropipette fixed 20pl , micropipette fixed 100pl , micropipette fixed 500pl , micropipette fixed 1000pl , micropipette variable 5 50pl , micropipette variable 10 100pl , micropipette variable 100 1000pl , micropipette holder stand , micropipette variable 5 50pl , micropipette variable 10 100pl , micropipette variable 100 1000pl , tourniquetebuckle premium , tourinquetestandard , test tube rack d13 mm, 50 holes , test tube rack d18 mm, 50 holes , test tube rack 50 wells multipurpose , rack for gilson tips 200pi 96 hole , rack for gilson tips 1000pi 60 hole , counting chambers , esrpipette disposable , blood cell counter s keys , blood cell counter 8 keys , alcohol swabs saturated , embeddingcassettes , embeddingring , pipette pump 2mi , slide box glass , thermal paper 110mmx25mtrs , thermal paper 57mmx25mtrs , thermal paper 80mmx25mtrs , thermal paper 50mmx25mtrs , blood lancets, steel type , blood lancets plastic screw , blood lancets plastic flat , cytobrush, standard type, nylon bristie,ss wire, pp stick , swab sticks wooden 6 inch , swab sticks sterilised wooden(in plastic tubes) , swab sticks sterilisedplastic(inplastic tubes) , wooden ayre scrapper / spatula , papsmear test kit 4pcs sterilised , papsmear test kit 2pcs sterilised , swab stick sterilised , endometrialsuction curette , a umbilicalcord clamp paper pouch , mucus extractor plastic pouch , crystal voilet pow. , crystal voilet pow. , giemsa’s pow. , giemsaspow. , leishman’sstainpow. , leishmansstainpow. , methyleneblue , methyleneblue , bisocodyl suppository , camphor menthol vapocap , chlorhexidine gluconate & cetrimide solution , chlorhexidine mouth wash , chloroxylenol, terpineol & absolute alcohol liquid , clindamycin gel , clotrimazole mouth paint 1% , drop dicyclomine , drop domperidone , drop. ciprofloxacin eye drop. , drop. ciprofloxacin+dexamethasone eye/ear drop. , drop. clotrimazole ear drop , drop. dexamethasone eye drop , drop. gentamicin eye /ear drop. , drop. iron oral drop 25mg/ml , drop. moxifloxacin eye drop , drop. multivitamin oral drop 15ml , drop. nasal drop. , drop. neomycin + clotrimazole + dexamethasone eye drop. , drop. neomycin + hydrocortisone eye drop. , drop. ofloxacin + dexamethasone eye drop. , drop. paracitamol oral drop , drop. polymyxin b eye drop , drop. saline nasal drop , drop. tobramycin eye drop. , drop. vitamin d3(1ml=800iu) , drop. waxonil ear drop. , drop. xylometazoline nasal drop , gamma benzene hexchloride lotion. , hydrogen peroxide. , oint. atropin sulphate 1% , oint. atropin sulphate 1% s eye ointment , oint. beclomethasone , oint. chloramphenicol , oint. clobetasol , oint. clotrimazole , oint. diclofenac gel , oint. fucidic acid , oint. ketoconazole ointment. , oint. metronidazole + povidine iodine , oint. mometasone , oint. mupirocin , oint. neomycin+polymyxin b eye oint. , oint. neosporm skin/eye ointment. , oint. ofloxacin+dexamethasone , oint. povidine iodine 15gm. tube , oint. soframycin skin ointment. , plaster of paris 50kg tin/bag. , povidone iodineointment 250gm , povidone iodine solution 5% w/v , povidone iodine solution 7.5 % , powder clotrimazole , powder neosporin , silver sulphadiazine cream 1% w/w 500gm , syp. albendazole. , syp. alkaline. , syp. amoxycillin 228.5mg/5ml , syp. amoxycillin+clavulanic acid 228.5mg+457mg/5ml , syp. ampicillin+cloxacillin. , syp. antacid. , syp. b complex. , syp. caffine citrate 60mg/3ml , syp. calcium , syp. calcium + phosp+ vit d3 , syp. cefadroxyl. , syp. cefalexin , syp. cefixime , syp. cefodoxim , syp. cefuroxime , syp. cetrizine , syp. chloroquine. , syp. cotrimoxazole. , syp. cough expectorant 100ml , syp. cough syrup 100ml , syp. cremalax , syp. dextromethorphan hydrobromide 15mg+cpm 2mg/5ml , syp. dry cough 100ml , syp. erythromycine , syp. ferrous fumarate/sulphate , syp. ibuprofen. , syp. lactulose. , syp. levo salbutamol+ ambroxol , syp. liver tonic. , syp. mefemenic acid , syp. multivitamin. with zinc , syp. ofloxacin. , syp. ofloxacin+metronidazole , syp. oxetacaine bp 10mg+aluminium hydroxide 0.291gm+magnisium hydroxide 98mg/5ml , syp. paracetamol. 125mg , syp. polymyxin b , syp. portklor , syp. promethezine hcl , syp. quinine. : , syp. sodium valporate. , syp. sucralfate , syp. vitamin a , syp. vitamin d , syp. vitamin e , drop paracetamol , drop cough , drop vitamin c , drop amoxycillin , syp. ofloxacin+ornidazole , syp. prednisolne , syp. ranitidin , syp. montelukast+levocetrizine , syp. montelukast+cetrizine , syp. vitamin c , ors , solution salbutamol nebulizing , solution ipratropium bromide nebulizing , solution budecort nebulizing , particulars , isolyte m(500ml) ffs pack , isolyte p(500ml) ffs pack , iv ciprofloxacine(100ml) bffs pack , iv mannitol (100ml) bffs pack , iv mannitol (300ml) ffs pack , iv metronidazole 100ml bffs pack , saline d.n.s. (500ml) ffs pack , saline dextrose 10%(500ml) ffs pack , saline dextrose 5%(500ml) ffs pack , saline n.s. (500ml) ffs pack , saline rl (500ml) ffs pack , saline 1/2 dns , crystalloid solution ( 0.9% ns) in severe cases , amlodipine tablet 5 mg , amoxicillin capsule 500 mg , cefoperazone inj 1gm , ceftriaxone 1gm injection , dexamethasone sodium phosphate inj 8mg/2ml , dexamethasone tab 0.5 mg , doxycycline 100mg capsule , enoxaparin inj 60 mg prefilled syringe , enoxaparin injection 60 mg , favipiravir tablet 200mg , formetron badesoride inhaler , ivermectin 12mg tablet , levosalbutamol inhaler , methyl prednisolone sodium succinate ip 40mg as injectable form , metronidazole injection 100mg infusion , metronidazole injection 500mg/100ml in vial , metronidazole tablet 400 mg , metroprolol sustained release tablet 25 , montelucast and levocetrizine , n acetyl cysteine 600mg tab , ondansetron tab 4 mg , ondenstron 4mg injection , pantoprazole 40mg/ml injection 10ml ample , pantoprazole 40mg tablet , paracetamol 500 mg tablet , paracetamol injection 150 mg/ml 2ml ampoule , piperacilin 4gm + tazobactum 0.5gm vial inj , povidone iodine gargle 100ml 2% w/v , ranitidine injection 25 mg/ml in 2ml ampoule , ranitidine tab 150 mg , vitamin c tablet 500mg , vitamin d capsule 60k , zinc tablet 50 mg , calcium & vitamin d3(alternative for vit d) , levocetrizine , tab favipiravir 200mg , tab favipiravir 400mg , cap doxycycline with lacto pasils (100 mg) , tab ivermevtin(12 mg) , tab vitamin c , tab zinc , inj methyl prednisolone(40 mg) , inj enoxaparin (60 mg) , inj dexona(30 ml) , tab dexona , cap vitamin d3 , tab pantaprazole (40 mg) , inj cefoperazone 1gm , inj ceftriaxone 1gm , inj tazobactum + piperacillin , inj pantaprajol (40 mg) , inj ranitidine (50 mg) , inj ondansetron (4 mg) , inj metronidazole (100ml ) , cap pre + prabiotics , tab ondansetron (4 mg) , tab amlodipine (5 mg) , tab metroprolol sustained 25 mg , inj frusemide , levocetrizine with montelukast , tab methyl predisolone (4 mg) , syringe 0.5 ml , pregnancy test kit , hepatitis b test kit , hemoglobin test kit , delivery disposable kit , medicated soap , labetalol inj , iv ns , iv lectyle m , iv protien infusion , inj tenectaplase , inj streptokinase , rubbersheet roll , insulin syringe , diclofenac +pcm , ibuprofen + pcm , metronidazole + ofloacin , blood transportation set , tab vitamin b complex , inj mutivitamin...

Health Department - Jharkhand

29775937 rate contract for supply of medicine and consumables rate contract for supply of medicine and consumables , injection , inja barteether150mg. , injadrenaline. , injamikacin100mg. , injamikacin 250mg. , injamikacin500mg. , injamoxycillin500mg. , injamoxycillin+clavulanicacid ( 1.2gm ) , injamoxycillin+cloxacillin ( 250mg.each ) , injampcillin+cloxacillinneonet. , injamphotericinb10mg , injamphotericinb25mg10ml , injamphotericinb50mg10ml. , injamphotericinbcrystal , injamphotericinblipidcomplex10mg , injamphotericinblipidcomplex25mg , injampicillin ( 500mg ) , injampicillin+cloxacillin ( 125mg.each ) , injampicillin+cloxacillin ( 250mg.each ) , injampicillin+cloxacillin ( 500mg.each ) , injantirabbiesvaccine , injantisnakevenomserumlypholised , injartemether40mg. , injartemether80mg. , injartisunate60mg. , injatropinsulphate. , injazithromycin500mg , injbetamethasone , injcalciumgluconate. , injcamylofindihcl. , injcefepime1gm , injcefepime+sulbactum , injcefepime+tazobactum1.125gm , injcefoperazone+sulbactum1.5gm , injcefoperazone1gm. , injcefoperazone+tazobactum1.125gm. , injcefopodoxime+clavulanicacid , injcefotaxime125mg. , injcefotaxime1gm. , injcefotaxime250mg. , injcefotaxime500mg. , injcefotaxime+sulbactum ( 1gm+500mg ) , injcefpirom , injceftazidime1gm. , injceftriaxone ( 1gm. ) , injceftriaxone125mg. , injceftriaxone250mg , injceftriaxone500mg. , injceftrioxone+sulbactum ( 1gm+500mg ) , injceftrioxone+tazobactum ( 1gm+500mg ) , injcefuroxime250mg , injcephazolin500mg , injchloroquine40mg / ml , injciticholine , injclarithromycin1gm , injclindamycin100mg , injclindamycin300mg , injclindamycin600mg , injclonidine , injcloxacillin250mg , injcloxacillin500mg , injdexamethasone4mg / 2ml , injdexamethasone8mg / 2ml , injdiazepam. , injdiclofenacsodium75mg / 3ml , injdiclofenacsuppository50mg , injdiclofenaceaqous , injdicyclomine10mg / ml , injdoxycycline100mg , injerythropoeitin4000alpha , injerythropoeitin4000beta , injerythropoeitin4000thermostat , injesomeprazole40mg , injesomeprozle40mg , injetophyllin+theophyllin. , injfrusemide , injgentamycin40mg. , injgentamycin80mg. , injheparin25000iu , injheparin5000iu , injhydrocortisone100mg , injinsulin50 / 50regularnphpremixedvile40u10mlvile , injinsulin50 / 50regular / nphcartridge4pen100u3ml , injinsulinhumanactrapid. , injinsulinhumanmixterd , injintraconozole200mg / 20ml , injirondextran50mg , injironsucrose , injlignocaine2%30ml , injlignocaine2%withadrenaline , injlowmolecularweightheparin0.4mg / 40ml , injlowmolecularweightheparin0.6mg / 60ml , injmagnesium.sulphate. , injmecoblamine1500gm , injmeropenam1gm , injmeropenam250mg , injmeropenam500mg , injmeropenam+clvulanicacid , injmethylprednisolane1gm , injmethylprednisolane500mg , injmethylcobal. , injmetoclopramide. , injmidazolam10mg / 10ml. , injmultivitamin , injondansetron. , injoxytocin , injpantoprazole40mg. , injparacetamol75mg / 2ml , injparacetamolsuppository 80mg , injpentazocine. , injpheniraminemaleate. , injpiperacillin+tazobactam1.125gm , injpiperacillin+tazobactam4.5gm. , injrabeprazole. , injrabeprazole. , injranitidine. , injregularinsulin40iu / ml , injremdisivir100mg , injroxithromycin , injsalbutamol. , injsalbutamol+ipratropiumsolution250mcg / 1ml , injstemetil , injstreptomycine0.75mg. , injsuccinylcholine. , injsulbactum500mg+cefoperozone500mg , injtetnusantitoxin , injtetnustoxoidevaccine. , injthiamine100mg / ml , injthiamine200mg / ml , injtramadolhcl50mg / ml , injtranexamicacid , injtriamcinlone , injvancomycin500mg. , injvitamin a50000iu / ml , injvitamin c1.5gm , injvitamin k1mg / 0.5ml , injvonconazole , tablets & capsules , aceclofenac+paracetamol , aceclofenac+serratiopeptidase , acetylcysteine , acetylsalicylicacid , acyclovir800mg. , albendazole400mg. , alprazolam0.25mg , alprazolam0.5mg , amitryptyline10mg / 25mg , amlodipine10mg , amlodipine5mg , amoxycillin500mg+clavulanate125mg , amoxycillin250+clavulanate125mg , amoxycillin250mg. , amoxycillin500mg. , ampicillin+cloxacillin ( 250mgeach ) , ampicillin+cloxacillinkid , ampicillin+dicloxacillin ( 250mgeach ) , ampicillin500mg. , amytriptilline. , antacid. , artemether+lumefaotive , artemether40mg. , artemether80mg. , artisunate+sulphadoxim+pyrimethanuine , artisunate50mg. , ascorbicacid ( vitaminc ) , atenolol50mg. , atorvastatin20mg , atorvastatin40mg , azithromycin250mg , azithromycin500mg , baclofen20mg , b complex. , benadone20mg , betamethasone8mg , bisacodyl10mg , calcium+vitd3 , carbamazepine200mg , carbamazepine300mg. , carbamazepine400mg. , carbimazole10mg , carvedelol12.5mg , carvedelol3.125mg , carvedelol6.25mg , cefadroxyl500mg , cefadroxylkid. , cefixime+ofloxacin , cefixime200mg , cefopodoxime+clavulanicacid200+125mg , cefopodoxime500mg. , cefuroxime250mg , cefuroxime500mg , cepecitabine500gm , cephalexin500mg. , cetrizinehcl10mg. , chloramphenicol. , chlordiazepoxide5mg+clinidiumbromide2.5mg. , chloroquinephosphate15mg. , chlorpheniraminemaleate25mg , chymoralplus. , cinnarizine30mg , cinnarzine25mg / 50mg , ciprofloxacin250mg. , ciprofloxacin500mg. , ciprofloxacin500mg+tinidazol600mg. , citicoline+piracetam500+800mg , citicoline500mg , clarithromycin250mg. , clarithromycin500mg. , clindamycin300mg , clindamycin600mg , clinidipine10mg , clonazepam0.25mg. , clopidogrel150mg. , clopidogrel75mg. , clotrimazolevaginal , coralcalciumwithvitdandk , cotrimaxazole , co trimoxazole , deflazacort6mg , dexamethasone4mg , diclofenac50mg+patacetamol325mg , diclofenacsodium+paracetamol50+325mg , diclofenacsodium100mg. , dicyclomine100mg. , dicyclominehydrochloride , di ethylcarbazine100mg. , diloxamidefureate. , disprin325mg , domperidone10mg , doxycycline100mg. , drotaverin , dulcolax , ecosprin150mg , enalprilmaleate5mg , erythromycin500mg. , erythromycinkid, , ethambutol800mg , ethamsylate250mg. , etophyllin+theophyllin23+77mg , famotidine40mg. , favipiravir200mg , favipiravir400mg , flavoxate200mg , fluconazole150mg. , fluoxetive40mg , frusemide40mg , gatifloxacin200mg. , glibenclamide5mg. , gliclazide30mg , glimipride1mg , glimipride1mg+metformin500mg , glimipride2mg+metformin500mg , griseofluvin250mg. , hydrochloroquine200mg , ibuprofen+paracetamol. , ibuprofen400mg. , iron+folicacid , itraconazole100mg , itraconazole200mg , ivermectin12mg , ketocanazole200mg , ketoconazole200mg. , levetiracetan500mg , levocetrizinelomg. , levofloxacin500mg , levofloxacin750mg , linozobid600mg , loperamide 2mg , losertan , mefenamicacid , metformin500mg. , methylcobalamine , methyldopa. , methylprednisolone8mg , metoprolol25mg , metoprololsuccinateextendedrelese12.5mg , metronidazole400mg. , misoprostol200mcg , multivitamin , nitrofurantocin100mg , norfloxacin+tinidazole. , norfloxacin400mg. , ofloxacin100mg. , ofloxacin200mg. , ofloxacin200mg+ornidazole500mg , olanzapine5mg , omeprazole20mg. , omeprazole20mg+domperidone10mg , ondensateron10mg , ornidazole500mg. , pantoprazole40mg. , pantoprazole40mg+domperidone , paracetamol500mg. , paracetamol650mg. , paroxetine12.5mgxr , pheniraminemaleate.50mg , phenytoinsodium100mg , pioglitazone15mg , piperazine500mg. , piracetam800mg , prednisolone10mg. , prednisolone10mg. , pregabolin+methylcobalamine , primaquine15mg. , primaquine2.5mg , prochlorperazine , promethazine25mg. , propanolol40mg. , pyrazinamide750mg. , pyridostigmine60mg. , quininehcl300mg. , quitiapine25mg , rabeprazole20mg , rabiprazoletablet 10mg , racecadrotil , ramipril2.5mg. , ranitidine. , rifampicin450mg. , rifampicin450mg+isoniazide300mg , rifampicinkid. , risperidone2mg , rosuvastatin , roxythromycin150mg , salbutamol2mg , salbutamol2mg. , serratiopeptidase10mg. , serratiopeptidase10mg+diclofenacsodium50mg. , sodvalporate250mg. , sodvalporate500mg , sparfloxacin , spironolactone , sulfadoxime500mg+pyrimethenine250mg , sulfasalazine500mg , tamsulosin0.4mg , telmisartan40mg , terbinafin250mg. , terbutaline. , thalidomide100mg , theophyllin. , thyroxinesodium25mcg , thyroxinesodium50mcg , tiamine , tinidazole500mg. , torsemide , tramadol+paracetamol , tramadolhcl50mg , trenexamicacid500mg , trihexiphenidyl2mg. , trypsinandchymotrypsin , valacyclovir500mg , vitamin a , vitamin c , vitamin d , vitamin e400mg , vitamin k , zinc10mg , zinc20mg , zinc50mg , drops , syrups , ointments & misllaneous , bisocodyl suppository , camphor menthol vapocap , chlorhexidine gluconate & cetrimide solution , chlorhexidine mouth wash , chloroxylenol, terpineol & absolute alcohol liquid , clindamycin gel , clotrimazole mouth paint 1% , drop dicyclomine , drop domperidone , drop. ciprofloxacin eye drop. , drop. ciprofloxacin+dexamethasone eye / ear drop. , drop. clotrimazole ear drop , drop. dexamethasone eye drop , drop. gentamicin eye / ear drop. , drop. iron oral drop 25mg / ml , drop. moxifloxacin eye drop , drop. multivitamin oral drop 15ml , drop. nasal drop. , drop. neomycin + clotrimazole + dexamethasone eye drop. , drop. neomycin + hydrocortisone eye drop. , drop. ofloxacin + dexamethasone eye drop. , drop. paracitamol oral drop , drop. polymyxin b eye drop , drop. saline nasal drop , drop. tobramycin eye drop. , drop. vitamin d3 ( 1ml=800iu ) , drop. waxonil ear drop. , drop. xylometazoline nasal drop , gamma benzene hexchloride lotion. , hydrogen peroxide. , oint. atropin sulphate 1% , oint. atropin sulphate 1% s eye ointment , oint. beclomethasone , oint. chloramphenicol , oint. clobetasol , oint. clotrimazole , oint. diclofenac gel , oint. fucidic acid , oint. ketoconazole ointment. , oint. metronidazole + povidine iodine , oint. mometasone , oint. mupirocin , oint. neomycin+polymyxin b eye oint. , oint. neosporm skin / eye ointment. , oint. ofloxacin+dexamethasone , oint. povidine iodine 15gm. tube , oint. soframycin skin ointment. , plaster of paris 50kg tin / bag. , povidone iodineointment 250gm , povidone iodine solution 5% w / v , povidone iodine solution 7.5 % , powder clotrimazole , powder neosporin , silver sulphadiazine cream 1% w / w 500gm , syp. albendazole. , syp. alkaline. , syp. amoxycillin 228.5mg / 5ml , syp. amoxycillin+clavulanic acid 228.5mg+457mg / 5ml , syp. ampicillin+cloxacillin. , syp. antacid. , syp. b complex. , syp. caffine citrate 60mg / 3ml , syp. calcium , syp. calcium + phosp+ vit d3 , syp. cefadroxyl. , syp. cefalexin , syp. cefixime , syp. cefodoxim , syp. cefuroxime , syp. cetrizine , syp. chloroquine. , syp. cotrimoxazole. , syp. cough expectorant 100ml , syp. cough syrup 100ml , syp. cremalax , syp. dextromethorphan hydrobromide 15mg+cpm 2mg / 5ml , syp. dry cough 100ml , syp. erythromycine , syp. ferrous fumarate / sulphate , syp. ibuprofen. , syp. lactulose. , syp. levo salbutamol+ ambroxol , syp. liver tonic. , syp. mefemenic acid , syp. multivitamin. with zinc , syp. ofloxacin. , syp. ofloxacin+metronidazole , syp. oxetacaine bp 10mg+aluminium hydroxide 0.291gm+magnisium hydroxide 98mg / 5ml , syp. paracetamol. 125mg , syp. polymyxin b , syp. portklor , syp. promethezine hcl , syp. quinine. : , syp. sodium valporate. , syp. sucralfate , syp. vitamin a , syp. vitamin d , syp. vitamin e , drop paracetamol , drop cough , drop vitamin c , drop amoxycillin , syp. ofloxacin+ornidazole , syp. prednisolne , syp. ranitidin , syp. montelukast+levocetrizine , syp. montelukast+cetrizine , syp. vitamin c , ors , solution salbutamol nebulizing , solution ipratropium bromide nebulizing , solution budecort nebulizing , particulars , isolyte m ( 500ml ) ffs pack , isolyte p ( 500ml ) ffs pack , iv ciprofloxacine ( 100ml ) bffs pack , iv mannitol ( 100ml ) bffs pack , iv mannitol ( 300ml ) ffs pack , iv metronidazole 100ml bffs pack , saline d.n.s. ( 500ml ) ffs pack , saline dextrose 10% ( 500ml ) ffs pack , saline dextrose 5% ( 500ml ) ffs pack , saline n.s. ( 500ml ) ffs pack , saline rl ( 500ml ) ffs pack , saline 1 / 2 dns , crystalloid solution ( 0.9% ns ) in severe cases , disposables / consmables , disposable syring 5ml , disposable syring 10ml , disposable syring 3ml , disposable syring 2ml , disposable syring 1ml , disposable syring 0.5ml ad , gloves 7.5 surgical pair , gloves 7 surgical pair , gloves 6.5 surgical pair , gloves 6 surgical pair , examination gloves all sizes , nitrile gloves all sizes , vinyl gloves all sizes , heavy duty gloves all size rubber , cotton roll 400gm nett , absorbent cotton i.p 400gm / roll ( net weight ) , absorbent gauze than 18 m x 90 cm sch f ii delux quality , absorbent bandage than 18 m x 90 cm sch f ii delux quality , roller bandage sch f ii 2x5mtr , roller bandage sch f ii 3x5mtr , roller bandage sch f ii 4x5mtr , roller bandage sch f ii 6x5mtr , saline set , b.t. set , paedia drip set , scalp vein set ( 18 nos. ) , scalp vein set ( 22 nos. ) , scalp vein set ( 24 nos. ) ( all size ) , oxygen mask adult , leucoplast with zinc oxide 4 x 5 mt , leucoplast with zinc oxide 4 x 9 mt , leucoplast with zinc oxide 7.5 cm x 5 mt , leucoplast with zinc oxide 7.5 cm x 9 mt , lecopore with zinc oxide 7.5 cm x 5 mt , lecopore with zinc oxide 7.5 cm x 9 mt , intracath 18g , intracath 20g , intracath 22g , intracath 24g , intracath 26g , butter fly scalp vein set ( 24 no. ) , butter fly scalp vein set ( 23no. ) ( all size ) , adhesive micropore 2 , adhesive micropore 1 / 2 , adhesive micropore 1 , uro bag , uro bag with hanger for adult / child , urine pot , nasal prongs ( neonats ) , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , suction tube6fr , suction tube 8 fr , micropore 1 inch , oxygen mask child , oxygen mask adult , nebulizer set , disposable niddle 18fr , disposable niddle 22 fr , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , malecot catheter different sizes , epidural catheter , suction catheter , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , trece ostomy tube set , folye’s catheter 16 two way , folly’s catheter 20 two way , folly’s catheter 18 two way , folly’s catheter 10 two way , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , mersilk ( 1 0 ) , mersilk ( 1 no ) , mersilk ( 1 no ) , mersilk ( 2 0 ) , mersilk ( 8 0 ) , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , plain catgut ( 1 0 ) , plain catgut ( 2 0 ) , plain catgut 1no , plain catgut 1no , plain vial , prolene ( 2 0 ) , prolene ( 1no ) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene ( 1 0 ) , vicryl ( 1 0 ) , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl ( 2 0 ) , x ray plates ( 12x15 ) , x ray plates ( 10x12 ) , x ray plates ( 08x10 ) , x ray plates ( 12x12 ) , x ray cassttee ( 12x15 ) , x ray cassttee ( 10x12 ) , x ray cassttee ( 08x10 ) , x ray cassttee ( 12x12 ) , developer for xray 13.5 litre , fixerfor xray 13.5 litre , rapid test card for pregnancy kit , rapid test card for malaria a / g , rapid test card for chiakngunia , rapid test card for dengue , rapid test card for hbsag , rapid test card for hiv , rapid test card for hcv , rapid test card for covid 19 ag , rapid test card for syphillis , rapid test card combo ( hiv & syphlis ) , urine test strip 2p , urine test strip 3p , urine test strip 4p , urine test strip 5p , urine test strip 10p , idbracelet for chiidren, written type , idbracelet for adult, written type , idbracelet for chiidren, card insert type , idbracelet for aduit, card insert type , idbracelet for adult & chiid, card insert type , idbracelet for adult & chiid, card bar code type , ppe kit , surgeon cap , 3 ply face mask , n 95 mask , shoe cover disposable , bouffant cap , disposable apron , new born diaper , needle straight , needle curved , mucus sucker , roller crepe bandage 2 , roller crepe bandage 3 , roller crepe bandage 4 , roller crepe bandage 6 , cotton thread , cord clamp , burn patti , bleaching powder 25 kg , b.p. blade no. 20 ( all size ) , b.p. blade no. 15 , b.p. blade no. 12 , lab items , albumin , albumin , alkaline phosphatase , alkaline phosphatase , a amylase , a amylase , a amylase , sgot ( uv kinetic ) , sgot ( uv kinetic ) , sgot ( uv kinetic ) , sgot ( uv kinetic ) , sgpt ( uv kinetic ) , sgpt ( uv kinetic ) , sgpt ( uv kinetic ) , sgpt ( uv kinetic ) , bilirubin total &direct , bilirubin total &direct , bilirubin total &direct , bilirubin direct , bilirubin direct , bilirubin direct , bilirubin total , bilirubin total , bilirubin total , calcium , calcium , calcium , cholesterol + hdl ppt , cholesterol , cholesterol , cholesterol , ck nac ( kinetic ) , ck nac ( kinetic ) , chloride , chloride , ck mb ( kinetic ) , ck mb ( kinetic ) , cleaning solution ( semi auto analyser ) , creatinine ( 3affe’s 2p kinetic ) , creatinine ( 3affe*s 2p kinetic ) , creatinine ( 3affe’s 2p kinetic ) , ggt ( kinetic ) , ggt ( kinetic ) , glucose , glucose , ldh ( kinetic ) , ldh ( kinetic ) , micro protein , micro protein , phosphorus , phosphorus , triglycerides , triglycerides , triglycerides , total protein , total protein , uric acid , uric acid , uric acid , urea uv ( 2p kinetic ) , urea uv ( 2p kinetic ) , acid phosphatase ( kinetic ) , acid phosphatase ( kinetic ) , cholesterol direct ( ep ) , hdl , cholesterol direct ( ep } , hdl , cholesterol direct ( ep } , ldl , cholesterol direct ( ep ) , ldl , lipase ( kinetic ) , lipase ( kinetic ) , sgpt ( uv kinetic 30 days ) , sgpt ( uv kinetic 30 days ) , sgpt ( uv kinetic 30 days ) , sgpt ( uv kinetic 30 days ) , sgot ( uv kinetic 30 days ) , sgot ( uv kinetic 30 days ) , sgot ( uv kinetic 30 days ) , sgot ( uv kinetic 30 days } , cholesterol ( ep90 days ) , cholesterol ( ep90 days ) , cholesterol ( ep90 days ) , glucose ( ep60 days ) , triglycerides ( ep 30 days ) , triglycerides ( ep 30 days ) , triglycerides ( ep 30 days ) , uric acid ( ep30 days ) , uric acid ( ep30 days ) , uric acid ( ep30 days ) , urea berthelot ( ep21 days ) , urea uv ( 2p kinetic 30 days ) , urea uv ( 2p kinetic 30 days ) , urea uv ( 2p kinetic 30 days ) , plain, vacutainer tubes, 4mired , edtak2 ( k3 } , 2mi purple , edtanaf, 2mi, grey , sodiumheparin, 4mi, green , sodium citrate 3.2* / a, 2mi blue , sodium citrate 3.8* / a, 2mi black , gel & clot activator, sml yellow , blue tips gilson type 1000ui , white tips gilson type 1000ui , yellow tips, gilson type 200ui , white tipsgilson type 200ui , white tipsgilson type 10 ul , white tips 1000ui with filter , white tips 200ui with filter , white tips 10ui with filter , white tips 1000ui rna / dna free , white tips 200ui rna / dna free , white tips 10u rna / dna free , white tips 1000ui ( with filter ) in rack , white tips 200ui ( with filter ) in rack , cover glass square 18x18mm ( ) , cover glass square 22x22mm ( ) , microslides 75mmx25mmx1.25mm ( ) , microslides 75mmx25mmx1.30mm ( ) , esr pipette westergreen ( glass ) , haemometer pipette 20pi ( glass ) , haemometer tube round ( glass ) , hb square tube ( glass ) , rbc pipette pvc tubing ( glass ) , wbc pipette pvc tubing ( glass ) , winthrobe tube ( glass ) , coverglasses, 18x18mm, 100pcs, #1 ( imported ) , coverglasses, 22x22mm 100pcs, #1 ( imported ) , cover glass 22 x 50 mm 100pcs, # 1 ( imported ) , microslides 75mmx25mmx1.25mm ( imported ) , microslides 75mmx25mmx1.25mm ( imported ) frosted one end , test tube glass disposable 12x75mm , test tube glass disposable 12x100mm , haematocrit capillariesheparinised , haematocrit capillariesnon heparinised , petridish 90mm eto sterilized , urine container 30mi eto steriiized , urine container 50mi eto steriiized , urine container 60mi eto steriiized , urine container 120 ml , stool container 30 ml pp , stool container 30 ml ps , centrifuge tube 15mi ( sterilised ) , centrifuge tube 50mi ( sterilised ) , pasteur pipettes3mi ( sterilised ) , test tube ( ria tube ) 1zx75mm ps , microcentrifuge tube 0.5mi conical ( dna / rna free } , microcentrifuge tube 1.5mi conical ( dna / rna free } , microcentrifuge tube 2.0mi conical ( dna / rna free } , microcentrifuge tube 0.5mi conical , microcentrifuge tube 1.5mi conical , microcentrifuge tube 2.0mi conical , centrifuge tube 15mi conical , centrifuge tube 50 ml conical , cryovial tube 1.8mi , sample cups hitachi , pasteur pipettes3mi , aserological pipette 1mi , ‘grserological pipette 2mi , 6serological pipette 5mi , 6 serological pipette 10mi , serological @ipette 25mi , micropipette fixed 10pl , micropipette fixed 20pl , micropipette fixed 100pl , micropipette fixed 500pl , micropipette fixed 1000pl , micropipette variable 5 50pl , micropipette variable 10 100pl , micropipette variable 100 1000pl , micropipette holder stand , micropipette variable 5 50pl , micropipette variable 10 100pl , micropipette variable 100 1000pl , tourniquetebuckle premium , tourinquetestandard , test tube rack d13 mm, 50 holes , test tube rack d18 mm, 50 holes , test tube rack 50 wells multipurpose , rack for gilson tips 200pi 96 hole , rack for gilson tips 1000pi 60 hole , counting chambers , esrpipette disposable , blood cell counter s keys , blood cell counter 8 keys , alcohol swabs saturated , embeddingcassettes , embeddingring , pipette pump 2mi , slide box glass , thermal paper 110mmx25mtrs , thermal paper 57mmx25mtrs , thermal paper 80mmx25mtrs , thermal paper 50mmx25mtrs , blood lancets, steel type , blood lancets plastic screw , blood lancets plastic flat , cytobrush, standard type, nylon bristie, ss wire, pp stick , swab sticks wooden 6 inch , swab sticks sterilised wooden ( in plastic tubes ) , swab sticks sterilisedplastic ( inplastic tubes ) , wooden ayre scrapper / spatula , papsmear test kit 4pcs sterilised , papsmear test kit 2pcs sterilised , swab stick sterilised , endometrialsuction curette , a umbilicalcord clamp paper pouch , mucus extractor plastic pouch , crystal voilet pow. , crystal voilet pow. , giemsa’s pow. , giemsaspow. , leishman’sstainpow. , leishmansstainpow. , methyleneblue , methyleneblue...

Health Department - Jharkhand

29730279 rate contract for medicine, emergency life saving drugs, lab. reagents, other consumables and disposable items , deparment of medicine , aceclofenac + paracetamol , albendazole , albendazole , amikacin , amikacin , amikacin , amlodipine , amoxicillin+clavulanic acid , amoxicillin+clavulanic acid ( tab ) , amoxicillin+cloxacillin , amoxycillin , amoxycillin , amoxycillin , amoxycillin , amoxycillin+ clavulanic acid , amoxycillin 250 + cloxacillin 250 , ampicillin , antisnake venom , arteether , artesunate , atenolol , atenolol , azithromycin , azithromycin , azithromycin , betamethasone , calcium with d3 , cefixime , cefixime , cefixime , cefixime , cefotaxime , cefotaxime , cefotaxime , cefotaxime , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone+salbactum , ceftriaxone+salbactum , cetrizine , cetrizine , chloroquine phosphate , chloroquine phosphate , chlorpheniramine maleate , chlorpheniramine maleate , ciprofloxacin , ciprofloxacin , ciprofloxacin +tinidazole , ciprofloxacin eye / ear drops , ciprofloxacin hcl , co trimoxazole , co trimoxazole ds , co trimoxazole pead. , co trimoxazole ss , cough expectorant , cough suppressant , dexamethasone , dextrose 25% , diazepam , diazepam , diclofenac , diclofenac , diclofenac , dicyclomine hcl , dicyclomine hcl , dicyclomine hcl+paracetamol , diethylcarbamazine citrate , domperidon , domperidon , doxycycline , enalapril maleate 5 mg , ethamsylate , ethamsylate , fluconazole , folic acid , framycetin hydrochloride , frusamide , gamma benzene hexachloride , gentamicin , gentamicin ear / eye drop , ibuprofen , ibuprofen , ibuprofen , iron , iron folic acid ( large ) , iron folic acid ( small ) , iron folic acid ( syrup ) , levocetrizine , levocetrizine , lysol , mafloquin , magnesium sulphate , mefenamic acid , metformin , methyl ergometrine , metoclopramide , metoclopramide , metoclopramide , metronidazole , metronidazole , metronidazole , metronidazole , misoprostol , multivitamins , norfloxacin + tinidazole , normal saline , ofloxacin , ofloxacin , ofloxacin ( eye / ear drop ) , ofloxacin+ ornidazole , ofloxacin+ ornidazole , ondansetron , ondansetron , ondansetron , oral rehydration salts , pantoprazole , paracetamol , paracetamol , paracetamol , paracetamol , paracetamol , pentazocine , povidone iodine , povidone iodine , prednlsolone , primaquine , primaquine , primaquine , promethazine , rabeprazole , rabeprazole + domperidon dsr , rabeprazole hydrocholoride , rabies vaccine ( arv ) , rabies vaccine ( arv ) , ranitidine , ranitidine , ringer lactate , salbutamol , savlon , sulfadoxine +pyrimethamine , syrup. b complex 100 ml , tramadol hcl , tramadol hcl , tranexamic acid , tranexamic acid , vitamin b complex ( for prophylactic use only ) , zinc sulphate , zinc sulphate , 10% dextrose , 10% dextrose + 0.9% sodium chloride inj. , 5% dextrose , 5% dextrose + 0.9% sodium chloride inj. , abgel , aceclofenac + paracetamol + sersiopetidose , acetyl salicylic acid ( aspirin ) , activated charcoal , adhesive tape , adhesive tape , adrenaline bitartrate , airway , alprazolam , alprazolam , ambubag with zero size , amino acid solution , aminophilineinj. , aminophylline , amlodipine 2.5 mg , amlodipine 5 mg , anti scorpion venom , anti allergical cough suppresent 60 ml , anti d immunoglobulin ( human ) , anti d immunoglobulin ( human ) , anti imunoglobin 1 gm , antitetanus human immunoglobin , antitetanus human immunoglobin , atropine sulphate , b.p. blade assorted size , b.t. set , bandage , bandage , bandage , bandage than , bandaid , bleaching powder , brown paper bag ( large size ) , budesonide respiratory suspension 1 mg ( for inhalation only ) , bupivacaine hcl ( for spinal anaesthesia ) heavy , butorphanol tartrate , calcium 2x150 ml , calcium gluconate , carboprost250mg , care free extralarge / safe care extra large, total length of sanitary napkin 538 mm ( + / ) , catgut , catgut , catgut , catgut , catgut chromic , catgut chromic , catgut chromic , ceasirian kit , cell counting machine ( manually ) , chloramphenicol 1% eye applicacaps , chlorinated lime water ( ec lotion ) , clotrimazole + gentamycin + beclometasone ointment , compound sodiume lactate iv 500 ml , cord calmp , cotton ( absorbent ) , cotton ( absorbent ) , cotton thread no. 1, 3, 4 , crepe bandage 4 , crepe bandage 6 , cretinnine kit ( 35 test ) , disposable delivery kit ( ddk kit ) , disposable surgical head cap , disposalmask triple layer ( without nose pin ) , dobutamine , dopamine hcl , dropper 3ml plastic , drotaverine , e c lotion , e.d.t.a vail 2 ml. ( 100 pc ) , ear drop ( neomycin + beclometasone + clotrimazole + lidocaine ) , ecg gel 250ml , ecg gel 5 kg jar , edta 100 vial , emergency obstetric care drug kit , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , esr stand 6 tube capacity , esr tube ( all size ) , etophylline +theophylline , etophylline +theophylline , face shield , filtter paper 9 ca ( 100 pc ) , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , foleys catheter , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , frusemide tab. , gauze than , gauze than , gentian violet , glass slide ( per box ) 50 pcs , gloves ( nitrile ) sterile , gloves ( non sterlite isi ) large size , gloves ( non sterlite isi ) medium size , gloves ( sterlite isi ) , gloves ( sterlite isi ) , gloves ( sterlite isi ) , gloves ( sterlite isi ) , glucose ( 1x9x50ml ) , glucose antigen ( 2x200 ml ) , glucose kit good / pod ( 4x250 ) test , glucose powder 1 kg jar , glucose powder 1 / 2 kg jar , glycopyrrorlate , gypsona ( readymade plaster of paris roll ) , gypsona ( readymade plaster of paris roll ) , hiv rti / sti kit , hiv rti / sti kit , hiv rti / sti kit , hiv rti / sti kit , hiv rti / sti kit , hiv rti / sti kit , hiv rti / sti kit , hydrochlorothiazide , hydrocortisone sodium succinate , hydrogen peroxide , hydrogen peroxide , i.v. set , immerssion oil ( bottle ) , infusion set with hypodermic needle 21g 1.5 , inj. betamethasone4mg / ml , inj. efcorlin , inj. mephentine , inj. noradrenaline , inj. pam , inj. piperacillin + tazobactam 4.5 gm , inj. piperacillin + tazobactam 1.5 gm , inj. reteplase , inj. sodibicarb 10 amp , inj. tenectaplase , inj. vitamin k ( phytomenadione ) , inj. vitamin k 3 ( menadione ) , inj.plasama substitude 500ml bottle , inracath / safety canula , inracath / safety canula , inracath / safety canula , inracath / safety canula , inracath / safety canula , insulin injection ( soluble ) , iron drop , iron sucrose , isolyte ( m, g, p ) , iv catheter ( jelco ) 25 no , ketamine hydrochloride , labetalol 100 mg , lancet ( 200 pcs ) , large microtips ( 1000 pc ) , lead apron , lecopore 3 , lignocaine hydrochloride , lignocaine hydrochloride , lignocaine hydrochloride+adrenaline , lotion. benzyl benzoate ( 100ml ) , lubricant eye drop , luliconazole cream , lysol ( cresol with soap ) , lysol ( cresol with soap ) , mannitol , mask n 95 , mask n95 ( respirator ) , medical abortion kit ( mifepristone misoprostol ) , mersilk ( 1 no ) , mersilk ( 2 no ) , mersilk 0.3 , mersilk 2.0, 1.0 cutting needle , mersilk 2.0, 1.0, 0.5 cuttingneedle , methyl dopa 250 mg , methyl ergometrine , micro scalp veinset , micro tips blue ( 1000 pcs ) , micro tips yellow ( 1000 pcs ) , mma drugs kit , mother & child name tag wrist band , moxifloxacin eye drop , mtp tray , mucus sucker , multivitamin drop , mva kit , n / 2 dns , n / g tube 5, 6 no , nasal normal saline drop , nasal prongs ( neonatal ) , neaomycineoint , neaomycinepowder , nebuliser solution ( salbutamol, ipratopium bromide ) , needle curve, streght , needle curve cutting & round body , needle straight , new born diaper , new born baby kit ( containt of baby sheet, towel, cap, t shirt, diaper ) , nifedipine 10 mg , nifedipine 5 mg , nitroglycerin , d 9 % , nsv kit , ofloxacin + dexamethasone ear drops , oint. silver sulphadizine 20gm , oint. silver sulphadizine 500gm , ot cap , oxygen mask adult , oxygen mask set ( complete set ) , oxytocin , peadiaset , pheniramine maleate , phenobarbitone , phenobarbitone , phenobarbitone inj. 2 ml , phentoin inj. 2 ml , phenyl 5 liter jar , phenytoin sodium , phenytoin sodium , plain catgut 1no , plain vial , plasma volume expendore 500 ml , plastic appron , pop bandage 4 inch , pop bandage 6 inch , potassium chloride , potassium chloride , potassium chloride solution , povidine iodine ointment 5gm , povidine iodine solution 50 ml , pralidoxine chloride ( pam ) , prednisolone , prednisolone , priking needle len set , rabies immunoglobulin , rabies immunoglobulin , ready made adhesive , ready made adhesive traction kit bothfor adult and child , ready made adhesive traction kit adult , ready made adhesive traction kit child , rhyles tube16 no. , roll bandage 4 , roll bandage 6 , rubber turniquite , ryles tube assorted size , s.g.p.t kit ( 25 ml ) , s0076 sanitary towels , safe flight 8x10 , salbutamol inhaler , salbutamol sulphate , salbutamol sulphate , salbutamol sulphate , sanetary pad ( best quality ) big , sanetary pad extra large / safe care extra large ( sanitary napkins with adjustable loop emds, made by non woven febric 2 pulp for absorbency and three side leak proff, total length of sanitary napkin 538 mm ( + / ) ) , sanetary pad extra large / safe care extra large ( with belt 10 s pack ) , sanitizer 100 ml bottle , sanitizer 200 ml bottle , sanitizer 5 ltr jar , sanitizer 50 ml bottle , saving blade , savlon 50 ml , scalpvain set , scalven set 24 no. , 20 no. , shoe cover , shoe covers. ( disposable ) , silk thread ( make j&j ) , silver sulphadiazine , skeltal traction kit , slide ( 100 pc ) , small microtips ( 1000 pc ) , sodium bicarbonate , sodium chloride iv inj sodium chloride i.p 0.9% w 1 v 500 ml folic bottle , sodium citrate 3.8% ( 500 ml ) , sodium hypochloride , sodium hypochlorite 1% , sodium hypochlorite solution , sodium metabisulfate 500 gm , sofratulle mesh , spinal needle , spinal needle , spinal needle , spinal needle , spirit 100 ml , spirit 400ml , sterile water for inj. i.p 5 ml , surgical paper tape , surgical paper tape , surgical paper tape , surgical paper tape , surgical paper tape , surgical spirit 500 ml , syringe 50ml , syringe disposable 1cc , syringe disposable 2cc , syringe disposable 3cc , syringe disposable 5cc , syringe disposable 10cc , syringe disposable 20cc , syringe disposable 50cc , syrp. azithromycin 15 ml / 600mg , syrp. azithromycin 200 mg / 15ml , tab. azithromycin 100mg , tab. chromostat , tab. clopidogrel 75 mg , tab. dicolofenae potassium ( 50mg ) , tab. dicolofenae sodium ( 50mg ) , tab. ecosprine 150 mg , tab. glimepride ( 2 mg ) , tab. glimepride 5 mg , tab. glimipride 1mg , tab. glimipride 2mg , tab. ivermectin 4mg , tab. labetalol 100mg , tab. levocetrizine 5mg + montelukast 10mg , tab. p.c.m. d.t. ( 250 mg ) , tab. pentoprazole , tab. telmisartan 10 mg , tab. telmisarten ( 20 mg ) , tab. telmisarten ( 40 mg ) , tab. tranaxaemic acid + mefenamic acid , tab. vitamin b complex , tab. voglibose ( 2mg ) , tab. voglibose ( 3mg ) , tab.ascorbic acid , tab.losartan potassium 25mg. , tab.losartan potassium 50mg. , tarpin oil ( 50 ml ) , teicoplanin , teicoplanin , test tube 12x75 mm , test tube 3 / 4 inch ( 100 pcs ) , test tube rack , testube brush , tetanus toxoid , themometer ( body ) , thiopentene 500 mg , thrombophob ointment ( 20 gm ) , tips ( 100 1000ul ) , tissue paper , total protien , traction kit both for adult and child , tri sodium citrate 3.8% ( 500 ml ) , triglyecide desgpopap25 ml , triglyeerides kit 2x150 ml , triple dye lotion , triple layer mask ( with nose pin ) , twin bore nasal oxygen set ( with 2 mtr. long multichannel kink resistant tube ) adult , twin bore nasal oxygen set ( with 2 mtr. long multichannel kink resistant tube ) pediatric , umbilical cathether ( 100 pc ) , urea bun urease gldh ( 20x5 ) , urea dam mannual kit ( 125 ml ) , urea kit 300 ml , uric acid kit ( 20x2 ml ) , uric acid kit ( 5x20 ml ) , urine pot , urine strip ( 100 test ) , urinometer with measuring cylinder , urobag , v.d.r.l ( shippils test strip one step ) , v.d.r.l. ( shippils test strip one step ) , vicril no. 1 , vicryl 910 both side needle no. 1 , viscomet kit , vitamin d drop , w.b.c. diluting fluid 500 ml , water for injection , wax ear drop , widal antigen slide methed ( 4x5ml ) , widal koit span 4x5 ml , x ray film 10x12 ( green ) , x ray film 12x12 ( green ) , x ray film 12x15 ( green ) , x ray film 8x10 ( green ) , xylometazoline nasal drop adult...

Employees State Insurance Corporation - Jharkhand

29540497 bids are invited for abdominal drain 16 post operative abdominal drainage consists of super smooth drainage catheter along with a collection bag. made from non toxic and non irritant medical grade pvc. size 16 self life more then 2 years , cidex soln. 5ltr. cidex dialdehyde solution instrument disinfectant 2.4% w/v glutaraldehyde5 litter volume self life more then 2 years , desnet fumigaton disinfectant soln. 1ltr. fumigaton disinfectant solution for hospital use, 1 litter , self life more then 2 years , gloves surgical latex sterilesize : 8.0 sterile disposable latex surgical gloves no 8, self life more then 2 years , gloves surgical latex sterile size : 7.5 sterile disposable latex surgical gloves no 8, self life more then 2 years , mask, surgical mask 3 ply disposable surgical mask ,nose clip, bfe 99.6%, easily breathable, fluid resistant, ce, fda , iso ,(3 ply ,blue, pack of 100) self life more then2 years , oxygen mask (paed) disposableoxygen mask (paed) transparent,hospital useself life more then 2 years , ryles tube no.10 polymed disposableryles tube ,sterilized hospital useself life more then 2 years , soda lime 5kg. granules soda lime, hospital useself life more the 2 years 5 kg jar , surgical spirit 500ml. brilliant blue isopropyl rubbing alcohol hospital use self life more the 2 years 500ml bottle. , abgel haemostatic sponge 1x5x8cm. gelatin sponge used as a hemostat self life more the 2 years , bain circuit, adult romsons bain circuit 2.1m with 60cmh2o ultera apl valve double swivel patient elbow1 / 0.5 litre latex free breathing bagself life more then 2 years , betadine soln. 500ml. betadine std soln 10% w/v 500ml topical liquid (povidone iodine) hospital useself life more then2 years , cotton crepe bandage 10cm. x 4m. cotton crepe bandage 10cm. x 4m. hospital useself life more then 2 years , dispoable spinal needle, size 25g dispoable spinal needle, size 25g sterile . hospital use self life more then 2 years ...

Department Of Health - Jharkhand

29501536 rate contract for medicine and other consumable item rate contract for medicine and other consumable item , drugs items : , 0.5% bupivacain ( heavy ) , 1% gama benzene hexachloride lotion , 3% nacl 100 ml , 3% phenyl ( 5 litre ) , 3.8% sodium citrate solution 500 ml , 5% lysole , abo & rh ( anti ab&d ) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent cotton i.p 400gm / roll ( net weight ) , absorbent gauze than 18 m x 90 cm special , adenosine , airway 01234 , ambu bag adult , ambu bag pediatric , analgesic cream ( 30 mg tube ) , anti a1 ( lactin ) serum 5 ml , anti ab sera 30 ml , antifungal skin cream 20 gm , antihuman globulin serum 5 ml , apron , aso latex ( span ) ( 20 pcs ) , asthalin respules , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 ( all size ) , baby cap , baby dress , baby socks , baby tag , barium chlorine 500 ml , bendicts solution 500 ml , betadine ointment , betamethasone dipropionate cream , bilirubin ( span ) ( 35 pcs ) , bleaching powder25kg bag , blood bag350 ml , blood bag 100 ml , botroclot 10ml , bovine albumin 22% ( 5 ml ) , bt set , budecortrespules, , burn patti , butter fly scalp vein set ( 23no. ) ( all size ) , butter fly scalp vein set ( 24 no. ) , caffeine oral capnea , cannula ( 18 12 ) / jelco , cannula 20 no , cannula 24 no , cannula 26 no , cap. amoxycilline ( 250 mg ) + cloxacilline ( 250mg ) , cap. amoxycilline ( 250mg ) , cap. amoxycilline ( 500mg ) , cap. ampicilline 500mg , cap. cefalamine ( 250 mg ) , cap. cephalamine ( 500 mg ) , cap. cephalexin 250 mg , cap. cephalexine ( 250 mg ) , cap. cephalexine ( 500mg ) , cap. cholicalciferol 2000iu , cap. cholicalciferol 30000iu , cap. cloxacillin 250 mg , cap. cloxacillin 500mg , cap. depin ( 10 mg ) , cap. depin ( 5 mg ) , cap. doxycycline ( 100 mg ) , cap. griseofulvin 250mg , cap. omeprazole ( 10mg ) , cap. omeprazole ( 20mg ) , cap. vitamin a 200000 iu , capillary tube , carbolic acid ( 500 gm ) , chloramphenicol eye ointment , chlorhexidine , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , ciprofloxacine eye / ear drop 10ml , cleansole , clindamycin gel 30 gm , clobetasol fusidic acid cream , clotrimazole ear drops , clotrimazole ointment 30 gm , color coded bins black 20 litre , color coded bins black 40 litre , color coded bins black 60 litre , color coded bins black 80 litre , color coded bins blue 20 litre , color coded bins blue 40 litre , color coded bins blue 60 litre , color coded bins blue 80 litre , color coded bins red 20 litre , color coded bins red 40 litre , color coded bins red 60 litre , color coded bins red 80 litre , color coded bins yellow 20 litre , color coded bins yellow 40 litre , color coded bins yellow 60 litre , color coded bins yellow 80 litre , cord clamp , cotton roll 400gm nett , cotton thread , cover glass ( 100 pcs ) , cpr ( latex ) ( 20 pcs ) , crape bandage 4 , creatinine ( creast ) ( 35 pcs ) , crepe bandage 6 , crescent blade disposable , dextrose 25% ( 100 ml ) , diclofenac gel ( 30 gm ) , dicyclomine hydrochloride + activated semithicone drop 10 ml , digital thermometer , diltiazem , disposable delivery kit for delivery of hiv patient , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1ltr , distilled water 5ltr , donepezil , duolin respules , ec ( 700 ml ) ( agrawal ) , ecg jelly , ecg roll , edta powder 100gm , edta vial , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , enoxaparin , epidural catheter , epipress , esr stand ( 6group ) westergrens method , ethamsylate , examination gloves 6.5 ( 100pcs ) , examination gloves 7.0 ( 100pcs ) , examination gloves 7.5 ( 100pcs ) , eye drop chloramphenicol 5ml 0.50% ( 5 ml ) , eye drop occumox – p ( moxifloxacin + prednesolone ) ( 5 ml ) , eye drop ofloxacin + dexamethasone , eye drop, flurbiprofen plus ( 5 ml ) , eye drop, ofloxacin / moxifloxacin ( 5 ml ) , eye drop, tropicacyl plus ( 5 ml ) , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent ( 500 ml ) , fradiomycin cream 15 gm , fusidic acid cream , g.v. paint lotion 400ml , galamantine , gentamicin dexamethasone ear drops , glacial acetic acid ( 500 ml ) , glass slide ( 100 pcs ) , gloass rod , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter ( dr morphen ) , gluco meter strip ( dr morphen ) , glucometer , glucometer strip , glucometer ( ozocheck ) , glucometer strip ( ozocheck ) , glucose ( auto span ) ( 50ml ) , gown , haemometer set , hand sanitizer 100 ml , hand sanitizer 5 lt , hand sanitizer 500 ml , hand wash liquid form 80ml , handiplast ( 100 pcs ) , hbsag card rapid test kit ( 50 pcs ) , hcv rapid ( 30 kits ) , heavy duty gloves , hiv card rapid test ( 50 kits ) , inj anti d , inj. a.r.v. ( anti rabies ) multi dose , inj. a.r.v. ( anti rabies ) single dose , inj. adrenaline ampl , inj. amikacin ( 250mg ) vial , inj. amikacin ( 500mg ) vial , inj. amikacine ( 100mg ) , inj. amino phylline ampl , inj. ampicilin 250mg vial , inj. ampicilin 75 mg vial , inj. ampicillin500mg vial , inj. anafortan 2ml , inj. anamin , inj. anaspas , inj. anawin heavy , inj. anawin plain , inj. anti snake venus serum , inj. antitetanus human immunoglobulin , inj. arteether 2ml 50mg , inj. artesunate 1ml 60 mg , inj. atropin ( ampoule ) ampl , inj. avil ampl , inj. b complex amp , inj. botropase , inj. butodol , inj. caffeine , inj. calcium gluconate amp , inj. cefoperazone ( 1 gm. ) with watervial , inj. cefotaxime with water ( 1 gram ) , inj. cefotaxime with water ( 125 mg ) , inj. cefotaxime with water ( 500 mg ) , inj. ceftriaxone + salbatum with water ( 1.5 gram ) , inj. ceftriaxone 250mg with water vial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone inj 1gram with watervial , inj. chlorpheniramine , inj. chromostat amp , inj. citicholine , inj. compose 2ml , inj. deriphylin , inj. dexamethasonevial , inj. dexamethasone sodium phosphate 2ml / 4mg , inj. diazepam ( 5 mg ) 2ml , inj. diclofenac aqua ( 1 ml ) , inj. diclofenacc sodium 2ml ampl , inj. dicyclomine ampl , inj. dicyclomine hydrochloride 10 mg 2ml , inj. dilantin sodium100 mg , inj. dizepam , inj. dobutamine , inj. dopamine ampl , inj. drotaverine , inj. e mal , inj. efcorlin 50mg , inj. endpoprost inj , inj. epitrate , inj. etophylline + theophylline 220mg ( 169.4+50.6 mg ) , inj. fluconazole 100ml , inj. fortwin ampl , inj. furosemide 2ml , inj. fusemide vial , inj. gardinal , inj. gentamicin 10 mg , inj. gentamicin 40 mg , inj. gentamycine 20 mg. vial , inj. gentamycine 80 mg. vial , inj. glycopyrrolate , inj. haloperidol 5mg , inj. hemsyl , inj. hydro cortisone , inj. hydrocort 100mg , inj. hynidase , inj. hyprosol 5ml , inj. i.v. ciprofloxacine , inj. immunoglobin ampl , inj. insulin primixed ( 30 / 70 ) , inj. iron sucrose , inj. kcl , inj. ketamin ( 2ml ) ampl , inj. ketamin inj. ( 10ml vail ) , inj. ketorolac ( 1 ml ) , inj. k nate ( phytomenadione ) 1ml , inj. labatalol , inj. lasix ampl , inj. levipil , inj. levitiracetam , inj. lignocaine adrenaline , inj. lorazepam 2mg , inj. magnesium sulphate ampl , inj. megazid xp , inj. mephentermine , inj. meropenam 1gm , inj. meropenam 250 mg , inj. meropenem 125 mg , inj. methergin , inj. methyl ergometrine ampl , inj. metochlopramide ampl , inj. metoclopramide 10mg , inj. midazolam , inj. moxifloxacin , inj. multivitamin ampl , inj. nacphin 10 mg , inj. naloxone , inj. neostigmine ampl , inj. netromycin 10 mg , inj. netromycin 25 mg , inj. norad 2mg , inj. ondansetron ( 4 mg ) , inj. ondansetron ( 8 mg ) , inj. ondem 2mg , inj. ondem 4mg , inj. ondensetron ampl , inj. oxytocin ampl , inj. pam , inj. pantoprazole with watervial ( 40 mg ) , inj. perinorm ampl , inj. phenargan ampl , inj. phenobarbitone , inj. phenraminemaleate ampl , inj. phenytoinampl , inj. pilocarpine , inj. promethazine 25mg , inj. propofol , inj. prostadin , inj. ranitidine ampl , inj. sensrocain ( 30 ml ) vial , inj. sodium bicarbonate ampl , inj. sodium chloride ampl , inj. termin , inj. tetvac ampl. , inj. tetvac vial , inj. theophyillin + ethophyillin ampl , inj. thiamine , inj. tramadol ampl / vial , inj. tranexa , inj. vitamin k1 1 mg / 0.5 ml ( phytonadione ) , inj. xylocaine 2% ( plain ) , inj. xylocard 2 % , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , iron drop , isolyte p ( 500ml ) , itraconazole cream , iv ciprofloxacine ( 100 ml ) , iv mannitol ( 100ml ) , iv mannitol ( 300ml ) , iv metronidazole ( 100 ml ) , keratome 2.8mm disposable , lam / i gel 01234 , lancet ( 100 pcs ) , leclyete m ( 100 ml ) , leclyete p ( 100ml ) , leishmans stain ( 500 ml ) , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , levipil syrup , lidfast jelly , loperamide , lotion. benzyl benzoate ( 1000 ml ) , lox 2%with adrenaline , luglos iodine solution ( 100 ml ) , luliconazole cream , lysol 500ml , m.c. lotion400ml , m.p pf / pv card antibody ( 100 pcs ) , m.p pf / pv card antigen ( 100 pcs ) , mackintosh sheet ( 1 meter ) , magills forceps large , magills forceps small , malaria pf / pv antibody card rapid test ( 50 kits ) , malaria pf / pv antigen card rapid test ( 30 kits ) , malecot catheter different sizes , maleria stain kit jsb ( i ) , maleria stain kit jsb ( il ) , memantine , mersilk ( 1 0 ) , mersilk ( 1 no ) , mersilk ( 1 no ) , mersilk ( 2 0 ) , mersilk ( 8 0 ) , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue ( 500 ml ) , miconazole ointment 10gm , miconazole ointment 30gm , micro pipette ( 10 1000ul tips ) , micro pipette ( 10 100ul tips ) , micropore 1 inch , micropore 1 / 2 , micropore 2 , morphine , moxifloxacin eye drop , mucus sucker , multivitamin drop , n / 10 hydrochloric acid , n / 2 , n / 4 , nasal normal saline drop ( 10 ml ) , nasal prongs ( neonats ) ( cannula ) , neaomycineoint , neaomycinepowder , nebulizer set , needle curved , needle straight , neomycin ( 5 mg + 500 iu / g ) 15gm , neospsrin powder 100gm , new born diaper , nitroglycerin , noscapine drop1.83 mg / ml , noscapine linct7mg / 5ml , ofloxacin + dexamethasone ear drops , ors , ors adult 21 24 gm pack , ors ( pedartic pack ) , oxygen mask adult , oxygen mask child , paraffin mesh , pedia set , permethrin lotion 5% , phenyl 5 litre , phenylephrine , plain catgut ( 1 0 ) , plain catgut ( 2 0 ) , plain catgut 1no , plain vial , plasma volume expendore 500 ml , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , pottasium permagnate ( 400gm ) , povidone iodine lotion 500ml , pregnancy kit , prolene ( 2 0 ) , prolene ( 1no ) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene ( 1 0 ) , pyrethrum extract 2% , pyronate , ra latex ( span ) ( 20 kits ) , rbc diluting fluid , rhyles tube16 no. , rivastigmine , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , salbutamol inhaler , saline d.n.s. ( 500ml ) , saline dextrose 10% ( 500ml ) , saline dextrose 5% ( 500ml ) , saline ns ( 500ml ) , saline rl ( 500ml ) , saline set , sanitary napkin pad , antiseptic liquid 500ml , shoe cover disposable , side port disposable , silver sulfadiazine 1% cream 100gm , silver sulfadiazine 1% cream 20gm , silver sulfadiazine 1% cream 500gm , silverex ointmet ( burning ) ( 20gm ) , silverex ointmet ( burning ) ( 500gm ) , slide dying rack , sodium calcium hypochloride ( 5 litre ) , soframycin cream , sofratulle mesh , specimen collection bottle , spinal needle 25 g , spirit 100 ml , spirit 1000 ml , spirit ( methylated ) 1000ml , sprit lamp , stritching thread , stylet , suction catheter , suction tube6fr , suction tube 8 fr , sulphar powder 100 gm , surgeon cap , susp levosalbutamol ambroxol , susp. albendazole 400mg 10ml , susp. amoxycilline 60ml , susp. antacid 170 ml , susp. antacid 200 ml , susp. azithromycin ( 200 mg ) 30 ml , susp. bromhexine hydrochloride 4mg / 5ml , susp. calciumcarbonate +vitamin d3 calcium 250 mg+vit d3 125 iu / 5 ml , susp. cefixime 50mg 30ml , susp. cephalexin 125ml / 30ml , susp. cetrizine 30ml , susp. co trimoxazole ( trimethoprim 40mg+ sulphamethoxazole 200mg ) 100 ml , susp. co trimoxazole 50ml , susp. cough syrup child , susp. dexchlorpheniramine maleate 0.5 mg / 5ml , susp. digene , susp. domperidone ( 30ml ) , susp. ibuprofen 100mg / 5ml , susp. iron folic acid 200ml , susp. levitiracetam , susp. levocetrizine , susp. methadone , susp. metronidazole 30ml , susp. montelukast , susp. ofloxacin + metronidazole 30 ml , susp. paracetamol 125mg 60ml , susp. pheniramine maleate 15 mg / 5ml , susp. phenobarbitone , susp. salbutamol sulphate 100ml , susp. vitamin a 100000 iu / ml , syringe 50ml , syusp. clobazam , t bact ointment , tab. aceclofenac ( 100 mg ) , tab. acetyl salicylic acid 300mg , tab. aciloc, 150mg. , tab. albendazole ( 400 mg ) , tab. alprazolam 0.25 mg , tab. aluminium hydroxide+ magnesium hydroxide 400mg , tab. amitriptyline 25 mg , tab. amlodipine ( 10mg ) , tab. amlodipine ( 5mg ) , tab. amoxy 250 mg dt , tab. amoxycilline + clavulanic acid ( 325 mg ) , tab. amoxycilline + clavulanic acid ( 625 mg ) , tab. anaspas , tab. antacid , tab. anti cold , tab. artesunate 100mg , tab. artesunate 200 mg , tab. artesunate 25 mg , tab. artesunate 50 mg , tab. ascorbic acid 500 mg , tab. atenolol ( 50mg ) , tab. avil ( chalpheniramin ( 25 mg ) , tab. azithromycine250 mg , tab. azithromycine 500mg , tab. bisacodyl5mg , tab. buprenorphine , tab. calcium carbonate 500mg , tab. calcium d3 500mg. , tab. carbamazepine 200mg , tab. cefadroxyl 250mg , tab. cefadroxyl 500mg , tab. cefixime ( 100mg ) , tab. cefixime ( 200 mg ) , tab. cefixime ( 50 mg ) , tab. cefuroxime axetil250mg , tab. cefuroxime axetil500 mg , tab. cephalexin 500 mg , tab. cepodoxime proxetil , tab. cetrizine 10mg. , tab. chloroquine 300mg , tab. chloroquine phosphate 150 mg , tab. chromostat , tab. cipro 500mg + tz 600mg , tab. ciprofloxacin hydrochloride 250mg , tab. ciprofloxacin hydrochloride 500mg , tab. ciprofloxacine ( 250mg ) , tab. ciprofloxacine ( 500 mg ) , tab. clobazam , tab. clomipramine 25mg , tab. clonazepam 0.5 mg , tab. compose , tab. co trimoxazole ( trimethoprim 80mg + sulphamethoxazole 400mg ) , tab. co trimoxazole ds , tab. co trimoxazole ss , tab. deriphylline 150 mg , tab. deriphylline 300 mg , tab. diamox 250 mg , tab. diazepam ( 2 mg ) , tab. diazepam ( 5 mg ) , tab. diclofenac sodium 100 mg , tab. diclofenac sodium 50 mg , tab. diclofenac sodium 75 mg , tab. dicolofenae sodium ( 50mg ) , tab. dicolofenc + paracetamol , tab. dicyclomine , tab. dicyclomine + paracetamol , tab. dicyclomine hydrochloride 10 mg , tab. diethylcarbamazine citrate 100 mg , tab. dilantoin sodium ( 100 mg ) , tab. domperidon ( 10mg ) , tab. domperidone 10mg , tab. doxycycline ( 100 mg ) , tab. drotaverine ( 40 mg ) , tab. ecospirin ( 75 mg ) , tab. erythromoycin250 mg , tab. escitalopram 5 mg , tab. escitalopram 10 mg , tab. carbamezapine 25 mg , tab. etophylline + theophylline 100 mg ( 77+23 mg ) , tab. etophylline + theophylline 150 mg sr , tab. etophylline + theophylline 300 mg sr , tab. famotidine ( 40 mg ) , tab. famotidine 20 mg. , tab. fluconazole 150 mg. , tab. fluoxetine 20 mg , tab. folic acid 5mg , tab. folic acid large , tab. furosemide 40mg , tab. glibenclamide 5mg , tab. glimepride ( 2 mg ) , tab. glyceryl trinitrate 0.5 mg , tab. griseofulvin 250mg , tab. haloperidol 5mg , tab. hydrochlorothiazide 12.5 mg , tab. hydrochlorothiazide 25 mg , tab. ibuprofen 200mg , tab. ibuprofen 400mg , tab. ibuprofen 400mg + paracetamole 325mg , tab. imipramine25mg , tab. ketrolac ( 50 mg ) , tab. labetalol 100mg , tab. lanoxin0.25mg , tab. lasix 40 mg , tab. levitiracetam , tab. levocetrizine 5mg , tab. levofloxacin ( 500mg ) , tab. levofloxacine 250mg , tab. lithium carbonate 300mg , tab. lorazepam 2mg , tab. losartan potassium 50mg. , tab. metformin ( 500 mg ) sr , tab. methyl prednisolone 4mg , tab. methyl prednisolone 8mg , tab. metoclopramide 10mg , tab. metronidazole ( 200mg ) , tab. metronidazole ( 400mg ) , tab. mifepristone 200mg , tab. misoprostol 200μg , tab. naltrex1one , tab. nefedipine 20 mg , tab. nitrocontin ( 2.6 mg ) , tab. norfloxacin 400 mg+ tinidazole 600 mg , tab. ofloxacin100mg. , tab. ofloxacin 200mg , tab. ofloxacin 400mg , tab. ofloxacin 200mg + ornidazole ( 500mg ) , tab. olanzapine 5 mg , tab. olanzapine 10mg , tab. olanzapine 7.5 mg , tab. phenytoin sodium 100 mg , tab.resperidone 1 mg , tab.resperidone 2 mg , tab.resperidone 4 mg , tab. ondansetron ( 4 mg ) , tab. ondansetron ( 8 mg ) , tab. ornidazole 500mg , tab. p.c.m. d.t. ( 250 mg ) , tab. p.c.m. d.t. ( 500 mg ) , tab. p.c.m. d.t. ( 600 mg ) , tab. pantoprazole 40mg , tab. paracetamol ( 500mg ) , tab. paracetamol ( 650mg ) , tab. pheniramine maleate 25mg , tab. pheniramine maleate 50mg , tab. primaquine 2.5mg , tab. primaquine 7.5mg , tab. ranitidine ( 150mg ) , tab. risperidone 2mg , tab. risperidone 4mg , tab. roxythromycine 150mg , tab. roxythromycine 300mg , tab. salbutamol 4mg , tab. sodium valproate 200mg , tab. sodium valproate 500mg , tab. sorbitrate ( 5 mg ) , tab. stemetil m.d , tab. telmisarten ( 20 mg ) , tab. telmisarten ( 40 mg ) , tab. terbinaffine 250mg , tab. thiamine , tab. tinidazole 500mg , tab. tranaxaemic acid + mefenamic acid , tab. tranexamic acid 250 mg , tab. tranexamic acid 500 mg , tab. trihexyphenidyl 2mg , tab. vitamin b complex , tab. voglibose ( 2mg ) , tab. voglibose ( 3mg ) , tab. wysolone 10mg , tab. wysolone 20 mg , tab. wysolone 5 mg , tab. zinc sulfate 20mg , tab. zinc sulphate ( 20 mg ) , tab. zolpidem 10mg , tarpin oil 1000 ml , test tube ( khan tube ) , test tube ( khan tube ) 2.5 3 ml , test tube ( khan tube ) 3 4ml , test tube holding clamp , test tube rack , thiopentone , thrombophob ointment , tissue paper roll , tourniquet , tramadol , trece ostomy tube set , tripane blue ( blue day , ultrasound jelly , underwater 1c drain for chest tube , urea ( creast ) , uric acid ( span ) , urine albumin & sugar test kit , urine pot , urine strip ( 100pc pack ) , uro bag , vdrl ( strip ) , vdrl ( syphilis ) card rapid test ( 100pcs ) , vdrl rapid card , vdrl rapid latex , vicryl ( 1 0 ) , vicryl1no , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl ( 2 0 ) , vitamin d drop , water for injection 5ml , wax ear drop , wbc diluting fluid , westergrens tube , widal kit ( span ) , wooden spatula , x ray cassttee ( 08x10 ) , x ray cassttee ( 10x12 ) , x ray cassttee ( 12x15 ) , x ray plates ( 08x10 ) , x ray plates ( 10x12 ) , x ray plates ( 12x15 ) , xylocain jelly 5% , xylocaine jelly2% , xylometazoline nasal drop adult , yellow tips for micropipette , temophos 25 ltr , bti ( as ) for polluted / non polluted water , bti ( wp ) for polluted / non polluted water , swab , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , towel ( 24x18 ) , plastic mug 1 ltr , plastic bucket 20 ltr , anteseptic soap 75 gm , intravenous paracetamol , plastic sputum container with sticker , lence paper , potasium per magnate , zipper pouch , falcun tube , parafin liquid 1000 ml , marker pen for pulse polio , oxygen regulator with flow meter , a4 paper , tag , pen , plastic folder , writing pad , non chlorinated biohazard bags black size 80kg , non chlorinated biohazard bags blue size 80kg , non chlorinated biohazard bags red size 80kg , non chlorinated biohazard bags yellow size 80kg , non chlorinated biohazard bags black size 2litre , non chlorinated biohazard bags red size 2litre , non chlorinated biohazard bags black size 40kg , non chlorinated biohazard bags blue size 40kg , non chlorinated biohazard bags red size 40kg , non chlorinated biohazard bags yellow size 40kg...

Ministry Of Petroleum And Natural Gas - Jharkhand

29318858 bids are invited for oxygen gas regulators , ventury medical oxygen mask , patient stretcher trolley , wheel chairs rev 1 , nasal oxygen cannula , nabulizer , nebulizer mask and accessories , ecg machine , waste containers or rigidliners dust bin or garbage bin or household bin is 12402 ,patient bed (fowler and semi fowler) , patient caremattresses total quantity : 4497...

District Mineral Foundation Trust - Jharkhand

29171232 supply of items 1 a. bubble cpap with high frequency nasal oxygenation device b. high frequency nasal cannula (paediatric) c. high frequency nasal cannula (neonatal) 2 2 para monitors with pediatric wrist probe 3 bed side monitor stand 4 arterial blood gas machine 5 a. neonatal ventilator with humidifier b. disposable circuit 6 endotaracheal tubes (uncuffed) 7 endotaracheal tubes (cuffed) 8 multiliumen central venous catheters (guide wire) 9 paediatric infusion set/ paediatric drip set 10 advanced cardiac life support ambulance 11 3 seater chair 12 patient examination table 13 patient stretcher 14 patient wheel chair 15 printer (laser) b&w 16 ppe kit 17 face shield 18 disposable head cap 19 gloves 20 gloves disposable 21 gloves 22 almirah 23 water cooler 24 visiting chair 25 examination stool 26 cpap/bipap machine 27 high flow mask 28 nebulizer mask 29 heavy duty extension wire 30 medicine tray with trolly 31 sanitisation machine (spray machine) 32 color coated bin 33 small dustbin 34 iv cannula 26 no. 35 iv set 36 automatic analizer machine 37 paediatric oxygen mask 38 paediatric nebulizer 39 paediatric nasal prangs 40 bed sheet 41 blanket 42 shoe cover 43 disposable bedsheet 44 oxygen flow meter 45 disposable apron 46 reusable mask (cotton) 47 ot light 48 a. pediatric ventilator with humidifier b. disposable circuit 49 mattress (general bed) a 50 mattress (general bed) b ...

Department Of Health - Jharkhand

29085674 rate contract for medicines and consumables2 tab. paracetamol ( 250 mg ) 3 inj. ranitidine ( 25 mg / 2ml ) 4 inj. amlkacin ( 250 mg / 2 ml ) 5 cap. amoxicillin ( 250 mg ) 6 cap. amoxicillin ( 500 mg ) 7 tab. azithromycin ( 250 mg ) 8 tab. fluconazole ( 150 mg ) 9 tab. losartan potassium ( 50 mg ) 10 tab. ofloxacin ( 100 mg ) 11 tab. ofloxacin ( 200 mg ) 12 tab. calcium carbonate ( 500 mg ) 13 syrup domperidom ( 30 ml ) 14 syrup ofloxacin ( 30 ml ) 15 syrup salbutamol sulphate ( 100 ml ) 16 tab. clopidogrel ( 75 mg ) 17 tab. atorvastatin ( 10 mg ) 18 tab. erythromycin estolate ( 500 mg ) 19 inj. gentamicin ( 40 mg / ml ) 20 tab. metformin ( 500 mg ) 21 tab. calcium & vit d3 250 mg ( each ) 22 syrup metoclopramide ( 5mg / 30ml ) 23 inj. ceftriaxone ( 1 gm ) with water 24 inj. ceftriaxone ( 125 mg. / 5 ml ) with water 25 inj. ceftriaxone ( 250 mg. ) with water 26 inj. ceftriaxone ( 500 mg. ) with water 27 tab. ciprofloxacin ( 250 mg. ) 28 tab. domperidone ( 10 mg. ) 29 tab. paracetamol ( 500 mg ) 30 tab. prednlsolone ( 5 mg ) 31 tab. prednlsolone ( 10 mg ) 32 tab. prednlsolone ( 20 mg ) 33 tab. azithromycin ( 500 mg ) 34 syrup. b complex 100 ml ( each ) 35 inj. tramadol ( 50 mg ) 36 suspension albendazole ( 200 mg / 60 ml ) 37 tab. famotidine ( 20 mg ) 38 inj. gentamicin ( 80 mg / ml ) 39 tab. ibuprofen ( 200 mg ) 40 tab. ibuprofen ( 400 mg ) 41 tab. metronidazole ( 200 mg ) 42 tab. metronidazole ( 400 mg ) 43 tab. multivitamins ( as per schedule v of drugs and cosmetics rules ) ( 1 tab ) 44 syrup paracetamol ip 125 mg ( 60 ml ) 45 tab. ciprofaloxacin ip + tinidazole ( 500 mg.+600 mg ) 46 tab. ciprofloxacin ( 500 mg. ) 47 cap. tramadol 100 mg 48 inj. paracetamol 10 ml 49 inj. metoclopramide5mg 50 tab. co trimoxazole ds ( 160 mg.+800 mg. ) 51 tab. co trimoxazole ss ( 80 mg.+400 mg. ) 52 tab. norfloxacin ip + tinidazole ( 400 mg+600 mg. ) 53 inj. amikacin ( 500 mg ) 54 tab. cetirzine ( 10 mg ) 55 tab. nimesulide + paracitamole ( 100mg+325mg ) 56 cough supressent ( dextromethorphan based ) ( 60ml ) 57 ors powder ( 16 gm. pkt. ) 58 tab. accelofenace+ para ( 100 mg + 325 mg ) 59 tab. ibuprofen ip+ paracetamol ip ( 400 mg.+325 mg ) 60 tab. ranitidine ( 150 mg. ) 61 tab. amoxycillin+ clavulanic acid ( 500+125 mg ) 62 tab. amoxycillin+ clavulanic acid ( 250+125 mg ) 63 cap. omeprazole ( 20 mg ) 64 tab .paracetamol + diclofenac sodium ( 500 mg.+50 mg ) 65 tab. dicyclomine hydrocloride.+ paracetamol ( 20 mg.+325 mg. ) 66 inj. diclofenac ( 25 mg / 3ml ) 67 syp. cotrimoxazole ( 50 ml ) 68 tab. misoprostal ( 200 gm ) 69 tab. salbutamol ( 4 mg ) 70 inj. ondansetron ( 4mg ) 71 inj. dicyclomine ( 10 mg ) 72 tab. iron folic acid 73 tab. folic acid 400 microgram 74 tab. iron 75 syp. amoxicillin 125 mg / 30 ml 76 tab. norfloxacin 400 mg 77 tab. enalapril maleate 5 mg 78 cap. amoxy 250 + cloxy 250 79 cap ampi 250 + cloxy 250 80 inj. human rabies immunoglobulin ( 300 iu / 2 ml ) 81 inj. human tetanus immunoglobulin ( 250 iu / 2 ml ) 82 inj. human tetanus immunoglobulin ( 500 iu ) 83 inj. human tetanus immunoglobulin ( 1000 iu ) 84 inj. hepatitis b immunoglobulin ( 200iu / 1ml ) 85 syp. nimesulide + para 60 ml 86 tab. phenoxymethylpenicillin potassium 250 mg 87 inj. anti imnuoglobin 250 mg 88 inj. anti imnuoglobin 1 gm 89 tab. zinc sulphate 50 mg 90 tab. chloroquine 150 mg 91 tab. albendazole ( 400 mg ) 92 syrup cetrizine ( 30 ml ) 93 tab. amlodipine ( 5 mg ) 94 inj. pentazosin ( amp ) 95 tab. cephalexin ( 500 mg. ) 96 inj. equine rabies immunoglobulin ( 1500 iu / 5 ml ) 97 tab. ondansetron ( 4 mg ) 98 inj. ampicillin 500 mg 99 inj. ampicillin 250 mg 100 cap. ampicillin 500 mg 101 tab. tinidazole 102 tab. allopurinol 100 mg 103 tab. rabiprazole + domperidome 30 mg 104 inj. benzathine penicillin ( 6 lakh units ) 450 mg 105 inj. benzathine penicillin ( 12 lakh units ) 106 inj. anti imnuoglobin 1 gm 107 tab. cefexime 200 mg 108 tab. doxycycline 100 mg 109 tab. vitamin c 500 mg 110 tab. paracetamol ( 650 mg ) 111 inj. anti rabies vaccine with 5 syringe ( multi dose intra dermal 1 ml ) 112 cap tramadole 50 mg 113 inj. dexamethasone 4 mg 114 inj. oxytocin 2 ml 115 tab. cefexime 200 mg 116 inj. anti rabies vaccine withsyringe ( single dose intra muscular 0.5 ml ) 117 cap hydroxyurea 500 mg 118 inj. desferal 119 tab. foluite 5 mg 120 sample cup 121 allicote ( bullete tube ) 122 inj. effcorlin 123 oxygen nesal set neonetal adult 124 oxygen nesal set neonetal new born 125 inj. cefotexime 125 mg 126 inj. cefotexime 250 mg 127 inj. amikacin 100 mg 128 inj. aminofylin 10 ml 129 iv dextrose 10% 500 ml 130 inj. meropenum 500 mg 131 inj. meropenum 125 mg 132 oxygen hood 133 liga clip lt 300 134 liga clip lt 400 135 corogated drain disposable 136 corogated drain rubber 137 romo vac set 138 romo adk set 139 cotery pencil 140 cotery pad disposable 141 pmo line 142 disposable syringe 50 ml 143 disposable syringe 20 ml 144 3 way line connector 145 dextrose 25% 100 ml 146 iv isolyte p 500 ml 147 n / 4 ns 500 ml 148 inj. pipracillin + tazobactom 1.125 gm 149 inj. phenobarbiton 150 inj. phenytoin 100 mg 151 iv amninovein 10% ( 500 ml ) 152 inj. caffirate 153 inj. doubutamine 154 tube ciller 155 refrigertor graph paper 156 calpol suppository 157 duphalac suppository 158 neonate ecg lead 159 senitizer 5 liter jar 160 paraffin wax 161 formalin 162 xylene 500 ml 163 formalin 10% 164 absolute alcohol 165 hematoxylene stain 166 scotts tap water 167 eosin tap water 168 hcl 1% 169 dpx mount 250 ml 170 hmf sachet 1 gm 171 inj. xylocain 2% with adrinaline 172 sodium choride ( nacl, 500 ml per pkt. ) 173 disodium hydrogen phosphgate ( na2hpo4 ) , 500 gm per pkt. 174 sodium dihydogen phosphate ( nah2po4, 2h2o ) 500 gm pkt. 175 anthydrous ( k2 hp04 ) 500 gm pkt. ( potassium phosphate dibasci anhydrous 176 sponin 25 gm per pkt. 177 sodium dithionite 500 gm pkt. 178 micropippet 200 1000 ul. 179 micropippet 5 50 ul. 180 sodium fluoride vail ( non vacuum ) 2 ml ( 100 pc ) 181 citrate 3.2% vail ( non vacuum ) ( 100 pc pkt ) 182 urineanalyzer strip ( 10 para ) 183 hi aid ( medicated dressing ) 22 mm diameter 184 vidas t3 1x60 t ( mini vidas ) 185 vidas t4 1x60 t ( mini vidas ) 186 vidas tsh 1x60 t ( mini vidas ) 187 vidas fsh 1x60 t ( mini vidas ) 188 prolacin 1x60 t ( mini vidas ) 189 vit d 1x60 t ( mini vidas ) 190 d dimer 1x60 t ( mini vidas ) 191 ns troponin i ( mini vidas ) 192 covid ig g ( mini vidas ) 193 covid ig m ( mini vidas ) 194 p.t. vail 1x100 ( mini vidas ) 195 urine analyzer print paper roll 196 turniquat 197 syrup phenobarbitone 198 inj. nikethamide each 199 cutting and round body needle medium size each 200 ctg paper ( per pkt. ) 201 carbolic lotion 2% 202 tab ondencetron 4 mg 203 tab. deferasirox dispersible 500 mg 204 tab. nifedipine ( 5mg ) 205 inj. efipres each 206 inj ampicillin 125mg 207 inj.chromostate 208 tab. telmisartan 10 mg 209 syrp. vitamin a 100ml 210 tab. alprazolam 0.25 mg 211 tab. cephalexine 250 mg 212 esr tube disposable 213 cover slip small ( 100x1 pkt ) 214 rh view box 215 vial rack 216 bovine albumin 20% 100 ml 217 anti h 218 immerssion oil ( bottle ) 219 hemosafe sls 1 ltr 220 test tube 12x75 mm 221 test tube rack 222 triglyeerides kit 2x150 ml 223 tri sodium citrate 3.8% ( 500ml ) 224 a.b.d. ( 3x10ml ) 225 micro tips yellow ( 1000 pcs ) 226 micro tips blue ( 1000 pcs ) 227 widal antigen slide methed ( 4x5ml ) 228 urea kit 300 ml 229 tips ( 100 1000ul ) 230 petridish 231 inj. adrenaline 232 tab. drotavarin 233 drop dicyclomine 234 tsh ( 1x96 test ) 235 t4 ( 1x96 test ) 236 t3 ( 1x96 test ) 237 liquiplastin ( 5 ml ) 238 liquicelin e ( 5 ml ) 239 calcium chloride ( 5 ml ) 240 hcv kit ( 50 test ) 241 inj. medazolam 242 inj. propofol 10 ml 243 inj. phenargan 244 inj. fentanyle 245 inj. kcl 246 inj. heaparin 247 inj. pethedin 248 inj. glycopyrolet 249 inj. butrodol 1 ml 250 inj. butrodol 2 ml 251 inj. suceinyle cholene 252 inj. calmpose 253 pedia set 254 pedia mask 0, 1 255 feeding tube no. 5, 6 256 inj. noloxone 257 inj. butorphanal 258 inj. vecurouium 259 ryles tube adult no. 14, 16 260 amylase ( 50 test ) 261 lipase ( 50 test ) 262 recombinant factor viii ( 3rd generation dna origin ) 500 iu 263 recombinant factor viii ( 3rd generation dna origin ) 1000 iu 264 tab. defrijet 250 ( each uncoted tab. for oral suspension contains deferarirox 250 mg ) 265 tab. defrijet 500 ( deferasirox 500 mg ) 266 permethrin lotion 30 ml 267 soft cotton 4 268 soft cotton 6 269 ketokonazole soap 270 dns 0.45% 271 dns 10% 272 lh ( 1x96 test ) 273 fsh ( reagent ) 274 uric acid ( 5x20 ml ) 275 call counting machine ( manually ) 276 esr stand 6 tube capacity 277 bleading time test 278 helix pcd test ( conform to iso 13485 1class 2, 121c / 20 min, 134c / 3.5 min, shelf life 3 years after production, clear transition of pink into brown for steam, easy to interpret, easy to document, non toxic / lead free ) 279 chemical indicator ( shelf life 3 years after production, packed in an easy dispensing carton, clear colour transition of the emulator, non toxic / lead free ) 280 documentation labels ( process indicators ( steam ) , for steam 121 c 20 min & 134 c for 3.5 min, conform to iso 11140 1 class 1, clear transition of indicatorinto its end color, easy to use labe gun, double labels serve for an easy traceability and document 281 blood gas analyser card 282 blood gas analyser paper roll ( for printer ) 283 iv albumin 100 ml 284 plain catheter no. 10 285 casete with inensifying screen 12x15 286 casete with inensifying screen 12x12 287 casete with inensifying screen 12x10 288 casete with inensifying screen 8x10 289 developing tank ( 13.5 ltr. ) 290 digoxin 0.5 mg 291 calcium gluconateiv 1gm 292 inj. aminophyline each 293 tab. metoprolol 294 tab. aspirin 295 tab. hydrochlorthiazide 12.5 mg 296 tab. hydrochlorthiazide 25 mg 297 tab. enalapril 2.5 mg 298 tab. enalapril 5 mg 299 tab. captopril 300 tab. clopidogrel 301 tab. isosorbidedinitrate ( sorbitrate ) 302 tab. glyceryl trinitrat 303 tab. verapamil ( isoptin ) 304 inj. mephentine 305 tab. potasium ip ( pencylin v ) 306 inj. mannitol 20% 300 ml 307 tab. carbamazepine 308 syrp. carbamazepine 309 plain rubber urinary catheter each 310 mosquito repellent each 311 stainless steel small galley pot each 312 hiv rti / sti kitkit 1 grey a ) tab. azithromycin 1 gm tab. b ) tab. cefixime 400gm. 1 tab. 313 hiv rti / sti kitkit 2 green a ) tab. secnidazole 1 gm 2 tabs. b ) tab. fluconazole 150 mg1 tab. 314 hiv rti / sti kit ( kit 3 white a ) inj. benzathine penicillin 2.4 mu 1 no. b ) tab azithromycin 1gm. 1 tab. c ) sterile disposable syringe 10ml.21 g needle 1 no. d ) sterile water 10 ml. 1 no. ) 315 hiv rti / sti kitkit 4 blue a ) cap. doxyccline 100 mg. 30 caps. b ) tab. azithromycin 1gm. 1 no. 316 hiv rti / sti kitkit 5 red a ) tab. acyclovir 400 mg. 21 tab. 317 hiv rti / sti kitkit 6 yellow a ) tab. cefixime 400 mg 1 tab b ) tab metronidazole 400 mg. 28 tabs c ) cap. doxycycline 100 mg 2 tab 318 hiv rti / sti kitkit 7 black a ) cap. doxycycline 100mg 42 caps b ) tab. azithromycin 1 gm 1 no. 319 hcb card test ( 50 test ) kit 320 hydrocele operation kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalne 321 hernia kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 322 appendectomy bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 323 mva / eva for safe aboration sevice kit 324 ppiucd forcep set 325 rpr card test kit 326 whole blood finger prick test for hiv ( card test ) kit 327 tab. azithromycin 100mg 328 syrp. promethazine 60 ml 329 inj. spasmocare 330 syp. norbin power 30ml 331 ec lotion 100 ml 332 crepe bandage 333 tab. atenol 100 mg 334 tab. glimepride 5 mg 335 tab. premaquine 2.5 mg 336 tab. misoprostol 100 mg 337 inj. ketamin 10 mg 338 sputum container ( per pcs ) 339 drop bottle ( per 200 ml ) 340 filter paper ( per 100 pcs pkts ) 341 cyrstol phenol ( per 500 gram pack ) 342 ethanol ( per 500 ml pack ) 343 liquid praffine ( per 500 ml pack ) 344 basic fuchin powder ( per 25 gram pack ) 345 isoniazid 100 mg. tab ( per stip ) 346 isoniazid 300 mg. tab ( per stip ) 347 pyridoxine 100 mg tab. ( per stip ) 348 streptomycin injection 0.750 gram ( per vials ) 349 streptomycin injection 0.500 gram ( per vials ) 350 streptomycin injection 1.000 gram ( per vials ) 351 rifampicin 150 mg caps ( per stip ) 352 pyrazinamide 750 mg tabs ( per stip ) 353 rifabutine 150 mg caps ( per stip ) 354 clofazimine 100 mg. caps ( per stip ) 355 capreomycin 01 gram injection ( per vials ) 356 pyridoxine 50 mg. tabs ( per stip ) 357 pyridoxine 25 mg. tabs ( per stip ) 358 cepromycin 750 mg injection ( per vials ) 359 kanamycine 01 gram injection ( per vials ) 360 kanamycine 500 mg injection ( per vials ) 361 french chalk powder 1 kg 362 viscoelastic hypersole 363 flurabifrofen eye drop 5 ml 364 bitadin hand scrab 365 sprit 1 ltr. 366 tropiacil plus ( eye drop ) 367 bandage 3” 368 needle 26g 369 needle 24g 370 inj. hynidase 371 tab. allpharazolam 0.5 mg 372 inj. anawin ( 5% ) 30 ml 373 mma drugs for safe abortion services ( in combi pack 1 tab mifepristone 200 mg and 2 tab misoprostol 200 mcg each tab ) 374 respule salbutamol + iprapropiun 375 respule budenocide 376 enteroglemina 377 syrp. zinc sulphate 100 ml 378 inj. insulin 40 units / 10 ml 379 inj. insulin zinc suspension 40 unit / 10 ml 380 inj. betamethasone4mg / ml 381 inj. furosemide 10 mg / ml 382 inj. diazepam5 mg 383 inj. etophyllin + theophylline ( deriphyllin ) 384 inj. cloxacillin 250 mg 385 tab. methyldopa 250 mg 386 chloramphenicol eye ointment 250 mg 387 x ray film 8x10 ( blue ) ( 50 pc pkt. ) 388 x ray film 10x12 ( blue ) ( 50 pc pkt. ) 389 x ray film 12x12 ( blue ) ( 50 pc pkt. ) 390 x ray film 12x15 ( blue ) ( 50 pc pkt. ) 391 vicril no. 1 392 chromic catgut 0 2 393 drop paracetamol 15 ml 394 drop ondenstron 395 drop cough 15 ml 396 drop multivitamin 15 ml 397 drop oflox oz 30 ml 398 drop azithromycin 100 mg susp. 30 ml 399 drop enzyme 15 ml 400 drop enzyme 100 ml 401 drop amoxicillin 10 ml 402 drop cefexime oral susp. 30 ml 403 drop domperidone 404 inj. prostodine 405 inj. hydrocortisone 406 deshnet 1 ltr. jar 407 bt set 408 tamophose 50 ec ( 5 ltr. jar ) 409 disteel water 7.4 5 ltr. jar 410 povidine iodineoint15 gm 411 inj. drotaverin2 ml 412 utility gloves ( pair ) 413 perineal sheet 414 surgical mask disposable 415 head cap disposable 416 slipper ( pair ) 417 inj. atropine 0.6 mg 418 clotrimazole ointment 419 gypsona 6 420 gypsona 4 421 tab. pan 40 ( pantotrazole ) 422 inj. tranexamic acid 423 inj. vitamin k ( phytomenadione ) 424 inj. vitamin k 3 ( menadione ) 425 clotrimazole + gentamycin + beclometasone ointment 426 gentamycin eye / ear drop 427 sodium metabisulfate 500 gm 428 gentian violet 500 ml 429 glass slide ( per box ) 100 pcs 430 urine strip 2 para meter ( 100 test ) 431 urine strip 4 para meter ( 100 test ) 432 urine strip 10 para meter ( 100 test ) 433 saving blade 434 ecg gel 1 kg 435 inj. xylocain 2%30ml 436 sticking plaster ( surgical tape ) 2.5 cm x 9.10 m 437 cotton thred no. 10 438 gloves ( nitrile ) sterile 439 glovesnitrile ( non sterile ) 440 glovesnitrile ( non sterile ) 6.5 no. 441 glovesnitrile ( non sterile ) 7 no. 442 shoe covers. ( disposable ) 443 nitrile 120 mm 444 non sterille 280 mm 445 sterile surgical gloves 280 mm 446 service gloves 400 mm 447 disposable surgical head cap 448 mask surgical 3 lyer ( with nose clip ) 449 mask surgical 3 lyer ( without nose clip ) 450 n95 mask ( with nose clip ) 451 n95 mask ( without nose clip ) 452 mask cotton cloth 453 desnet 1 ltr. jar 454 roller bandage 4 455 roller bandage 6 456 duoline repsules 457 dextrose 25% ( 100 ml ) 458 ointment silverex ( 250 gm ) 459 tarpin oil ( 400 ml ) 460 inj. phenylphrine ( 1ml ) 461 inj. camolol 462 bt filter ( bacteria filter ) 463 inj. methergin 464 sodium chloride iv inj sodium chloride i.p 0.9% w 1 v 500 ml 465 inj. sterile water fori.p 5 ml 466 ferittin estimatiry elisa reagent 467 inj. aminophiline 468 umbilical cathether ( 100 pc ) 469 dropper 3ml plastic 470 medical abortion kit ( mifepristonemisoprostol ) ( per set ) 471 mma drugs kit ( content of the kitmifepristone, misoprostol ) ( per set ) 472 drop moxifloxcin eye ( 5ml ) 473 lubricant eye drop ( 5 ml ) 474 savlon ( 500 ml ) 475 dns ( 500 ml ) 476 ns ( 500 ml ) 477 5% dextrose ( 500 ml ) 478 iv set ( disposable ) 479 povidine iodine solution ( 500 ml ) 480 gouze than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 481 rl 500 ml 482 inj. ciprofloxacine iv 100 ml 483 plaster of paris 5 kg jar 484 surgical sprit 100 ml 485 leucoplastroll 4 486 leucoplast roll 2 487 urobag 488 endotracheal tube 2.5 489 malaria kit 490 bleaching powder ( 25 kg beg ) 491 nsv kit 492 developer13.5 ltr 493 fixture13.5 kg 494 chest stand flour model 495 safe flight 8x10 496 clip big 497 half flim bloker 12x15 498 half flim bloker 12x12 499 half flim bloker 12x10 500 half flim bloker 8x10 501 phenobarbitone inj. 2 ml 502 potassium chloride solution 503 inj. prostaglandin 205 mg 504 halothen i.p 0.01%ww 505 coppersulphate crystal for chemical cautery of umbilical stump 500 mg 506 ambubag with zero size 507 triple dye lotion 508 lead apron 509 clotrimezole ointment ( 15 gm ) 510 inj. prostadine each 511 mosquito repellent each 512 kelleys pad each 513 tab. methyl dopa each 514 senetiser 1 ltr. 515 inj. pipracillin + tazobactum 4.5 gm 516 intra cath canula & gauze no. 22 517 savlon ( 100 ml ) each 518 crup bandage 519 banaid 520 inj. donperidone 521 syrp. azithromycin 200 mg / 15ml 522 inj. azithromycin 500 mg 523 syrp. chlorphenatamin + dhenylephrione 60 ml 524 cap. ampicillin 250 mg 525 anti allergical cough suppresent 60 ml 526 syp. metronidazole 60ml 527 tab linezolid 600 mg 528 tab amlosafe at 529 tab deriphyllin 50 mg 530 tab dexamethasone 531 syp multivitamin 532 syp ondemsetron 533 tab vitazyme 534 syp hemfer 535 cap depin 5 mg 536 cap depin 10 mg 537 tab hcqs 200 mg 538 tab hcqs 400 mg 539 tab wysolone 10 mg 540 inj augmentin 1.2 gm 541 inj paracetamol 1 gm 542 inj mvi 543 inj dobutamine 544 inj lasix 545 inj termin 546 inj nitroglycerine 547 inj esmolol 548 inj amzodarone 300 mg 549 hydrogan pyroxide 100 ml 550 tab. glimepride 1 mg 551 tab. chlroquine 250 mg 552 tab. premaquine 7.5 mg 553 priking needle len set 554 syrp. erythromycin 60 ml 555 tab. erythromycin 250 mg 556 syrp. ibuprofen 60 ml 100 mg 557 2% xylocain jelly 30 gm 558 inj. anti snake venum 559 optimal test kit for malaria test of pw 560 anti d 10 ml 561 anti a 1 lactin 562 anti a 10 ml 563 anti b 10 ml 564 anti ab sera 10 ml 565 edta ( k3 ) non vaccutenor ( 100 pc pkt. ) 566 plain vial non vaccutenor ( 100 pc pkt ) 567 cloride vial non vaccutenor ( 100 pc pkt. ) 568 rh view box 569 vdrl ( rpr test 100 ) 570 blood grouping kit 571 bovine serum albumin 572 blood bag 573 sodium hypochloride 574 umbilical cord clamp 575 inj. hydrocortisone sucoinate 100mg 576 suction tube 577 mersilk 2.0, 1.0 cutting needle 578 n / g tube 5, 6 no. 579 test tube 3 / 4 inch ( 100 pcs ) 580 calcium 2x150 ml 581 w.b.c. diluting fluid 500 ml 582 test tube rack 583 widal koit span 4x5 ml 584 v.d.r.l ( shippils test strip one step ) 585 r.a. ( 1x50 test ) 586 s.g.pt kit ( 50 ml ) 587 uric acid kit ( 5x20 ml ) 588 triglyecride desgpopap ( 25 ml ) 589 alkaline phospohate ( 5x15 ml ) 590 leishman stain solution 500 ml 591 leishman stain solution 250 ml 592 sodium citrate 3.8% ( 500 ml ) 593 r.a. antigen ( 100 test ) 594 glucose antigen ( 2x200 ml ) 595 uric acid kit ( 20x2 ml ) 596 distilled water ( 5 ltr. ) 597 urea bun urease gldh ( 20x5 ) 598 urea dam mannual kit ( 125 ml ) 599 cholestral antiigen / kit ( 75 ml ) 600 hdl kit 50 ml 601 sgot 150 ml x 2 602 total protien 25 test 603 albumin 25 test 604 microprotein kit 25 test 605 crp test kit 25 test 606 aso titre kit 25 test 607 urine pot 608 tips ( 100 1000ul ) 609 silk thred ( make jonson & jonson ) 0 1, 0 2 610 pregency kit 611 inj. promethazine 25 mg / 2 ml 612 tab. trimethoprim 80mg & sulphamethoxazole 400 mg ( adults ) 613 inj. magsulph magnisium sulphate i.p 50% 614 inj. syntocinon inj. 615 iv compound sodiume lactate iv 500 ml 616 phenytoin sodium 2 ml 617 sodium bicarbonat iv 7.5% 10 ml 618 iv catheter ( jelco ) 25 no 619 ryles tube infant size 620 microdrip set 621 inj. sodibicarb 10 ml amp ( 7.5% ) 622 prolactin ( reagent ) 623 tissue paper ( each roll ) 624 cretinnine kit ( 50 test ) 625 billirubin kit ( 50 test ) 626 e.d.t.a vail 2 ml. ( 100 pc ) 627 h.c.l n / 10 ( 500 ml ) 628 spinal needle 25 no. 629 nosogastric tube no. 6 630 creatinine antigen / kit ( 2x500ml ) 631 glucose kit good / pod ( 4x250 ) test 632 capillary tube ( 100 pc ) 633 creatinine jaffees reaction 634 drop ciprofloxacin eye ( 5ml ) 635 drop gentamycin ear ( 5ml ) 636 tab. atenolol ( 25 mg ) 637 tab. atenolol ( 50 mg ) 638 surgical gloves disposable all size ( no. 6.5, 7, 7.5 ) pair 639 disposable gloves disposable all size ( no. 6.5, 7, 7.5 ) pair 640 disposable syring ( 1 ml ) 641 disposable syring ( 2 ml ) 642 disposable syring ( 3 ml ) 643 disposable syring ( 5 ml ) 644 disposable syring ( 10 ml ) 645 bandage than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 646 inj. metronidazole iv 100 ml 647 cotton400 gm 648 micropore 2 649 mucus sucker 650 bp blade 651 hiv rti / sti kit 652 lysol 400 ml 653 oxygen mask set ( complete set ) 654 infusion set with hypodermic needle 21g 1.5 655 intera kit, size 18 / 20 / 22 ( infusion therapy kit ) iv canulla 1 pc, canulla fixatar 1pc, syringe 5 ml 1pc, sterile alcohol swab 1pc, infusion set 1 pc 656 intra cath canulas gauze 18, 20 657 cord calmp 658 micro scalp veinset no. 26 ( buterfly ) 659 disposable delivery kit ( ddk kit ) ( content of the kit2 pair of gloveblade 1 pc carbolic soap 1 cord clamp 1 plastic sheets 2x2 mtr. ) 660 inj. anti d300 mg 661 tab. nifedipine 5 mg 662 tab. nifedipine 10 mg 663 inj. labetalol 100 mg 664 inj. labetalol 50 mg 665 inj. potassium chloride 666 inj. prostaglandin 205 mg 667 inj. dopamine 200 mg 10 ml 668 inj. betamethasone sodium phosphate 669 halothen i.p 0.01%ww 670 thiopentone sodium 500 671 coppersulphate crystal for chemical cautery of umbilical stump 500 mg 672 triple dye lotion 673 formalin ( 5 ltr. jar ) 674 inj. plasma volume expender 500 ml bottle 675 inj. bupivaccine 0.5% 20 ml 676 inj. avil each 677 inj. hydrocortisone succinate ( efcorlin ) each 678 inj. dopamine each 679 plain rubber urinary catheter each 680 mosquito repellent each 681 curved cutting needle each 682 inj. calcium sandoz each 683 inj. neostigmine each 684 inj. iron sukroj amp each 685 cidex 5 ltr. jar each 686 diclofenac spry 687 hiv rti / sti kitkit 2 green a ) tab. secnidazole 1 gm 2 tabs. b ) tab. fluconazole 150 mg1 tab. 688 hiv rti / sti kitkit & black a ) cap. doxycycline 100mg 42 caps b ) tab. azithromycin 1 gm 1 no. 689 inj. donperidone 690 inj. azithromycin 500 mg 691 tab. b. complex 692 lab scabe lotion 100 ml 693 tab. cefexime 100 mg 694 inj. pentoprazole 695 tab. pentoprazole 696 trimmer ( per pcs ) 697 spirit ( 100% ) ( per 5 ltrs ) 698 streptomycin injection 0.500 gram ( per vials ) 699 clofazimine 100 mg. caps ( per stip ) 700 inj augementine 1 gm 701 inj atracurium 702 inj noradrenaline 703 fulcon tube ( 50ml pot ) 704 mathylene blue ( 25 gram bottle ) 705 sulphuric acid conc. ( 500 ml bottle ) 706 phenol crystal ( 500 gram bottle ) 707 lense cleaning paper ( 100 pcs packet ) 708 ethanol ( ethyle alcohal ) 100% ( 500 ml bottle ) 709 sodium hypo chloride ( 5 ltr jar ) 710 slide staning trey aluminium 711 slide staining tray plastic 712 glass staning rode 713 drop bottle ( 500 ml ) 714 spirit lamp glass 715 water bath 716 slide stand 717 mahise 718 favi piravir tab 719 ivermectin tab 720 tab vitamin bcomplex 721 stain jsb 1 722 stain jsb 2 723 temephos 50% ec 1 liter 724 diflubenzuron 25% wp 1 kg 725 tab. asprin ( 75 mg ) 726 tab. captopril 2.5 mg 727 tab. methyldopa 500 mg 728 tab.atorvastatin 10 mg 729 glyceryl trinitrate inj, sub lingual tabs 730 inj. atropine sulphate 731 inj. digoxin 732 tab. digoxin 733 tab. potasium ip ( penicillin v ) 734 inj. insulin regular 735 insulin intermediate 736 inj. aminophylline 737 tab.folic acid 738 inj. benzathine benzyl penicillin 739 carbamazepine tabs, syrup 740 inj. lignocaine hydrochloride 741 tab prednisolone 742 promethazine tab, syrup, caps, inj. 743 tab atenolol 25 744 tab. metoprolol 25 745 tab methyldopa 250 mg 746 tab. frusemide 40 mg 747 inj. streptokinase 7.5 lac vial 748 inj. streptokinase 15 lac vial 749 inj. heparin sod 1000 iu 750 tab. issorbide dinitrate ( sorbitrate ) 10 mg 751 tab. issorbide dinitrate ( sorbitrate ) 5 mg 752 inj adrenaline 753 mixed human insulin 30 / 70 754 mixed human insulin 50 / 50 755 tab pioglitazone ( 15mg ) 756 tab. vildagliptin ( 50 ) 757 tab b complex 758 tab. methcoclamine 1500 759 tab. telmisatan 40 mg 760 anixide h 761 tab. escitelopam 5 mg 762 inj. penidure la6, la 12 763 tab. pantaprazole ( 400 ) 764 tab. pantaprazole + domeperidone 765 tab. ondacetron ( ondem ) 766 inj. pantaprazole 767 tab atorvastatin 10 mg+ecosprin 75 ( combined ) 768 tab. epselin ( 100 mg ) . 769 spyrometer 770 carbon monoxide breathe monitor. 771 nicotine gum 2 mg 772 nicotine gum 4 mg 773 nicotine patch 21 mg, 15 mg, 7 mg 774 nicotine inhaller 775 nicotine nasal spray 776 bypropion 150 mg 777 varenicline 0.5 mg, 1 mg 778 carbon monoxide breathe monitor. 779 nicotine gum 2 mg 780 nicotine gum 4 mg 781 nicotine patch 21 mg, 15 mg, 7 mg 782 nicotine inhaller 783 nicotine nasal spray 784 bypropion 150 mg 785 varenicline 0.5 mg, 1 mg 786 sputum container ( 50 ml pot ) 787 glass slide 788 fulcon tube ( 50 ml pot ) 789 mathylene blue ( 25 gram bottle ) 790 sulphric acid conc. ( 500 ml bottle ) 791 phenyle liquid ( 40% ) ( 5 ltrs jar ) 792 phenol crystal ( 500 gram bottle ) 793 d.m. water ( 5 ltrs. jar ) 794 lense cleaning paper ( 100 pcs packet ) 795 filter paper ( 100 pcs per packet ) 796 tissue paper roll 797 surgical spirit ( 100% ) 5 ltrs jar 798 auramin o ( 25 gram pack ) 799 ethanol ( ethyle alcohal ) 100% 800 hydro chloric acid conc. ( 500 ml bottle ) 801 potassium per manganate ( 500 gram bottle ) 802 basic fuchin ( 25 gram pack ) 803 liquid parafin ( 500 ml bottle ) 804 sodium hypo chlorite ( 5 ltr jar ) 805 slide staning trey 806 slide staning trey plastic 807 staning stand 808 glass staining rod only 15x2pcs 809 drop bottle ( 125ml. ) plastic 810 spirit lamp glass / ss 4oz. 811 forcap ( 6 ) ss disecting 812 water bath 2 rack capacity electrically operated 813 slide box ( 50 pc slide boxes ) plastic 814 slide boxes ( 100 pc slide boxes ) 815 scissor ( 8 ) ss 816 parmanent marker pen 817 funnel keep big ( glass ) sz 4 818 funnel keep big ( glass ) sz 6 819 slide stand aluminium 820 inj. hepatitis b immunoglobulin 100 iu / 0.5ml. 821 diluent for cbc machine 20 ltr 822 lyse for cbc machine 500ml. 823 cleaner for cbc machine, 5 ltr 824 cbc reporting paper ( per roll ) 825 mouth gag ss 826 test tube rack plastic 12.5mmx24hole 827 test tube rack plastic 12.5mm x48 hole 828 test tube rack plastic 15mmx24 hole 829 test tube rack plastic 15mmx48hole 830 test tube rack plastic 18mmx48hole 831 test tube rack plastic 18mmx24 hole 832 liquiplastin ( 5 ml ) 833 liquicelin e ( 5 ml ) 834 calcium chloride ( 5 ml ) 835 inj. heaparin 25000iu 836 call counting machine ( manually ) 5 key 837 bleading time test capilary tube 838 inj. heparin sod 5000 iu 839 inj. heparin sod 10000 iu 840 plain rubber urinary catheter each 841 stainless steel small galley pot 20 25ml. capacity 842 ecg paper ( schller ) ( per pkt. ) 843 hydro chloric acid conc. ( per 500 ml ) 844 crescent knife ( 2.6 ) 845 keratome ( 2.8 ) 846 side port ( 15 ) 847 trypan blue 848 iol lense pamma lense 849 viscoelastic hypersole 850 inj. hynidase 851 enteroglemina 852 ferittin estimatiry elisa reagent 853 umbilical cathether ( 100 pc ) 854 halothen i.p 0.01%ww, 250ml. 855 coppersulphate crystal for chemical cautery ofumbilical stump 500 mg, 500gm 856 drop gsb ear ( 10ml. ) 857 stainless steel small galley pot each 858 tab metron 500mg 859 ahg ( antihuman globulin ) , 5ml. 860 rh view box 861 measuring cylinder ( glass ) 100 ml 862 measuring cylinder ( glass ) 1000 ml 863 measuring cylinder ( glass ) 2000 ml 864 beaker glass ( 250 ml ) 865 bovine serum albumin 5ml. 866 blood bag single adult / paeditric 867 anti h lectin 5ml. 868 testube brush small / medium 869 testube brush big size 870 mersilk 2.0, 1.0 cutting needle 871 lab wash ( 500ml ) 872 esr tube disposable with cap 873 distilled water ( 5 ltr. ) 874 urea dam mannual kit ( 125 ml ) 875 microprotein kit 1x50ml. 876 tips ( 100 1000ul ) big size 877 iv catheter ( jelco ) 24 no 878 iv catheter ( jelco ) 26 no 879 glucose ( 1x9x50ml ) 880 serum bilirubin kit ( 35 test ) 881 micropipette fixed volume 882 micropipette variable volume 883 large microtips ( 1000 pc ) 884 small microtips ( 1000 pc ) 885 tissue paper ( each roll ) 886 call counting machine ( manually ) 5 key 887 bleading time test capillary tube 888 filtter paper 9 cm ( 100 pc ) 889 cappillary tube ( 100 pc ) 890 h.c.l n / 10 ( 500 ml ) 891 nosogastric tube no. 6 feeding tube 892 creatinine antigen / kit ( 2x500ml ) 893 glucose kit good / pod ( 4x250 ) test 894 capillary tube ( 100 pc ) 895 creatinine jaffees reaction 4x60ml. 896 cold box with ice pack 6 ltr 897 plain rubber urinary catheter 898 curved cutting needle each 899 gentian violet 30 ml 0.5% 900 ecg paper ( schller ) ( per pkt. ) 901 inj atracurium 2.5ml. 902 sodium hypo chloride ( 5 ltr jar ) 903 inj. diazepam 904 inj. promethazine 905 do syrup 60ml. 906 tab. amlodipine2.5 mg, 907 tab. amlodipine 5mg 908 tab. amlodipine 10mg 909 spyrometer disposable 910 plain vials ( 100 pc ) 911 floride vials ( 100 pc ) 912 floride vials non vaccum ( 100 pc ) 913 edta kj tube ( 100 pc pkt ) 914 plain vials 2 ml non vaccum ( 100 pc ) 915 vicryle 1 0 cutting needle 916 elisa ( hiv ) 4th genrationkit 1x96test 917 elisa ( hbsag ) kit ( 1x96 test ) 918 elisa ( hcv ) kit ( 1x96 test ) 919 elisa ( malaria ) kit ( 1x96 test ) 920 rpr latex kit ( 250 test ) 921 rapid ( hiv ) kit 922 rapid ( hbsag ) kit 923 rapid ( hcv ) kit 924 rapid ( vdrl ) kit, syphillis card test 925 rapid ( malaria ) kit 926 anti ab reagent 10 ml 927 anti ahg reagent 5ml 928 cupling jar plastic 5 slide cpacity 929 shalis method hb meter 930 gel card , ahg ( for cross match ) 931 gel card grouping ( forward & reverse ) 932 gelcard machine 8 card with warmer 933 gelcard machine 24 card with warmer 934 liss solution 935 labozent 500ml. 936 plastic tub 937 pasteur pipette 938 apron ( lab coat ) 939 tube sealer ( portable ) 940 glucon d 100gm 941 emergency medicine box 942 centifuse machine 16 channel r8c model 943 chemical balance machine 944 hot air oven 945 pap smear ( cyto brush +spetula ) 946 glass slide pkt of 50 947 eosin stain yelllow 100 ml 948 heamotoxilline harris 500ml 949 isoprofile ( propen 2 ol 500ml 950 inj. tetvac vial 5ml 951 inj. rabis immunoglobin 1500 iu 952 inj. amikacine 100mg 953 autoclave lable 954 tournicate valcro 955 antibiotic disc 956 culture plate disposable90 mm 957 culture plate glass 100 mm 958 maconkey agarv powder 500gm 959 maconkey agarv powder 100 ml 960 grams iodine100ml 961 grams iodine powder 962 cristel violate100ml 963 cristel violate powder 25gm 964 sodium citrate vial ( pt vial ) non vaccum 965 sodium citrate vaccum 966 alliequet vial 967 trop i 968 trop t 969 amkitdw plant 970 pm kitdw plant 971 phosphorus 10x12 ml 972 gamma gt 2x44 / 2x11ml 973 magnesium 2x44ml 974 uibc 125ml 975 ldh 2x44 / 2x11ml 976 serrum iron 125 ml 977 lipase 1x44 / 1x11ml 978 amylase5x22ml 979 ferritin 980 ferritin calibrator 981 ferritin control l 982 ferritin control h 983 erythromoietin...

Health Department - Jharkhand

29085671 rate contract for medicine and consumables 1 injection 2 inja barteether150mg. 3 injadrenaline. 4 injamikacin100mg. 5 injamikacin 250mg. 6 injamikacin500mg. 7 injamoxycillin500mg. 8 injamoxycillin+clavulanicacid ( 1.2gm ) 9 injamoxycillin+cloxacillin ( 250mg.each ) 10 injampcillin+cloxacillinneonet. 11 injamphotericinb10mg 12 injamphotericinb25mg10ml 13 injamphotericinb50mg10ml. 14 injamphotericinbcrystal 15 injamphotericinblipidcomplex10mg 16 injamphotericinblipidcomplex25mg 17 injampicillin ( 500mg ) 18 injampicillin+cloxacillin ( 125mg.each ) 19 injampicillin+cloxacillin ( 250mg.each ) 20 injampicillin+cloxacillin ( 500mg.each ) 21 injantirabbiesvaccine 22 injantisnakevenomserumlypholised 23 injartemether40mg. 24 injartemether80mg. 25 injartisunate60mg. 26 injatropinsulphate. 27 injazithromycin500mg 28 injbetamethasone 29 injcalciumgluconate. 30 injcamylofindihcl. 31 injcefepime1gm 32 injcefepime+sulbactum 33 injcefepime+tazobactum1.125gm 34 injcefoperazone+sulbactum1.5gm 35 injcefoperazone1gm. 36 injcefoperazone+tazobactum1.125gm. 37 injcefopodoxime+clavulanicacid 38 injcefotaxime125mg. 39 injcefotaxime1gm. 40 injcefotaxime250mg. 41 injcefotaxime500mg. 42 injcefotaxime+sulbactum ( 1gm+500mg ) 43 injcefpirom 44 injceftazidime1gm. 45 injceftriaxone ( 1gm. ) 46 injceftriaxone125mg. 47 injceftriaxone250mg 48 injceftriaxone500mg. 49 injceftrioxone+sulbactum ( 1gm+500mg ) 50 injceftrioxone+tazobactum ( 1gm+500mg ) 51 injcefuroxime250mg 52 injcephazolin500mg 53 injchloroquine40mg / ml 54 injciticholine 55 injclarithromycin1gm 56 injclindamycin100mg 57 injclindamycin300mg 58 injclindamycin600mg 59 injclonidine 60 injcloxacillin250mg 61 injcloxacillin500mg 62 injdexamethasone4mg / 2ml 63 injdexamethasone8mg / 2ml 64 injdiazepam. 65 injdiclofenacsodium75mg / 3ml 66 injdiclofenacsuppository50mg 67 injdiclofenaceaqous 68 injdicyclomine10mg / ml 69 injdoxycycline100mg 70 injerythropoeitin4000alpha 71 injerythropoeitin4000beta 72 injerythropoeitin4000thermostat 73 injesomeprazole40mg 74 injesomeprozle40mg 75 injetophyllin+theophyllin. 76 injfrusemide 77 injgentamycin40mg. 78 injgentamycin80mg. 79 injheparin25000iu 80 injheparin5000iu 81 injhydrocortisone100mg 82 injinsulin50 / 50regularnphpremixedvile40u10mlvile 83 injinsulin50 / 50regular / nphcartridge4pen100u3ml 84 injinsulinhumanactrapid. 85 injinsulinhumanmixterd 86 injintraconozole200mg / 20ml 87 injirondextran50mg 88 injironsucrose 89 injlignocaine2%30ml 90 injlignocaine2%withadrenaline 91 injlowmolecularweightheparin0.4mg / 40ml 92 injlowmolecularweightheparin0.6mg / 60ml 93 injmagnesium.sulphate. 94 injmecoblamine1500gm 95 injmeropenam1gm 96 injmeropenam250mg 97 injmeropenam500mg 98 injmeropenam+clvulanicacid 99 injmethylprednisolane1gm 100 injmethylprednisolane500mg 101 injmethylcobal. 102 injmetoclopramide. 103 injmidazolam10mg / 10ml. 104 injmultivitamin 105 injondansetron. 106 injoxytocin 107 injpantoprazole40mg. 108 injparacetamol75mg / 2ml 109 injparacetamolsuppository 80mg 110 injpentazocine. 111 injpheniraminemaleate. 112 injpiperacillin+tazobactam1.125gm 113 injpiperacillin+tazobactam4.5gm. 114 injrabeprazole. 115 injrabeprazole. 116 injranitidine. 117 injregularinsulin40iu / ml 118 injremdisivir100mg 119 injroxithromycin 120 injsalbutamol. 121 injsalbutamol+ipratropiumsolution250mcg / 1ml 122 injstemetil 123 injstreptomycine0.75mg. 124 injsuccinylcholine. 125 injsulbactum500mg+cefoperozone500mg 126 injtetnusantitoxin 127 injtetnustoxoidevaccine. 128 injthiamine100mg / ml 129 injthiamine200mg / ml 130 injtramadolhcl50mg / ml 131 injtranexamicacid 132 injtriamcinlone 133 injvancomycin500mg. 134 injvitamin a50000iu / ml 135 injvitamin c1.5gm 136 injvitamin k1mg / 0.5ml 137 injvonconazole 138 tablets & capsules 139 aceclofenac+paracetamol 140 aceclofenac+serratiopeptidase 141 acetylcysteine 142 acetylsalicylicacid 143 acyclovir800mg. 144 albendazole400mg. 145 alprazolam0.25mg 146 alprazolam0.5mg 147 amitryptyline10mg / 25mg 148 amlodipine10mg 149 amlodipine5mg 150 amoxycillin500mg+clavulanate125mg 151 amoxycillin250+clavulanate125mg 152 amoxycillin250mg. 153 amoxycillin500mg. 154 ampicillin+cloxacillin ( 250mgeach ) 155 ampicillin+cloxacillinkid 156 ampicillin+dicloxacillin ( 250mgeach ) 157 ampicillin500mg. 158 amytriptilline. 159 antacid. 160 artemether+lumefaotive 161 artemether40mg. 162 artemether80mg. 163 artisunate+sulphadoxim+pyrimethanuine 164 artisunate50mg. 165 ascorbicacid ( vitaminc ) 166 atenolol50mg. 167 atorvastatin20mg 168 atorvastatin40mg 169 azithromycin250mg 170 azithromycin500mg 171 baclofen20mg 172 b complex. 173 benadone20mg 174 betamethasone8mg 175 bisacodyl10mg 176 calcium+vitd3 177 carbamazepine200mg 178 carbamazepine300mg. 179 carbamazepine400mg. 180 carbimazole10mg 181 carvedelol12.5mg 182 carvedelol3.125mg 183 carvedelol6.25mg 184 cefadroxyl500mg 185 cefadroxylkid. 186 cefixime+ofloxacin 187 cefixime200mg 188 cefopodoxime+clavulanicacid200+125mg 189 cefopodoxime500mg. 190 cefuroxime250mg 191 cefuroxime500mg 192 cepecitabine500gm 193 cephalexin500mg. 194 cetrizinehcl10mg. 195 chloramphenicol. 196 chlordiazepoxide5mg+clinidiumbromide2.5mg. 197 chloroquinephosphate15mg. 198 chlorpheniraminemaleate25mg 199 chymoralplus. 200 cinnarizine30mg 201 cinnarzine25mg / 50mg 202 ciprofloxacin250mg. 203 ciprofloxacin500mg. 204 ciprofloxacin500mg+tinidazol600mg. 205 citicoline+piracetam500+800mg 206 citicoline500mg 207 clarithromycin250mg. 208 clarithromycin500mg. 209 clindamycin300mg 210 clindamycin600mg 211 clinidipine10mg 212 clonazepam0.25mg. 213 clopidogrel150mg. 214 clopidogrel75mg. 215 clotrimazolevaginal 216 coralcalciumwithvitdandk 217 cotrimaxazole 218 co trimoxazole 219 deflazacort6mg 220 dexamethasone4mg 221 diclofenac50mg+patacetamol325mg 222 diclofenacsodium+paracetamol50+325mg 223 diclofenacsodium100mg. 224 dicyclomine100mg. 225 dicyclominehydrochloride 226 di ethylcarbazine100mg. 227 diloxamidefureate. 228 disprin325mg 229 domperidone10mg 230 doxycycline100mg. 231 drotaverin 232 dulcolax 233 ecosprin150mg 234 enalprilmaleate5mg 235 erythromycin500mg. 236 erythromycinkid, 237 ethambutol800mg 238 ethamsylate250mg. 239 etophyllin+theophyllin23+77mg 240 famotidine40mg. 241 favipiravir200mg 242 favipiravir400mg 243 flavoxate200mg 244 fluconazole150mg. 245 fluoxetive40mg 246 frusemide40mg 247 gatifloxacin200mg. 248 glibenclamide5mg. 249 gliclazide30mg 250 glimipride1mg 251 glimipride1mg+metformin500mg 252 glimipride2mg+metformin500mg 253 griseofluvin250mg. 254 hydrochloroquine200mg 255 ibuprofen+paracetamol. 256 ibuprofen400mg. 257 iron+folicacid 258 itraconazole100mg 259 itraconazole200mg 260 ivermectin12mg 261 ketocanazole200mg 262 ketoconazole200mg. 263 levetiracetan500mg 264 levocetrizinelomg. 265 levofloxacin500mg 266 levofloxacin750mg 267 linozobid600mg 268 loperamide 2mg 269 losertan 270 mefenamicacid 271 metformin500mg. 272 methylcobalamine 273 methyldopa. 274 methylprednisolone8mg 275 metoprolol25mg 276 metoprololsuccinateextendedrelese12.5mg 277 metronidazole400mg. 278 misoprostol200mcg 279 multivitamin 280 nitrofurantocin100mg 281 norfloxacin+tinidazole. 282 norfloxacin400mg. 283 ofloxacin100mg. 284 ofloxacin200mg. 285 ofloxacin200mg+ornidazole500mg 286 olanzapine5mg 287 omeprazole20mg. 288 omeprazole20mg+domperidone10mg 289 ondensateron10mg 290 ornidazole500mg. 291 pantoprazole40mg. 292 pantoprazole40mg+domperidone 293 paracetamol500mg. 294 paracetamol650mg. 295 paroxetine12.5mgxr 296 pheniraminemaleate.50mg 297 phenytoinsodium100mg 298 pioglitazone15mg 299 piperazine500mg. 300 piracetam800mg 301 prednisolone10mg. 302 prednisolone10mg. 303 pregabolin+methylcobalamine 304 primaquine15mg. 305 primaquine2.5mg 306 prochlorperazine 307 promethazine25mg. 308 propanolol40mg. 309 pyrazinamide750mg. 310 pyridostigmine60mg. 311 quininehcl300mg. 312 quitiapine25mg 313 rabeprazole20mg 314 rabiprazoletablet 10mg 315 racecadrotil 316 ramipril2.5mg. 317 ranitidine. 318 rifampicin450mg. 319 rifampicin450mg+isoniazide300mg 320 rifampicinkid. 321 risperidone2mg 322 rosuvastatin 323 roxythromycin150mg 324 salbutamol2mg 325 salbutamol2mg. 326 serratiopeptidase10mg. 327 serratiopeptidase10mg+diclofenacsodium50mg. 328 sodvalporate250mg. 329 sodvalporate500mg 330 sparfloxacin 331 spironolactone 332 sulfadoxime500mg+pyrimethenine250mg 333 sulfasalazine500mg 334 tamsulosin0.4mg 335 telmisartan40mg 336 terbinafin250mg. 337 terbutaline. 338 thalidomide100mg 339 theophyllin. 340 thyroxinesodium25mcg 341 thyroxinesodium50mcg 342 tiamine 343 tinidazole500mg. 344 torsemide 345 tramadol+paracetamol 346 tramadolhcl50mg 347 trenexamicacid500mg 348 trihexiphenidyl2mg. 349 trypsinandchymotrypsin 350 valacyclovir500mg 351 vitamin a 352 vitamin c 353 vitamin d 354 vitamin e400mg 355 vitamin k 356 zinc10mg 357 zinc20mg 358 zinc50mg 359 drops , syrups , ointments & misllaneous 360 bisocodyl suppository 361 camphor menthol vapocap 362 chlorhexidine gluconate & cetrimide solution 363 chlorhexidine mouth wash 364 chloroxylenol, terpineol & absolute alcohol liquid 365 clindamycin gel 366 clotrimazole mouth paint 1% 367 drop dicyclomine 368 drop domperidone 369 drop. ciprofloxacin eye drop. 370 drop. ciprofloxacin+dexamethasone eye / ear drop. 371 drop. clotrimazole ear drop 372 drop. dexamethasone eye drop 373 drop. gentamicin eye / ear drop. 374 drop. iron oral drop 25mg / ml 375 drop. moxifloxacin eye drop 376 drop. multivitamin oral drop 15ml 377 drop. nasal drop. 378 drop. neomycin + clotrimazole + dexamethasone eye drop. 379 drop. neomycin + hydrocortisone eye drop. 380 drop. ofloxacin + dexamethasone eye drop. 381 drop. paracitamol oral drop 382 drop. polymyxin b eye drop 383 drop. saline nasal drop 384 drop. tobramycin eye drop. 385 drop. vitamin d3 ( 1ml=800iu ) 386 drop. waxonil ear drop. 387 drop. xylometazoline nasal drop 388 gamma benzene hexchloride lotion. 389 hydrogen peroxide. 390 oint. atropin sulphate 1% 391 oint. atropin sulphate 1% s eye ointment 392 oint. beclomethasone 393 oint. chloramphenicol 394 oint. clobetasol 395 oint. clotrimazole 396 oint. diclofenac gel 397 oint. fucidic acid 398 oint. ketoconazole ointment. 399 oint. metronidazole + povidine iodine 400 oint. mometasone 401 oint. mupirocin 402 oint. neomycin+polymyxin b eye oint. 403 oint. neosporm skin / eye ointment. 404 oint. ofloxacin+dexamethasone 405 oint. povidine iodine 15gm. tube 406 oint. soframycin skin ointment. 407 plaster of paris 50kg tin / bag. 408 povidone iodineointment 250gm 409 povidone iodine solution 5% w / v 410 povidone iodine solution 7.5 % 411 powder clotrimazole 412 powder neosporin 413 silver sulphadiazine cream 1% w / w 500gm 414 syp. albendazole. 415 syp. alkaline. 416 syp. amoxycillin 228.5mg / 5ml 417 syp. amoxycillin+clavulanic acid 228.5mg+457mg / 5ml 418 syp. ampicillin+cloxacillin. 419 syp. antacid. 420 syp. b complex. 421 syp. caffine citrate 60mg / 3ml 422 syp. calcium 423 syp. calcium + phosp+ vit d3 424 syp. cefadroxyl. 425 syp. cefalexin 426 syp. cefixime 427 syp. cefodoxim 428 syp. cefuroxime 429 syp. cetrizine 430 syp. chloroquine. 431 syp. cotrimoxazole. 432 syp. cough expectorant 100ml 433 syp. cough syrup 100ml 434 syp. cremalax 435 syp. dextromethorphan hydrobromide 15mg+cpm 2mg / 5ml 436 syp. dry cough 100ml 437 syp. erythromycine 438 syp. ferrous fumarate / sulphate 439 syp. ibuprofen. 440 syp. lactulose. 441 syp. levo salbutamol+ ambroxol 442 syp. liver tonic. 443 syp. mefemenic acid 444 syp. multivitamin. with zinc 445 syp. ofloxacin. 446 syp. ofloxacin+metronidazole 447 syp. oxetacaine bp 10mg+aluminium hydroxide 0.291gm+magnisium hydroxide 98mg / 5ml 448 syp. paracetamol. 125mg 449 syp. polymyxin b 450 syp. portklor 451 syp. promethezine hcl 452 syp. quinine. : 453 syp. sodium valporate. 454 syp. sucralfate 455 syp. vitamin a 456 syp. vitamin d 457 syp. vitamin e 458 drop paracetamol 459 drop cough 460 drop vitamin c 461 drop amoxycillin 462 syp. ofloxacin+ornidazole 463 syp. prednisolne 464 syp. ranitidin 465 syp. montelukast+levocetrizine 466 syp. montelukast+cetrizine 467 syp. vitamin c 468 ors 469 solution salbutamol nebulizing 470 solution ipratropium bromide nebulizing 471 solution budecort nebulizing 472 particulars 473 isolyte m ( 500ml ) ffs pack 474 isolyte p ( 500ml ) ffs pack 475 iv ciprofloxacine ( 100ml ) bffs pack 476 iv mannitol ( 100ml ) bffs pack 477 iv mannitol ( 300ml ) ffs pack 478 iv metronidazole 100ml bffs pack 479 saline d.n.s. ( 500ml ) ffs pack 480 saline dextrose 10% ( 500ml ) ffs pack 481 saline dextrose 5% ( 500ml ) ffs pack 482 saline n.s. ( 500ml ) ffs pack 483 saline rl ( 500ml ) ffs pack 484 saline 1 / 2 dns 485 crystalloid solution ( 0.9% ns ) in severe cases 486 disposables / consmables 487 disposable syring 5ml 488 disposable syring 10ml 489 disposable syring 3ml 490 disposable syring 2ml 491 disposable syring 1ml 492 disposable syring 0.5ml ad 493 gloves 7.5 surgical pair 494 gloves 7 surgical pair 495 gloves 6.5 surgical pair 496 gloves 6 surgical pair 497 examination gloves all sizes 498 nitrile gloves all sizes 499 vinyl gloves all sizes 500 heavy duty gloves all size rubber 501 cotton roll 400gm nett 502 absorbent cotton i.p 400gm / roll ( net weight ) 503 absorbent gauze than 18 m x 90 cm sch f ii delux quality 504 absorbent bandage than 18 m x 90 cm sch f ii delux quality 505 roller bandage sch f ii 2x5mtr 506 roller bandage sch f ii 3x5mtr 507 roller bandage sch f ii 4x5mtr 508 roller bandage sch f ii 6x5mtr 509 saline set 510 b.t. set 511 paedia drip set 512 scalp vein set ( 18 nos. ) 513 scalp vein set ( 22 nos. ) 514 scalp vein set ( 24 nos. ) ( all size ) 515 oxygen mask adult 516 leucoplast with zinc oxide 4 x 5 mt 517 leucoplast with zinc oxide 4 x 9 mt 518 leucoplast with zinc oxide 7.5 cm x 5 mt 519 leucoplast with zinc oxide 7.5 cm x 9 mt 520 lecopore with zinc oxide 7.5 cm x 5 mt 521 lecopore with zinc oxide 7.5 cm x 9 mt 522 intracath 18g 523 intracath 20g 524 intracath 22g 525 intracath 24g 526 intracath 26g 527 butter fly scalp vein set ( 24 no. ) 528 butter fly scalp vein set ( 23no. ) ( all size ) 529 adhesive micropore 2 530 adhesive micropore 1 / 2 531 adhesive micropore 1 532 uro bag 533 uro bag with hanger for adult / child 534 urine pot 535 nasal prongs ( neonats ) 536 ryles tube 5fr 537 ryles tube 6fr 538 ryles tube 7fr 539 ryles tube 8fr 540 suction tube6fr 541 suction tube 8 fr 542 micropore 1 inch 543 oxygen mask child 544 oxygen mask adult 545 nebulizer set 546 disposable niddle 18fr 547 disposable niddle 22 fr 548 endotracheal tube 2.5 no 549 endotracheal tube 3 no 550 endotracheal tube 3.5 no 551 malecot catheter different sizes 552 epidural catheter 553 suction catheter 554 endotracheal tube 6 no 555 endotracheal tube 6.5 no 556 endotracheal tube 7 no 557 endotracheal tube 7.5 no 558 trece ostomy tube set 559 folye’s catheter 16 two way 560 folly’s catheter 20 two way 561 folly’s catheter 18 two way 562 folly’s catheter 10 two way 563 chromic catgut plain 2 564 chromic catgut plain 2 0 565 chromic catgut with needle 1 566 chromic catgut with needle 1 0 567 intestinal catgut 1 568 intestinal catgut 1 0 569 intestinal catgut 2 570 intestinal catgut 2 0 571 mersilk ( 1 0 ) 572 mersilk ( 1 no ) 573 mersilk ( 1 no ) 574 mersilk ( 2 0 ) 575 mersilk ( 8 0 ) 576 mersyl 2 0 withcurvedneedle 577 mersyl 2 0 withstraight needle 578 plain catgut ( 1 0 ) 579 plain catgut ( 2 0 ) 580 plain catgut 1no 581 plain catgut 1no 582 plain vial 583 prolene ( 2 0 ) 584 prolene ( 1no ) 585 prolene mesh 7.5 x10cm 586 prolene mesh 7.5 x15cm 587 prolene ( 1 0 ) 588 vicryl ( 1 0 ) 589 vicryl1no 140 cm 590 vicryl1no 45 cm 591 vicryl1no 70 cm 592 vicryl1no 90 cm 593 vicryl ( 2 0 ) 594 x ray plates ( 12x15 ) 595 x ray plates ( 10x12 ) 596 x ray plates ( 08x10 ) 597 x ray plates ( 12x12 ) 598 x ray cassttee ( 12x15 ) 599 x ray cassttee ( 10x12 ) 600 x ray cassttee ( 08x10 ) 601 x ray cassttee ( 12x12 ) 602 developer for xray 13.5 litre 603 fixerfor xray 13.5 litre 604 rapid test card for pregnancy kit 605 rapid test card for malaria a / g 606 rapid test card for chiakngunia 607 rapid test card for dengue 608 rapid test card for hbsag 609 rapid test card for hiv 610 rapid test card for hcv 611 rapid test card for covid 19 ag 612 rapid test card for syphillis 613 rapid test card combo ( hiv & syphlis ) 614 urine test strip 2p 615 urine test strip 3p 616 urine test strip 4p 617 urine test strip 5p 618 urine test strip 10p 619 idbracelet for chiidren, written type 620 idbracelet for adult, written type 621 idbracelet for chiidren, card insert type 622 idbracelet for aduit, card insert type 623 idbracelet for adult & chiid, card insert type 624 idbracelet for adult & chiid, card bar code type 625 ppe kit 626 surgeon cap 627 3 ply face mask 628 n 95 mask 629 shoe cover disposable 630 bouffant cap 631 disposable apron 632 new born diaper 633 needle straight 634 needle curved 635 mucus sucker 636 roller crepe bandage 2 637 roller crepe bandage 3 638 roller crepe bandage 4 639 roller crepe bandage 6 640 cotton thread 641 cord clamp 642 burn patti 643 bleaching powder 25 kg 644 b.p. blade no. 20 ( all size ) 645 b.p. blade no. 15 646 b.p. blade no. 12 647 lab items 648 albumin 649 albumin 650 alkaline phosphatase 651 alkaline phosphatase 652 a amylase 653 a amylase 654 a amylase 655 sgot ( uv kinetic ) 656 sgot ( uv kinetic ) 657 sgot ( uv kinetic ) 658 sgot ( uv kinetic ) 659 sgpt ( uv kinetic ) 660 sgpt ( uv kinetic ) 661 sgpt ( uv kinetic ) 662 sgpt ( uv kinetic ) 663 bilirubin total &direct 664 bilirubin total &direct 665 bilirubin total &direct 666 bilirubin direct 667 bilirubin direct 668 bilirubin direct 669 bilirubin total 670 bilirubin total 671 bilirubin total 672 calcium 673 calcium 674 calcium 675 cholesterol + hdl ppt 676 cholesterol 677 cholesterol 678 cholesterol 679 ck nac ( kinetic ) 680 ck nac ( kinetic ) 681 chloride 682 chloride 683 ck mb ( kinetic ) 684 ck mb ( kinetic ) 685 cleaning solution ( semi auto analyser ) 686 creatinine ( 3affe’s 2p kinetic ) 687 creatinine ( 3affe*s 2p kinetic ) 688 creatinine ( 3affe’s 2p kinetic ) 689 ggt ( kinetic ) 690 ggt ( kinetic ) 691 glucose 692 glucose 693 ldh ( kinetic ) 694 ldh ( kinetic ) 695 micro protein 696 micro protein 697 phosphorus 698 phosphorus 699 triglycerides 700 triglycerides 701 triglycerides 702 total protein 703 total protein 704 uric acid 705 uric acid 706 uric acid 707 urea uv ( 2p kinetic ) 708 urea uv ( 2p kinetic ) 709 acid phosphatase ( kinetic ) 710 acid phosphatase ( kinetic ) 711 cholesterol direct ( ep ) , hdl 712 cholesterol direct ( ep } , hdl 713 cholesterol direct ( ep } , ldl 714 cholesterol direct ( ep ) , ldl 715 lipase ( kinetic ) 716 lipase ( kinetic ) 717 sgpt ( uv kinetic 30 days ) 718 sgpt ( uv kinetic 30 days ) 719 sgpt ( uv kinetic 30 days ) 720 sgpt ( uv kinetic 30 days ) 721 sgot ( uv kinetic 30 days ) 722 sgot ( uv kinetic 30 days ) 723 sgot ( uv kinetic 30 days ) 724 sgot ( uv kinetic 30 days } 725 cholesterol ( ep90 days ) 726 cholesterol ( ep90 days ) 727 cholesterol ( ep90 days ) 728 glucose ( ep60 days ) 729 triglycerides ( ep 30 days ) 730 triglycerides ( ep 30 days ) 731 triglycerides ( ep 30 days ) 732 uric acid ( ep30 days ) 733 uric acid ( ep30 days ) 734 uric acid ( ep30 days ) 735 urea berthelot ( ep21 days ) 736 urea uv ( 2p kinetic 30 days ) 737 urea uv ( 2p kinetic 30 days ) 738 urea uv ( 2p kinetic 30 days ) 739 plain, vacutainer tubes, 4mired 740 edtak2 ( k3 } , 2mi purple 741 edtanaf, 2mi, grey 742 sodiumheparin, 4mi, green 743 sodium citrate 3.2* / a, 2mi blue 744 sodium citrate 3.8* / a, 2mi black 745 gel & clot activator, sml yellow 746 blue tips gilson type 1000ui 747 white tips gilson type 1000ui 748 yellow tips, gilson type 200ui 749 white tipsgilson type 200ui 750 white tipsgilson type 10 ul 751 white tips 1000ui with filter 752 white tips 200ui with filter 753 white tips 10ui with filter 754 white tips 1000ui rna / dna free 755 white tips 200ui rna / dna free 756 white tips 10u rna / dna free 757 white tips 1000ui ( with filter ) in rack 758 white tips 200ui ( with filter ) in rack 759 cover glass square 18x18mm ( ) 760 cover glass square 22x22mm ( ) 761 microslides 75mmx25mmx1.25mm ( ) 762 microslides 75mmx25mmx1.30mm ( ) 763 esr pipette westergreen ( glass ) 764 haemometer pipette 20pi ( glass ) 765 haemometer tube round ( glass ) 766 hb square tube ( glass ) 767 rbc pipette pvc tubing ( glass ) 768 wbc pipette pvc tubing ( glass ) 769 winthrobe tube ( glass ) 770 coverglasses, 18x18mm, 100pcs, #1 ( imported ) 771 coverglasses, 22x22mm 100pcs, #1 ( imported ) 772 cover glass 22 x 50 mm 100pcs, # 1 ( imported ) 773 microslides 75mmx25mmx1.25mm ( imported ) 774 microslides 75mmx25mmx1.25mm ( imported ) frosted one end 775 test tube glass disposable 12x75mm 776 test tube glass disposable 12x100mm 777 haematocrit capillariesheparinised 778 haematocrit capillariesnon heparinised 779 petridish 90mm eto sterilized 780 urine container 30mi eto steriiized 781 urine container 50mi eto steriiized 782 urine container 60mi eto steriiized 783 urine container 120 ml 784 stool container 30 ml pp 785 stool container 30 ml ps 786 centrifuge tube 15mi ( sterilised ) 787 centrifuge tube 50mi ( sterilised ) 788 pasteur pipettes3mi ( sterilised ) 789 test tube ( ria tube ) 1zx75mm ps 790 microcentrifuge tube 0.5mi conical ( dna / rna free } 791 microcentrifuge tube 1.5mi conical ( dna / rna free } 792 microcentrifuge tube 2.0mi conical ( dna / rna free } 793 microcentrifuge tube 0.5mi conical 794 microcentrifuge tube 1.5mi conical 795 microcentrifuge tube 2.0mi conical 796 centrifuge tube 15mi conical 797 centrifuge tube 50 ml conical 798 cryovial tube 1.8mi 799 sample cups hitachi 800 pasteur pipettes3mi 801 aserological pipette 1mi 802 ‘grserological pipette 2mi 803 6serological pipette 5mi 804 6 serological pipette 10mi 805 serological @ipette 25mi 806 micropipette fixed 10pl 807 micropipette fixed 20pl 808 micropipette fixed 100pl 809 micropipette fixed 500pl 810 micropipette fixed 1000pl 811 micropipette variable 5 50pl 812 micropipette variable 10 100pl 813 micropipette variable 100 1000pl 814 micropipette holder stand 815 micropipette variable 5 50pl 816 micropipette variable 10 100pl 817 micropipette variable 100 1000pl 818 tourniquetebuckle premium 819 tourinquetestandard 820 test tube rack d13 mm, 50 holes 821 test tube rack d18 mm, 50 holes 822 test tube rack 50 wells multipurpose 823 rack for gilson tips 200pi 96 hole 824 rack for gilson tips 1000pi 60 hole 825 counting chambers 826 esrpipette disposable 827 blood cell counter s keys 828 blood cell counter 8 keys 829 alcohol swabs saturated 830 embeddingcassettes 831 embeddingring 832 pipette pump 2mi 833 slide box glass 834 thermal paper 110mmx25mtrs 835 thermal paper 57mmx25mtrs 836 thermal paper 80mmx25mtrs 837 thermal paper 50mmx25mtrs 838 blood lancets, steel type 839 blood lancets plastic screw 840 blood lancets plastic flat 841 cytobrush, standard type, nylon bristie, ss wire, pp stick 842 swab sticks wooden 6 inch 843 swab sticks sterilised wooden ( in plastic tubes ) 844 swab sticks sterilisedplastic ( inplastic tubes ) 845 wooden ayre scrapper / spatula 846 papsmear test kit 4pcs sterilised 847 papsmear test kit 2pcs sterilised 848 swab stick sterilised 849 endometrialsuction curette 850 a umbilicalcord clamp paper pouch 851 mucus extractor plastic pouch 852 crystal voilet pow. 853 crystal voilet pow. 854 giemsa’s pow. 855 giemsaspow. 856 leishman’sstainpow. 857 leishmansstainpow. 858 methyleneblue 859 methyleneblue...

District Mineral Foundation Trust - Jharkhand

28097231 supply of items beds , side table , bed side chair , multipara monitor , ambu bag , side tables , oxygen facemask , oxygen flow meters , puse oxymeter , thermal scanner , digital thermometer , digital bp appartus , mask , sanitizer , generator , ecg machine , generator , benx circuit , dopplar , infra radiant warmer , dopplar , portable suction machine , photo theraty unit , syringe pump , ,sline stand , glucometer , portable x ray , oxygen mask , defibrator , porcedure spot light , portable suction , general sterile procedure trays , oxygen non rebrating mask , iv cannula , feeding tubes , nasogastric tube , multimen central catheter , multipara monito with pediatric attachment , nebulizer , iv stand neonstal /peaditric , digital bp apparatus , multipara monito with neo natal attahcement , oxygen nasal canuula paedistric , paediatric infusion set / pediatric set . etc . ...

Information And Public Relation Department - Jharkhand

28075362 providing items 1 beds (non reclining) 2 beds (reclining) 3 side table 4 bed side chair 5 multipara monitor 6 ambu bag 7 multipara monitor (with wrist probe) 8 side tables 9 oxygen face masks 10 oxygen cylinders (d type) 11 oxygen cylinders (b type) 12 oxygen flow meters 13 oxygen hood 14 pulse oxymeter 15 thermal scanner 16 digital thermometer 17 digital bp apparatus 18 mask (3 layer) 19 mask (n 95) 20 sanitiser 21 generator 63 kva 22 generator 160 kva 23 battery invertor 24 ecg machine 25 stethoscope 26 bp machine (sphygnomanometer ) 27 compound microscope 28 benz circuit 29 dopplar 30 infra radiant warmer 31 portable suction machine 32 photo therapy unit 33 syringe pump 34 bedside monitor stand 35 sline stand 36 glucometer 37 portable x ray 38 oxygen mask 39 emergency crash cart trolley 40 defibrillator 41 procedure spot light (portable) 42 portable suction 43 general sterile procedure trays 44 oxygen non rebreathing mask 45 iv cannula 24g 46 iv cannula 22g 47 iv cannula 20g 48 feeding tubes no 8 49 feeding tubes no 10 50 nasogastric tubes no 10 51 nasogastric tubes no 12 52 nasogastric tubes no 14 53 multilumen central cathetar (4fr) 8 cm 54 multilumen central cathetar (4fr) 16 cm 1 multipara monitor with pediatric attachments (bp cuff and probe) 2 nebuliser 3 iv stand neonatal/paediatric 4 digital bp apparatus 5 multipara para monitor with neo natal attachments 6 paediatric laryngoscope (curved & straight blade) 7 paediatricambu bag with different size masks 8 oxygen nasal canula neo natal & infant 9 oxygen nasal canula paediatric 10 paediatric infusion set/pediatric set ...

Department Of Health - Jharkhand

28068314 supply of beds, bed side chair, multi para monitor, ambu bag, side tables, oxygen face mask, oxygen cylinders, oxygen cylinders, oxygen flow meter, oxygen hood, pulse oxymeter, thermal scanner, digital thermometer, digital bp apparatus, mask, sanitizer, generator, battery inverter, ecg machine, stethoscope, bp machine, compound microscope, benz circuit, doppler, infra radiant warmer, portable suction machine, photo therapy unit, syringe pump, bed side monitor stand, sline stand, glucometer, portable x ray, oxygen mask, emergency crash cart trolley, defibrillator, procedure spot light, portable suction, general sterile procedure trays, oxygen non rebreathing mask, iv cannula 24 g, 22 g, 20 g, feeding tubes, nasogastric tubes, multilumen central cathetar, multi para monitor with pediatric attachment, nebulizer, iv stand neonatal/pediatric, digital bp apparatus, multi para monitor with neonatal attachment, paediatric laryngoscope, oxygen nasal canula....

Health Department - Jharkhand

28041476 supply of stationery , machine , equipment , medical instrument etc 7 medicine rack branded (powder coated) 2 office almirah4 shelves branded (powder coated) 3 office chair branded 4 hp printer laser jet 1020 plus 5 computer set processor makelntel processor generation9 processor description intel core i3 operating system (factory pre loaded)windows ram size (gb)4 total hdd capacity (gb)1000 t.f.d monitnr 10 home 6 ilr galvanized steel ice lined refrigerator, capacity 98.5 liter 7 refrigerator 198 liter branded company 8 officetable branded three shelves 9 three seater chair (steel back) 10 steel stool revolving ll revolving office chairs with wheel branded 72 semi fowler bed with abs head & leg, collapsible railing, jhonson castor iv rod 13 semi fowler bed with s/s head & leg, collapsible railing, blue wheel iv rod 14 mattress for hospital bed (foam) 15 dressing trolly ss 16 bed side screen with cloth l7 bed side locker 18 case sheet holder with clip 19 examinalion table (powder coated) 20 wheel chair branded 21 stretcher/ patients trolly branded 22 oxygen trolley branded poder coated 23 oxygen qylinder d type 24 saline stand ss with wheel 25 waste bucket plastic 26 bed pan plastic 27 urinal female 28 urinal male 29 waste disposal bin/drums plasitc 80 lit 30 waste disposal bin/drums plasitc 60 lit 31 waste disposal trolly iron 32 liqued soap dispenser 33 jhadu narial / fool 34 plastic mug 35 plastic bucket 36 ambu bags (silicon) 37 food (diet) trolley ss 38 lienen trolly ss 39 medicine trolly ss 40 needle cutter and melter (electrical) 4l thermometer digital 42 emergency resuscitation kit adult 43 ecg machine 12 channel 44 ecg machine 6 channel 45 12 channel stress ecg test equipments tread mill test 46 cardiac monitor 5 parameter 47 defibrillator with monitor 48 pulse oximeter ( colmed/hce/beurer/i.{iscommed) 49 hand held pulse oximeter with nib.p* 50 syringe pump 51 infusion pump 52 b.p.apparatus table model dieital (without mercury) 53 b.p.apparatus stand model digital ( without mercury) 54 sthetescope pediatric 55 sthetescope cardiac type 55 stethoscope general 57 washing machine with dryer (semi automatic 10kg) 58 disinfectantd 125 59 disinfectant alstan 25 6 60 electronic fumigator ot type 61 vacuum cleaner wet & dry automatic 62 dispoable slippers for patients 63 disinfectant sprayer battery opreated 64 suction machine electrical isi marked 65 suction machine foot opreated 66 double outlet oxygen concentrater (minimum 5 litre approx) 67 02 flow meter humidifier bottle 68 bipap machine (automatic) 69 high flow oxygen mask 70 high pressure nasal canula 77 bedsheets hopital blue 7x4 72 doctors overcoat/ lab coat 73 ppe kit 70 gsm ( laminated face shieldtgloves+shoe cover*mask+bio hazard bag) 74 gloves 6.51717.5 75 patient dress ( male/ female) 76 pillows 77 pillows covers 78 curtain cloth windows 79 curtain cloth doors 80 plastic apron 81 cloth apron 82 mortuary sheet 83 dead body bag v 84 mackintosh sheet (in meters) 85 wet wiper for cleaning ( professional) 86 dieital multifunction xerox machine 87 weather proof premium quality 2 way wall mountable passive speakers with stand 3129 home audio speaker 3729lndoor pa system (with installation) 88 ac stablizer 89 ac 1.5 ton ( copper) (with installation) 90 battrey 150 ah 91 inverter 1050 ups 92 generator 125 kva (with complete installation) 93 solar water heater ( capacity 500 lpd with fittine) 94 co2 fire extingusher isi marked capcity 4.5 ke 95 ss electric dead body freezer morturay (4 body with individual freezing capacity) 96 r.o.+ uv plants 500 lph ( drinking water purpose with installation) 97 handi for cooking (big size more than 100 lit) 98 handi dhakkan 99 deg for cooking (big size more than 100 lit) 100 kadhai for cooking (big size more than 100 lit) 101 gas oven for large size container 102 food plate steel 103 glass for drinking water...

Hindustan Copper Limited - Jharkhand

27976269 oxygen jumbo cylinders with accessories for moubhandar works hospital , d type oxygen cylinder , oxyflow meter for d type oxygen cylinder ( preset regulator with built in safety valve for excess pressure release, 0 15 lpm, with control valve, ss bobin, with humidifier bottle ) , oxygen mask with tube , key for d type cylinder...

Public Health Division - Jharkhand

27908006 supply of items 1 cap doxy (100mg) 2 tab invermetin (12 mg) 3 tab. vit c 4 tab. zincovit /zinc 5 tab favipiravir (200mg) 6 inj methy prednisolone (60mg) 7 inj enoxaparin (60mg prefilled syringe) s inj enoxaparin (40mg prefilled syringe) 9 ind remdisivir (100mg) 10 in] dexona (8mg) 11 tab. dexona (0.5mg) 12 cap vit d (60k) 13 tab n acteyl cystein (600mg) 14 formetron badesoride inhaler 15 levosalbutamol inhealer 16 tab pantocid (40mg) 17 in] cefoperazone 1gm vials 18 inj ceftriaxone (1gm) 19 inj tazobactum + piperacillin (4.5gm) 20 in] pantaprazole 40mg 21 inj ranitidine 50mg 22 inj ondenstron 4mg 23 ind metronidazole (100mg infusion) 24 cap pre + prabiotic 25 tab ondenstron 4mg 26 tab amlodepine (5mg) 27 tab metoprolol sustained relesed (25) 28 in] frusemide 29 in] regular lnsuline 30 in] h mixtard (30/70) 31 ind insulin glargine 32 levocetrizine (5mg) 33 montelukast(10mg) 34 meropenem iv lg 35 clavam 1.2g 36 polymixinb 500000iu 37 vancomycin iv 500mg 38 pulse ox meter (mnc/signature finger tip pulse ox meter, + 2 aaa batteries) 39 oxygen cylinder (metal), 10kg, iso 40 oxygen regulator with flow meter ( attachment of 10kg —b type oxygen cylinder ) 41 oxygen mask 42 oxygen, nasal cannula 43 oxygen cylinder (metal) jumbo size. ...

Ministry Of Steel - Jharkhand

27878939 bids are invited forbpc flowmeter with humidifier bottle , nasal oxygen cannula , ventury medical oxygen mask total quantity : 1015...

South Eastern Railways - Jharkhand

27865009 supply of oxygen mask set adult sizeoxygen mask set adult size, oxygen mask set adult size. specification: as per attached picture / catalogue....

District Magistrate - Jharkhand

27828287 supply of medical equipments disposable bedsheet iv stand wheel chair patient trolley ecg machine bed side locker crash cart trolley suction operatus machine high oxygen flow nasal cannula iv cannula 3 way adult ambu bag(with all face mask) multi para monitor endotracheal tube 6 no endotracheal tube 6.5 no endotracheal tube 7 no endotracheal tube 7.5 no defibrillator adult laryngoscope oropharyngeal air ways laryngeal forceps cardiac bed for icu donor bed couch patient beds patient bed bipap infusion pump forlv fluids and drugs connector for endotracheal tube(t type & angular type) boyls apparatus abg analyzer nebulizer oxygen mask...

East Central Railway - Jharkhand

27821915 supply of oxygen regulator, mask and cannulaoxygen regulator, mask and cannula,nasal oxygen mask , oxygen mask (adult) , oxygen regulater...

National Health Mission - Jharkhand

27804809 supply of (surgical and medicine) 1 adhesive tape/ paper 2 ambu bag with face mask 3 ambu bag with face mask 4 b.p. machine 5 b.p. machine 6 band aid 7 bandage 8 bed sheet 9 bio medical bag (yellow, black, blue & red) 10 blood transfusion set 11 blood transfusion tube 12 catheter suction 13 colour codded bin 14 colour codded bin 15 cotton roll 16 cotton swab 17 cough syrup 18 dead body cover 19 dispo cap 20 dispo. syringe 21 dispo. syringe 22 dispo. syringe 23 elastic adhesive bandage 24 entrogermine capsule 25 face sheild 26 foley catheter 27 foley catheter 28 gluco meter 29 gluco strip 30 goggles 31 handwash 32 hub cutter 33 hub cutter 34 i.v ciprofloxacin 35 i.v metronidazole 36 inj dexona 37 inj diclofenac 38 inj enoxaparin sodium ip 39 inj enoxaparin sodium ip 40 inj ranitidine 41 inj. adrenaline 42 inj. amiodarone sterile 43 inj. andrenalin 44 inj. atropine sulphate 45 inj. biphasic isophase 46 inj. cefotaxim 47 inj. deriphyline 48 inj. deriphyllin 49 inj. dexomethasone 50 inj. frusemide 51 inj. hepalock 52 inj. hydrocortisone 53 inj. lasix 54 inj. lmwh (60u) 55 inj. methyl prednisolone sodium succinatt 56 inj. methyl prednisolone acctate 57 inj. ondansetran 58 inj. pheniramine maleate 59 inj. polybian 60 inj. remdesivir 61 insulin syringe 62 iv cannula 63 iv cannula 64 iv d. 5% 65 iv dns 66 iv n. s. 67 iv ringers lactate 68 iv set 69 leucoplast 70 life boy soap 71 mask n 95 72 montelukast & levocetirizine 73 multivitamine & minerals capsules 74 nebulize mask 75 nebulizer asthalin 76 nebulizer budecort 77 nitrile gloves 78 nitrile gloves 79 non sterile gloves 80 non sterile gloves 81 oxygen mask with pipe 82 plastic gloves 83 ppe kit 84 puls oxymeter 85 senitizer with 70% alcohal 86 senitizer with 70% alcohal 87 senitizer with 70% alcohal 88 senitizer with 70% alcohal 89 shoe cover 90 spirit 91 tab. (vit c) 92 tab. amlodipine 93 tab. azithromycin 94 tab. azithromycin 95 tab. calcium 96 tab. cetrizine 97 tab. deflazacort 98 tab. doxycycline hcl tab. & ambroxol hcl 99 tab. favipiravir 100 tab. ivermectin 101 tab. ivermectin 102 tab. metformin 103 tab. metronidazone 104 tab. n acetylcysteine 105 tab. ondesatron 106 tab. ondesetron 107 tab. pantoprazole 108 tab. paracetamol 109 tab. paracetamol 110 tab. prednisolone dispersible 111 tab. salbutamol 112 tab. torsemide 113 tab. vitamine b complex 114 tab. vitamine d3 115 tab. zinc 116 tab.dexomethasone 117 tab.isosorbide nitrate 118 thermal scaner 119 triple layer mask 120 zeeper pack 121 zeeper pack 1 tab. haloperidol 2 tab. risperidone 3 tab. risperidone 4 tab. olanzapine 5 tab. olanzapine 6 tab. imipramine 7 tab. amitryptiline 8 tab. escitalopram 9 tab. fluoxetine 10 tab. lithium carbonate 11 tab. lithium carbonate 12 tab. carbamazepine 13 tab. sodium valproate 14 tab. sodium valproate 15 tab. zolpidem 16 tab. clonazepam 17 tab. lorazepam 18 tab. phenobarbitone 19 tab. phenobarbitone 20 tab. diphenylhydantoin 21 tab. clozapine 22 tab. clozapine 23 tab. donepezil 24 tab. donepezil 25 tab. trihexyphenidyl 26 inj. haloperidol 27 inj.promethazine 28 inj.lorazepam 29 inj.fluphenazine 1 paper 2 marker pen 3 sizer 4 sample sticker roll 5 rubber band 6 arch file 7 fevi stick medium 8 high lighter yellow 9 stepler 10 stepler 11 stepler pin 12 stepler pin 13 paper puncher 14 pen 15 cartidge 16 colin 17 white tape 18 flat file 19 whitener pen 20 stamp pad 21 mouse 22 format printing a4 size 23 format printing a4 size 24 register 25 ture nat register 1 flex with iron frame (multi colour) 2 flex banner (multi colour) 3 poster art paper (multi colour) 4 poster meplitho (multi colour) 5 handbill a4 size (multi colour) 6 handbill a4 size (multi colour) 7 horading flex banner multi colour iron steel frame 4inch, chanel with grouting with fixation charge 8 glow sign board multi colour 9 hand bill one side multi colour 10 hand bill both side multi colour 11 hand bill single side single colour 12 hand bill both side single colour 13 iron standi pasted with multi colour 14 wall writing multi colour ...

East Central Railway - Jharkhand

27802937 supply of oxygen regulator, mask and cannulaoxygen regulator, mask and cannula, nasal oxygen mask , oxygen mask ( adult ) , oxygen regulater...

District Magistrate - Jharkhand

27750892 supply of oxygen cylinder, oxygen gas regulator, oxygen mask, ppe kit, hypo, sanitizer, hospital bed, wheel chair, stretcher, drug trolley, mattress with cover, nebulization machine piston type, gloves, triple layer mask, mask n 95, rtpcr vtm kit, truenat kit, injection remidesivir, enoxaparine, deriphyline, dexoma, methylprednisolone, cefriaxone, asprin, tablet rosuvastatin, blood pressure machine, pulse oxymeter, high flow nasal cannual, ivermectin, doulin/foracort nebulizer respules, intracath, tablet wysolone, non rebreathing mask, foleys catheter, cardiac monitor....

Health Department - Jharkhand

27749236 supply of equipment/machine abg machine bipap machine cpap machine nebulizer machine nebulizer mask bp instrument stethoscope thermometer laryngoscope et tube & guidewire size 6.5 et tube & guidewire size 7.0 et tube & guidewire size 7.5 suction machine with tube guddles air way adult size foleys catheter 14 no. foleys catheter 16 no. foleys catheter 18 no. ryles tube size 16 no. ryles tube size 17 no. ryles tube size 18 no. oxvaen concentrator machine (10 lpm) oxygen concentrator machine (15 lpm) syringe pump ambu bag with mask — adult ambu bag with mask paediatrics t piece connector benz circuit freeze t gel — si7e 3 i gel — size 4 i/v canula size 18 no. i/v canula size 20 no. i/v canula size 22 no. dynaplast oxygen supply connector for patient high flow oxygen mask icu mattress 3 folded ...

District Collector - Jharkhand

27741807 supply of oxygen cylinder with trolley, oxygen flow meter, oxygen mask, nasal cannula, oxygen concentrator, bipap machine with mask, spare mask for bipap machine, hdu monitor, hospital bed manual, hospital bed semi automatic, hospital bed for emergency, modular isolation ward....

District Magistrate - Jharkhand

27739413 supply of oxygen clylinder b type with trolly oxygen clylinder d type with trolly oxygen flow meter oxygen mask nasal cannula oxygen concentrator bipap machine with mask spare mask for bipap machine hdu monitors hospital bed manual hospital bed semi automatic hospital bed for emergency (full automatic) moduler isolation ward...

Health Department - Jharkhand

27724931 supply of items abg machine bipap machine cpap machine nebulizer machine nebulizer mask bp instrument stethoscope thermometer laryngoscope et tube & guidewire size 6.5 et tube & guidewire size 7.0 et tube & guidewire size 7.5 suction machine with tube guddles air way adult size foleys catheter 14 no. foleys catheter 16 no. foleys catheter 18 no. ryles tube size 16 no. ryles tube size 17 no. ryles tube size 18 no. oxygen concentrator machine syringe pump ambu bag with mask adult with mask ambu bag pediatrics t piece connector benz circuit freeze i gel size 3 i gel size 4 a i/v canula size 18 no. i/v canula size 20 no. i/v canula size 22 no. dynaplast oxygen supply connector for patient high flow oxygen mask icu mattress 3 folded ...