Health Department - Jharkhand

39485354 supply for office stationery, equipments etc. , items names : , executive chair , revolving chair , study chair , office table , almirah ( for office use ) , glass almirah , journal rack , computer table , dinning table set ( 1 table + 6 chairs ) , dinning table , lab table , examination table , stool steel chair , bed side locker , single bed ( for hostel ) ( double decker ) , almirah , chair , table , needleholder : , 6 , 7 , 8 , suture cuttingscissors , sutureneedle : , straight , curved , mackintosh roll : , full bed length ( qtyin meters ) , draw mackintosh , extra for treatment and dressing , hot water bag , ice caps , ice collar , corrugated rubber sheet , gloves different sizes , catheters : , urinary catheters , foleys catheters , nasal catheters , plain catheters , rectal catheters , finger stalls different sizes ( set ) , air rings , mucus sucker , breast pump , nipple shield , gastric lavage tube , ryles tube , flatus tube , blakemore sange staken tube , rubber tubes with different diameter and size , rectale syringe with nozzle , ring pressories each size , douche nozzle different sizes , mortar and pestle , nelsons inhaler , spirit lamp , test tube stand , test tube holder ( in dozen ) , sterilizer small , portable autoclave , weighing scales , adult weighing scale , baby weighing scale , back rest , splints different sizes , i. v .stand , microscopes , sphygmomanometer ( mercury ) , a regular ( dial ) , b electronic ( digital ) , stethoscope , over bed table ( cardiac table ) , screens / bed side curtains , three way adapter , mattress: , adult , child , mattress cover: , adult , child , bed sheets , baby cot sheets , draw sheets , sandbags with covers , sponge cloth , hot water bag covers , ice cap covers , air ring / cushion covers , gowns masks , patient s clothes: , male ( set ) , female ( set ) , baby dresses of different sizes ( set ) , diapers different sizes ( set ) , trolley cover , dirty linen bag / box , leggings ( pair ) , perineal sheets , triangular bandages , many tailed bandages , eye shields , dusters , slings , t binder , screen curtains ( set ) , adult human articulated skekelton with hanging facility in a glass cupboard with locking facility. , full set of dis articulated human skeleton. , full size human body showing all muscles and articals , human torso : , male , female , skin cross section , heart and large blood vessels , heart with detachable parts on a stand , eye with different sections , ear with different sections , human brain with spinal cord , lungs and trachea , larynx , digestive system: , stomach , female reproductive system: , uterus on stand , male reproductive system , urinary system: , kidney: , joints and ligaments: , wrist , elbow , shoulder , ankle , knee , hip , teeth , skeleton system , muscular system: , showing different muscles of the body , joints and ligaments: , nervous system: , brain , cardio vascular system , respiratory system , lungs , trachea , larynx , digestive system , oral cavity , teeth , stomach pancreas and spleen , small intestine , large intestine , liver and gallbladder , kidney macroscopic structure , skin , eye , ear , female reproductive system , menstrual cycle , male reproductive system , endocrine glands , first aid for burns , cardiac pulmonary resuscitation: , adult , children , infant , first aid charts or emergencies such as fracture, drowning, wounds, poisoning, bites ( each ) , stages of development of embryo ( set ) , female bony pelvis , foetal skull , female dummy ( zoe model ) / obstetrical training with doll , placenta , full size fetus , new born baby , baby cradle , breast changes in pregnancy , uterine changes in pregnancy showing height of uterus at different terms of pregnancy , stages of labour , first stage , second stage , third stage , breech presentation , complete breech , incomplete breech , foot presentation , shoulder presentation , face presentation , brow presentation , twin pregnancy , placenta previa different stages , caput succedaneum, cephalhaematoma , congenital malformation of new born: , cleft lip palate , spina bifida , hydrocephalus , anencephalus , all in one computer set , laptop , xerox machine , color printer , air conditioner , lcd projecter , lcd screen , over head projecter , community health nursing for anm , community health nursing for anm ( hindi ) , health worker keliyepathyapustak , community health nursing ( samudayikswasthvigyan ) ( hindi ) , nursing manual of nutrition and therapeutic diet , essentials community health nursing in hindi , where there is no doctor a village health care handbook , where there is no doctor hindi , mecical surgical nursing , fundamentals of nursing , principal & practice of nursing , health promotion for anm , aaharavumposhan , text book of anatomy & physiology for nurses , anatomy & physiology anotomy and physiology for nurses ( sharirrachanavigyanevamsharirkriyavigyankewalnursonke live ) ( hindi ) , prathamiksahayataevamsankatkalindekhbbal ( hindi ) first aid and emergency care , manual of first aid ( prathamikupcharka manual ) ( hindi ) , health promotion , nurse keliyemanovigyanavumswasthya , psychiatric meantal health nursing , text book of microbiology for nurses , sukhamjivvigyankipathyapustak ( text book for microbiology for nurses ) ( hindi ) , primary health care nursing for anm , psychology and sociology for anm and bt students , nursing arts proceduces ( nursing kemoolsidhanth ) valume i ( hindi ) , fundamentals of nursing ( hindi ) , senior nursing procedure ( nursing kemoolsidhant volume ii ( hindi ) , sociology for nurses , pharmacology for nurses , medicine kipathyapustak , baal swasthya nursing for anm , child health nursing for anm ( hindi ) , quick look nursing pathophysiology , comprehensive manual of pediatric nursing procedures , pediatric nursing , english for nursing , textbook of computer in nursing , textbook of obstetrics , midwifery & gynecological nursing ( hindi ) , maternal & neonatal nursing care plans , midwifery for anm , midwifery and gynecological , nursing ( hindi ) , manual of midwifery procedures , pedicatric nursing care plans , cumulative record for general nursing midwifery course , health centre management , imnci module for basic health worker , chart booklet , simplified partograth ( big size ) , family planning , journal of midwifery, women health &gynaecological nursing. , journal of community & social health nursing , patient cots adult , child , bed side locker , revolving stools / chair , manikins for demonstrating nursing procedure: , adult male imported , adult female , child manikin , new born , cpr ( full body ) , trays different sizes: , 24x16 , 14x10 , 11x9 , 8x5 , trays with cover assorted sizes , bowls: , 16diameter , 10diameter , 4diameter , 2 3diameter , bowls with cover , 6diameter , 4diameter , enema can , 1 1t. capacity , 1 / 2 1t. capacity , kidney trays of assorted sizes ( big ) , measuring jugs , 1000 ml. , 500 ml. , 250 ml. , assorted size basins , catheter dish with cover , knife dish with cover , feeding cups , douche can , sputum mugs , bed pans , urinals male , funnel: , 4diameter , 2diameter , jars with covers: , 12x8 , 6x4 , dressing drums: , 8x4 , 12x9 , tub for sitz bath , saucepan with lid: , 1 1t. capacity , 2 1t. capacity , kettle: , 1 1t. capacity , 2 1t. capacity , trolleys with upper and lower shelves ( without steel top ) , pint measure , gallipots , mugs , bottle brush , cheatle forceps , sponge holding forceps , artery clamps: , straight 6 , curved6 , dissecting forceps: , toothed , non toothed , mosquito forceps , kocher’s , scissors: , surgical 8 , bandage , mayos cutting scissors , tissue forceps , sinus forceps , biopsy forceps , liver biopsy needle , alice forceps , probe , groove director with probe , mouth gag , tongue depressor , tongue holding forceps , nasal speculum , aural speculum , re tractors: , single hook , double hook , bladder sound , male urethral dilator ( set ) , packing forceps: , nasal , oral , ear irrigation syringe , ear speculum , shaving set , safety razor with blades , bard parker knife handle , surgical blades different sizes set ) , catheters , airway , laryngoscope: , paediatric , adult , proctoscope , infusion set , autoscope , ophthalmoscope , tracheostomy set with various size of tracheal tubes ( set ) , head mirror , tanning fork , oxygen cylinder with stand , oxygen mask , measuring cups: , 240ml. , 120 ml. , 30 ml. , undine , eyebath cup , pipettes & droppers , glass connection: different types e.g. y.t.l. ( each ) , wolfs bottle , conical flasks , ounce glass , dram glass , thermometers : , oral , rectal , bath , room , lotion , pulse meter , urinometer , lactometer , heamoglobinometer , specimen glasses , test tubes ( dozen ) , glass slides with cover ( box ) , bottels500 ml. capacity for lotion and mixtures , automizer , manometer , glucometer , head mirror , tuberculin syringe , insulin syringe with needle , needle all sizes ( one dozen each ) , lumbar puncture needle , trochar, cannula for abdominal paracentesis , i.v. cannula different type sand sizes , biopsy needle : , adult , children...

Indo Tibetan Border Police - Jharkhand

38431122 bids are invited for slit lamp (q3) , binocular indirect ophthalmoscope rbsk (q3) , ophthalmic auto refractometer (q3) , hand held keratometer (q3) , non contact tonometer (q2) , a scan (q3) total quantity : 6...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

38092010 rate contract for supply ,installation of eye equipments for vision centre and for district hospitals , name of equipment (equipment for vision centre) , direct ophthalmoscope , illuminated vision testing drum , snellens & near vision chart , battery operated torch 3 cells , name of equipment (equipment for district hospital ) , surgical operating microscope , a scan with immersion , nd yag laser , phacoemulsification...

Health Department - Jharkhand

37709215 group a medical equipment and others at sadar hospital koderma , items : , tray instrument / dressing with cover , forceps, backhaus towel, ( 130 mm ( tungsten carbide tip anti rust quality ) , forceps, sponge holding, ( 228 mm ( tungsten carbide tip anti rust quality ) , artery forceps ( straight 140 rnrn ( titanium ) , artery forceps ( straight 180 mm ( titanium ) , artery forceps ( curved 140 rnrn ( titanium ) , artery forceps ( curved 180 mm ( titanium ) , forcep mosquito ( titanium ) , forceps, hemostatic, halsteads mosquito, straight, ( 125 mrn ss ( tungsten carbide tip anti rust quality ) , forcep lifting , forcep ppiucd , knife handle ( surgical for minor & major surgery # 3 ( ss anti rust quality ) , knife handle ( surgical for minor & major surgery # 4 ( ss anti rust quality ) , knife blade ( surgical, size 11 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 15 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 22 for major surgery ( ss anti rust quality ) , needles, suture triangular point, ( 7.3 cm ) , cheatles forceps , cuscos speculum ( medium ) , cuscos speculum ( large ) , sharp and blunt curette , ovum forceps , oral airway , needles, suture, round bodied, ( 3 / 8 circle no. 12 ) , plain forceps ( 8 ( tungsten carbide tip anti rust quality ) , tooth forceps ( 8 ( tungsten carbide tip anti rust quality ) , kidney tray ( 8 ) , kidney tray ( 10 ) , cord cutting scissor ( ss ( titanium ) , scissors, operating curved mayo blunt pointed ( 170 mm ( tungsten carbide tip anti rust quality ) , scissor operating straight ( 230 mm ( tungsten carbide tip anti rust quality ) , scissor, gauze, straight ( 230 rnrn, ss ( titanium ) , bowl, metal sponge ( 600 rnl, ref. is: 5782 ) , drum, sterilizing cylindrical ( 275 mm oia x 132 rnrn, ss as per is: ) , foetoscope , kellys pad ( for labour and ot table set ) , thermometers ( para ) , thermometers ( digital ) , b.p. instruments ( portable ) , measuring tape , glucometer , ambu bag ( baby ) ( silicon ) , sahlis haemoglobinometer , airway guedel or berman, autoclavable rubber , endotracheal catheter ( w / cuff, rubber ) , breathing tubes, hoses, connectors for item 1, ( anti static ) , tcdc count apparatus , counting chamber , esr stand with tubes , test tube stands , test tube rack , test tube holders , spirit lamp , forceps obstetric ( wrigleys, 280 mm, stainless steel ( titanium ) , speculum vaginal bi valve ( cusco medium, ( ss anti rust quality ) , speculum, vaginal, sims double ended # 3 ( ss anti rust quality ) , forceps obstetric, wrigleys ( 280 mrn, stainless steel ( tungsten carbide tip ) , forceps, vulselium, duplay double cured, 280 mm ss ( ( tungsten carbide tip ) , sound, uterine, simpson ( 300 mm with 200 mm graduations ( ss anti rust quality ) , dilator, uterine, double ended hegar ( set of 5 ( ss anti rust quality ) , curette, uterine, sims blunts ( titanium ) , anterior vaginal wall retractor stainless ( ( ss anti rust quality ) , clamp intestinal, doyen ( curved 225 mrn, ss ) , clamp intestinal, doyen ( straight 225 rnrn, ss ) , uterine elevator ( ranathlbod ) ( ss ) , bag, reathing, self inflating ( anti static rubber, set of 4 ) , b.p. instruments with stand , timer stop watch , 3 fold reclining bed manually , weighing machine baby electronic ( 5 kg capicity with fiber tray ) , fetal monitor ( ctg monitor ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ecg machine ( 12 chennel ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , semi auto analiser ( with installation ) ( specification should be attached in technical bid turms & condition ) , micro scope binoculor ( with installation ) ( specification should be attached in technical bid turms & condition ) , cardiac monitor with defribillator ( with 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , cardiac table , oxygen cylender stand with trolly , auto clave ( elec. ) dubble drum 6x12 , b.p. instrument digital , electronic strailiser 6x8 , electronic straliser 8x10 , electronic straliser 10x12 , auto clave ( elec. ) dubble drum 4x10 , dressing drum small 9x9 , dressing drum big 12x15 , dressing drum big 9x11 , dressing drum big 12x17 , delivery table ( 72x24x3 ) power coated , ambu bag silicon adult , electric strailiser foot oprated big , fetal doppler machine digital , fetal doppler machine table model , thump forcep with tooth ( titanium ) , thump forcep without tooth ( titanium ) , straight cocker ( titanium ) , curve cocker ( titanium ) , green armittage ( titanium ) , alis forcep 6 ( titanium ) , alis forcep 8 ( titanium ) , outlet forcep ( titanium ) , kocchers forcep ( titanium ) , tissue forcep 6 ( titanium ) , tissue forcep 8 ( titanium ) , stethoscope ( best quality ) , paediatric stethoscope ( best quality ) , baby tray ( ss , ce inbuild ) , x ray film processing tank 9 lit. , x ray film processing tank 13.5 lit. , oxygen flow meter ( best quality ) , mox with yolk assombily , examination table with matress ( 72x24x3 ) ( iron ) , pulse oxymeter ( multi para ) ( with installation & 1 yrs. warrenty ) ( 8.5 tft display with ecg ) , centrifuge machine for blood storeg unit ( with installation & 1 yrs. warrenty ) , vein detector led , besin boul ( with stand ) , foot step ( 2 step ) , bed side screen with cloth ( 1 round pipe with wheel ) , salin stand with wheel with four hook ( ss ) , nsv kit set ( ss ) ( specification acched ) , streture trolly ( 85x22x32 power coated with matress ) , cotton folding strecher for ambulance ( best quality ) , weighing machine adult ( best quality ) , bed side locker ( best quality ) , hospital bed ( best quality ) ( general ) , semi fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , circle absorber with soda lime ( for boyles apparatus ) , portable oxygen cylinder ( best quality ) , baby weighing machine digital , high vaccum suction machine , iucd kit ( specification acched ) , minilap kit ( specification acched ) , water bath ( pathology department ) ( • should have double walled chamber made of stainless steel and outer wall made of thick mild steel sheet duly powder coated. • should have concentric rings are also made of stainless steel. • should have temperature co , hot air sterilizer ( oven ) digital construction: ovens are sturdy, with double walled construction. inner chamber is made of highly polished stainless steel. outer chamber is made of mild steel sheet duly pre treated in seven tanks process for surface , pulse oxymeter baby ( finger tip ) type: blood pressure monitor power supply: battery size: 57 ( l ) * 33 ( w ) * 32 ( h ) mm , pulse oxymeter adult ( table top ) built in rechargeable li polymer battery for uninterrupted monitoring compact and flexible appearance, easy for carrying and be suitable for indoor and outdoor ( in ambulance ) monitoring with user friendly interface displ , nebuliser should be lightweight, portable and compact. should have a dust filter. should be able to deliver a flow rate = 7 lpm should h ave air pressure = 35 psi. should have a check valve to protect the device against contamination due to backward , fumigation machine input power : 220 vac, 3.5 amp, 50hz consistant particle size generation : 5 15 microns vmd reach : 20 30 ft distance & 18 20 ft height. space treatment : up to 7000 cuft & even larger. nozzle assembly : non rotating vortex design , non , otoscope 1. should be a convenient pocket type otoscope. 2. should be provided with a halogen light source. 3. should be able to detach the otoscope head. 4. should provide no reflections and obstructions. 5. should provide detachable accessories of var , straight needle , o.t. table hydrolic ss ( best quality ) , focus light led ( spot light ) , laboratory autoclaves , pulse oxymeter , pulse spo2 , infusion pump , vacuum extractor metal ( best quality ) , head box for oxygen ( best quality ) , tuning fork ( best quality ) , examination instruments set ( speculums, tongue dipressors, mirrors, bulls lamp ) ( best quality ) , cervical biopsy set ( best quality ) , endometrial biopsy set ( best quality ) , vaginal hysterectomy set ( best quality ) , g.i. operation set ( best quality ) , uretheral dilator set ( best quality ) , stomach wash equipment ( best quality ) , emergency resuscitation kit adult ( best quality ) , air way 0, 1, 2, 3, 4 adult , air way peadiartric , tongue depressors , oxygen cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small d type jumbo ) , wheel chair ( ss ) folding , nibulisyer adult with mask , nibulisyer child with mask , nibulisyer mask for adult , nibulisyer mask for child , anaesthesia work station ( include anaesthesia machine with vaporiser, ventilator, monitor ) , boyles machine, brain circuit, jr , magills forceps , blood transfusion set ( best quality ) , back rest , medicine trolley ( ss ) , basin assorted ( ss ) , basin stand assorted ( ss ) ( 2 basin type ) , bed pan ( ss ) , urinal female , urinal male , waste disposal bin / drums , waste disposal trolley ( ss ) , diet trolley stainless steel , doctors overcoat , hospital worker overcoat , patients housecoat for female , patients paiiarna ( for male ) shirt , mouth mirror , waste disposal colour coded buckets swine bing 60 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets swine bing 30 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , tharmometer , nasogastric tube ( 8, 10, 12 fg ) , flow meter with humidifier bottle , bed side locker ( fully ss ) ( best quality ) , instrument trolly ( best quality ) , central patient monitoring station , bronchoscope , adjustable walker , bipap machine , cpap cum hfnc for newnate , paediatric vein circuit , ecg monitor cable , plastic tray bigh heavy , plastic box big heavy with led , x rey hanger 12x15 , x rey hanger 12x12 , x rey hanger 12x10 , x rey hanger 8x10 , x rey grid ( lead ) 12x15 , x rey grid ( lead ) 10x12 , mva aspirator , glass pippette , forceps, uterine nelaton solid tip one eye ( ( tungsten carbide tip ) , suction tube ( 225 rnrn, ss ) , valve inhaler ( chrome plated brass, y shape ) , intravenous ( set in box ) , needle spinal stainless ( set of 4 ) , syringe, anesthetic ( control 5 ml luer mount glass ) , head light ( ordinary ) ( boyle davis ) , beds semi recilining , feeding equipments ( tubes, katoris & spoon ) , channel semi automatic coaglomater with regent , x ray machine 100 ma with dark room assoseries ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , standalone color doppler machine ( specification should be attached in technical bid turms & condition ) , portable ultra sound with pw ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , portable cooling unit ( vaccine / blood bags ) ( specification should be attached in technical bid turms & condition ) , o.t light ( dichroic reflector ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , hospital bed ( ss head & foot side rod ) ( specification should be attached in technical bid turms & condition ) , led light ( single ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ultra high speed laboratary centrifuge ( specifications attached ) , digital incubator ( specifications attached ) , boyles machine ( specifications attached ) , 72 led dome ( double dome ) , lux 1, 30, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , 48 led dome ( single dome ) , lux 1, 00, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , coutery machine ( 400 w ) , coutery machine ( 250 w ) , portable o.t. light ( abs doom 19 single reflecter polycarbonate ) , portable o.t. light led , vaccu suck suction tube ( titanium ) ( for suction machine ) , alis forcep 10 ( titanium ) , tissue forcep 10 ( titanium ) , convex array tranducer c343ua ( for ultra sound machine ) , phototherephy unit single surface ( stand model ) , phototherephy unit single surface led ( with led buld ) , silent genrator 10 kva ( with installation ) ( 10 kva, 3 phase, water cooled ) , silent genrator 15 kva ( with installation ) ( 15 kva, 3 phase, water cooled ) , silent genrator 20 kva ( with installation ) ( 20 kva, 3 phase, water cooled ) , silent genrator 50 kva ( with installation ) ( 50 kva, 3 phase, water cooled ) , silent genrator 82 kva ( with installation ) ( 82 kva, 3 phase, water cooled ) , magil circuit with mask ( for boyles apparatus ) , patho fast test kit ( for patho fast machine ) , blood gas analyser test kit ( for blood gas analyser ) , dossimeter , peak expiritory flow meter ( best quality ) , laryngoscope fibreoptic ent ( best quality ) , p.v. tray ( best quality ) , varicose vein set ( best quality ) , connector set of six for en ( best quality ) , tubes connecting for en ( best quality ) , leqqinqs , explorar , endo explorar , amalgam carrier in sliver , murcury ball burnisher , carver ( dimond ) , compactor , element carrier , gic ( glass ionomer cement ) , zinc phosphate cement , temporary filling material , room thermometer , electric ventouse , radient baby warmer , right angel artry 4 , right angel artry 6 , automated autoref stand ( for ophthalmic ) , 2 mirror cronioscope ( for ophthalmic ) , disposable needle 26 g ( for ophthalmic ) , ppiucd forcep , uterus collection ( sister u and mama u ) , water cooler with purifire ( 120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap , hemoglobinometer ( 1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g / dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd / us fda / isoapproved 6. automatic correction of hb. 7. 20 , digital x rey film ( konika ) 8x10 , digital x rey film ( konika ) 10x12 , digital x rey film ( konika ) 12x12 , digital x rey film ( konika ) 12x15 , x ray digitalisationwith high end cr system ( with installation & 1 yrs. warrenty ) console software with multi modality work station the cr system should have advanced workstation provided with 17” high resolution monitor, keyboard & mouse, with the fol , x ray 500 ma ( with 1 yrs. warrenty ) x ray genera tor: high frequency x ray generator of frequency 40khz should be provided. power output of generator should be of sokw. kv range should be: • radiographic kv: 40 to 12sky. • fluoroscopic kv: 40 to 120k , suction machine foot operated ( powder coated m.s. chassis. noise level of suction apparatus from is 50 db + / 03 db. leakage current of suction units is less than 84 ua. electrical requirement – 220 ~ 230v, 50hz, 1 phase. ideal for mtp / medical / surgic , suction apparatus ( electric ) suction machine with pump: power supply: 230 240v / 50hz vacuum capacity: 18 litres / mim maximum depression: 75kpa ( 563mmhg ) vacuum is created by a plastic piston and cylinder system, with four vacuum creating modules ( , phototherapy unit 1 led phototherapy with intensity upto 6 50microwatts / nm / cumm / mwatt, adjustable intensity. 2 .height adjustable and tiltable light unit. 3 digital time totaller of led usage time. 4 stainless steel tray. 5 –provision for double surf , opthalmoscope 1. should be rechargeable battery with charger / mains operated. 2. should have halogen / led light source 3. should have red free filters 4. should have small and large spot sizes, fixation targets, slit aperture, hemi spot and cobalt blu , wireless indirect ophthalmoscope ( led ) ( compact and light weight, stereo optical system has all pupil features rechargeable battery integrated on headbrilliant white light with uniform and well spread led illumination ( focus distance : 300 800 mm, inter p , dental chair 1. should be electrically operated with zero program. 2. should have a switch operated operating light with minimum two steps of intensity control. 3. should have auto water connection for spittoon and tumbler with auto filling sensor. 4. s , av retractor 1.stainless steel 2.double ended, serrated 3.rust free 4.sturdy construction 5.accurate dimensions , vulcellum stainless steel size: 10 inch colour: silver shape: curved , ppiucd forcep ss , baby forceps ss ( big – straight ) , baby forceps ss ( big – curve ) , baby forceps ss ( big – straight ) , baby forceps ss ( small – curve ) , baby forceps ss ( small – straight ) , folis catheter 24 no , lab incubator 1. should have 4 inch attractive lcd display 2.should have intelligent controller to help maintain temperature incase of sensor failure 3. should have battery backup for temperature controller 4. should have auto tuning of controller , electricentrifuge, table top ( table top electric centrifuge ) 1. should have stepless speed regulator 2. should have safety lid interlock to prevent cover opening during centrifugation. 3. dynamic brake for quick deceleration 4. wide choice of swing out , cbc machine ( 5 part blood cell counter machine ) 1. should have throughput – 50 samples / hour 2.the sample volume should be < 17 ?l 3.should have technology – impedance ( wbc, rbc, plt ) , spectrophotometry ( hcg ) , should have optical laser methodfor 5 , incubator for culture sensitivity , esr stand with tubes , elisa reader cum washer , glycosylated haemoglobinometer , blood collection monitor , intensifying screen x ray , dossimeter , peak expiritory flow meter ( best quality ) , baby incubators ( best quality ) , craniotomy ( best quality ) , static vaccum extractor ( best quality ) , head light ( ordinary ) ( boyle davis ) ( best quality ) , ent operation set including headlight, tonsils , ent nasal set ( smr, septoplasty, nasal endoscopic set ( 00 & 300 ) polypetcomy, dns, rhinoplasty ) ( best quality ) , laryngoscope led ( best quality ) adult , laryngoscope led ( best quality ) pediatric , tracheostomy set ( best quality ) , proctoscopy set adult ( best quality ) , proctoscopy set peadiartric ( best quality ) , p.v. tray ( best quality ) , abdominal hysterectomy set ( best quality ) , laparotomy set ( best quality ) , varicose vein set ( best quality ) , thomas splint ( best quality ) , laproscopy set for cholecystectomy , amputation set ( best quality ) , colposcope ( best quality ) , mouth prop , regional anaesthesia devices, epidural set , vascular clamp set ( best quality ) , steel cup board , case sheet holders with clip ( ss ) , draw sheet , pereneal sheets for ot , explorar , spoon excavator , twizer , endo explorar , amalgam carrier in silver , murcury ball burnisher , carver ( dimond ) , diathermy machine , doyess ( medium ) , gernes retractor , metal catheter , mayo scissor curved , lma ( adult ) , steel galipot small , dressing drum size 9x11 , sims vaginal speculam , epsiotomy scissor , ovum forcep , tailor scissor , doctor & nurse dress with designation ( paijama & kurta ) , doynes retroctor 1.5” ( german steel ) each , doynes retroctor 2” ( german steel ) each , doynes retroctor 2.5” ( german steel ) each , doynes retroctor 3” ( german steel ) each , doynes retroctor 3.5” ( german steel ) each , czernys retractor ( german steel ) each , formalin chamber ( 20x8x8x5 mm ) , formalin chamber ( 26x8x8x5 mm ) , lifter with jar , strraight scissor 5” ( german steel ) each , strraight scissor 6” ( german steel ) each , strraight scissor 7” ( german steel ) each , strraight scissor 8” ( german steel ) each , s.s. bowl30 cm ( super fine quality ) each , s.s. bowl36 cm ( super fine quality ) each , babcock clamp 6” ( german steel ) each , babcock clamp 8” ( german steel ) each , ambu bag adult ( silicorised ) ( super fine quality ) , ambu bag child ( silicorised ) ( super fine quality ) , ambu bag 250 ml , artery forceps 6” curved ( german steel ) , artery forceps 6” straight ( german steel ) , mayo scissor long curved 6.5” each ( german steel ) , mayo scissor long curved 7.5” each ( german steel ) , tooth forceps 6” each ( german steel ) , non tooth forceps 6” each ( german steel ) , tenaculum long each ( german steel ) , myome screw each ( german steel ) , morrisen retractor each ( german steel ) , sim speculum medium each ( german steel ) , sim speculum long each ( german steel ) , waste disposal colour coded buckets swine bing 80 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets ( black, red, yellow, blue ) ( neelkamal, cello, suprem ) , dust bin ( ss ) small ( best quality ) , dust bin ( ss ) big ( best quality ) , sauce pan with lid , chest stand for x rey unit , oropharyngeal airway ( 000 4 guydel size ) , oxygen cylinder 10 ltr. mo2 with valve , bipap machine , elvo gloves – per pair , lyarigoscope set adult with led – each , lyarigoscope set child with led – each , hemoglobino meter digital – each , massiring mug – each , hair tremer branded – each , hot air oven , urino meter , adk drain , concigated drain ( plastic ) , diatharmy plate for vally lab , laryngoscope adult set , laryngoscope ped. set , coutry pencil , crash card with steel drower , digital spirometer , carbonmonoxide monitor , pulse oximeterfor ccu ( specifications attached ) , pulse oximter with nib for ccu ( specifications attached ) , carm for ccu ( specifications attached ) , laryngoscope for ccu ( specifications attached ) , nibulisor adult with mask , nibulisor child with mask , nibulisor mask for adult , nibulisor mask for child , infant weighing scale , lc dcp and dcp basic instrument set ( specifications attached ) , small fragment lc dcp & dcp® instrument set, st. steel ( specifications attached ) , select lcp upgrade instrument set large & small fragment ( specifications attached ) , dhs / dcs instrument set ( specifications attached ) , css 4.5mm instrument set in vario case ( specifications attached ) , css 6.5mm instrument set in vario case , synream ( specifications attached ) , distractor set large ( specifications attached ) , distractor set medium ( specifications attached ) , bone forceps range ( specifications attached ) , general instrument set ( specifications attached ) , instruments for damaged screw removal ( specifications attached ) , chisel and impactor set ( specifications attached ) , tomofix instrumentset in syncase ( specifications attached ) , instrument set for minimally invasive plate insertion osteosynthesis ( mipo ) in vario case ( specifications attached ) , collinear reduction clamp in vario case ( specifications attached ) , reduction handles, toothed and rounded, small & large in modular tray ( specifications attached ) , mipo cerclage passer ( specifications attached ) , hohmann retractor ( specifications attached ) , soft tissue spreader set ( specifications attached ) , periarticular reduction forceps ( specifications attached ) , pelvic basic instruments ( specifications attached ) , pelvic reduction & retraction ( specifications attached ) , pelvic c clamp ( specifications attached ) , wire instrumnents set ( specifications attached ) , shoulder instruments ( specifications attached ) , gili pot ss , weight machine hanging ( for bmw ) , sterlizer indicator , bio west trolly single bin ( ss ) , bio west trolly doubble bin ( ss ) , bio west trolly triple bin ( ss ) , variable pipette ( ce certified ) , variable pipette ( ce certified ) , spirometer , carbon monoxide breath monitor , portable 3 channel ecg recorder , 300ma fixed x ray unit with multi position table , 100 ma, 100 pps line frequency mobile x ray , biphasic defebrillator with aed , ctg nst machine , digital radiography system high frequency ( digital x ray ) , high end premium ultrasound system , syringe pump , ales tissue forceps6 no. , stragiht artery forceps 6 no , curved artery forceps 6no , mayo curved sessior6no , cord clamp forceps , mayo straight sessior 6 no , fomigator macine , tooth forceps , towel clip , bp blade holder 4 no , needleholder 8 no. , drum big size , drum medium size , sucetion pipe , formalin chamber big size , cut sheet , opration gown front with plastic , spinal cover sheet , opration plain seat , opration table cover ( plastic ) , plastic soft sleeper7no , instrument trolly table big size , split ac 1. ton with installation , split ac 1.5 ton with installation , split ac 2 ton with installation , window ac 1. ton with installation , window ac 1.5 ton with installation , window ac 2 ton with installation...

Patliputra Medical College - Jharkhand

35568045 purchase supply of machine equipment 1.1 boiling water bath with lids having 8 12 2.0 balance semi micro 3.0 balance micro 4.0 vortex mixers 5.0 constant temperature water bath 6.0 magnetic stirrer 7.0 calorimeters 8.0 stop watch 9.0 spirit lamp 10.0 samplers ( auto pipettes ) different volume range 11.0 electrolyte analyzer for the estimation of ph / na / k / ca / cl specifications: onboard reagent inventory, one point and two point automatic / manual calibration automatic washing of the sample needle. contamination free non volatile memory, no data loss during power failure. principle ion selective electrodes ( ise ) based on direct potentiometery sample types whole blood, serum, plasma, urine. sample volume 70 150 ul. throughput 100 or more samples per hour memory 1000 or more patient results inbuilt thermal printer , large lcd display 240 x 128 service and application support on the installation and post installation. complete training on handling the instrument, programming interpretation has to be given free of cost by the supplier. should be 1kva online ups with battery backup 30 minutes, all accessories and start up reagents. it must have 3 years warranty on analyzer with ups and battery and it should be written on affidavit. brochure should be attached of the equipment and demonstration for final consideration. 12.0 bp blade surgical 13.0 microtome ( leica 818 ) cutting blade 14.0 paraffin embedding wax bath 15.0 tissue floating bath 16.0 hot plate 17.0 fire extinguisher 2kg 18.0 fire extinguisher 4kg 19.0 monocular microscope 20.0 distilled water plant 21.0 anatomical charts 22.0 anatomical diagrams 23.0 plastic tank for storing soft & dissected parts 24.0 x ray view box ( led ) 25.0 x ray view box 4 plate 26.0 smart board 27.0 dead body refrigerator 28.0 large bath tub for cadaver ( l 152 cm ) 29.0 drawer cabinet 30.0 treadmill test ( tmt ) machine 31.0 airway management mannequins adult 32.0 male catheterisation mannequins 33.0 nasogastric tube mannequins 34.0 centrifuge machine 12 tube brushless digital 35.0 mannequins for iv injection basic model 36.0 mannequins for in injection 37.0 mannequins for pleural aspirator 38.0 mannequins for sc injection 39.0 nervous system:the model should be minimum half life size. this should be a schematic representation of the central and peripheral nervous system, including of spinal nerves radiated from central nervous system to other parts of the body. display of positions minimum 39. made of hsp resin on a firm base. 40.0 brain:the model should be suitable for understanding the correlation of brain parts. external features of the brain, cerebral hemisphere, brain stem and cerebellum. it should be dissectible in atleast 9 parts. 41.0 heart:the model should be 3 times larger than life size to show external feature and internal structures of heart and it’s relation between large blood vessels. should be dissectible at least into 5 parts. made of pvc plastic material. 42.0 pumping heart: it should be 3d working plastic heart model with clear chambers. should have squeeze bulb to pump simulation blood through clear heart chambers. 43.0 respiratory system: it should be well illustrated and informative, upper half displaying nasal cavity, oral cavity, trachea, bronchia, bronchial tree in pulmonary lobe, right and left lungs cut open, heart in situ, pulmonary blood vessels and diaphragm with muscles attached to it. 24 positions marked. in lower half of the model should display enlarged pulmonary acinus displaying pulmonary alveoli, alveoli saccules, bronchial artery and veins and alveolar capillary network. positions should be marked. it’s size should be atleast 40x80cm, made of hsp resin and mounted on a sturdy base. 44.0 gastrointestinal tract: the model of human digestive system should be in median section dissectible into 3 parts. duodenum, caecum and rectum opened, rectum unfolded. transverse colon and front half of the stomach should be removable. the oral cavity, pharynx, esophagus, stomach, liver with gall bladder pancreas, gi tract and spleen should be displayed. it’s size should be atleast of 40x80cm life size, made of hsp resin, mounted on a sturdy frame. 45.0 kidney macrostructure: the model should be detailed life size model featuring kidney, adrenal gland, renal and adrenal vessels and upper portion of the ureter. it should be dissectible into 2 parts to reveal the cortex medulla, cortex vessels and renal pelvis. model can be removed frm the stand for instruction and education. 46.0 kidney microstructure: the model should be 3d to show 5 sides view of structures in details of kidney section, parenchyma of kidney and nephron, renal corpuscle and arrociated structures, loop of henle and associated structures. it’s size should be atleast 30x20x24cm, atleast 45 parts labeled and made of hsp resin 47.0 haemoglobine ( hb% ) analyser cuvette system o / p 25mm 48.0 video laryngoscope ( ce certified usfda approved, blade curvature 85° to 90° ) 49.0 fibre optic bronchoscope with hd screen & eye piece ( outer dia. less than 5.2mm and more than 4.5mm, >160° tip movement in all 4 directions, with suction channel, ventilation channel and light source ) 50.0 fibre optic bronchoscope with eye piece ( outer dia. less than 3.2mm, with suction channel, ventilation channel and light source, >160° tip movement in all 4 directions, ce certified usfda approved ) 51.0 epidural full set latex free continuous epidural anaesthesia kit containing g18 / g16 epidural touhy needle with large crystal clear grooved transparent hub & epidural catheter of g20 / g19 with catheter connector. epidural catheter in the kit made of 2 layers inner layer of polyamide & outer layer of polyurethane. 52.0 single lumen central venous catheters 16g polyurethane, length 15 cm, seldinger needle 18g, dilator, scalpel, guidewire and connector to prevent back flow and air embolism, ecg lead. 53.0 double lumen central venous catheter 7f ( 16g / 16 g ) , polyurethane, length 15 / 20 cm, 18 g valve needle having side port dilator, scalpel guidewire and connector to prevent back flow and air embolism, ecg lead. 54.0 triple lumen central venous catheter 7f ( 16g / 18g / 18g ) polyurethane, length 15 / 20 cm, 18 g valve needle having side port dilator, scalpel, guidewire and connector to prevent back flow and air embolism, ecg lead. 55.0 suction with pedal double chamber 56.0 electronic suction with pedal double chamber 57.0 fully automated elisa processor fully automated elisa processor fully automated elisa processor for processing up to 4 microplates of elisa. instrument should not have any startup time after switching on. should be capable of performing sample dilution, sample pipetting, reagent pipetting, washing and reading, etc. should have 4 independent incubators with optional facility to cover micro plates. the equipment should have four independent incubators with inbuilt shaking facility. the equipment should have programmable shake time. should have up to 120 samples loading capacity along with more than 288 pinching tip loading facility. reading method: single / mal method standard filters: 405 nm, 450nm, 492nm, 620nm with two optional filter positions. optical measurement range should be 0.00 4.0 od software should provide flexibility to use control and calibrator positions for sample loading. software should be windows based software for easy handling. software should allow retrieving the older calibration curves and can be readjusted according to new values one or two calibrators. the equipment should have two syringes i.e., two needles for faster pinching of samples and reagents. the equipment should be capable of processing three steps simultaneously like washing a micro plate, reading a micro pate and at the same time pinching reagents / samples into another micro plate the software should provide flexibility to use small tips for samples, large tips or reagents or similar tips for both samples and reagents pipette tips should be disposable& non carbonated non conductive type washer unit should have 16 needles, 8 needles for dispensing and 8 needles for aspirating wash buffer with level sensor facility software should be capable of bi directional host data interface, facilitating the creation of new work list software should have an option of automatic creation of lj graphs for qc samples. there should be provision for demonstration of equipment before final purchase if required. should be 2kva online ups with battery backup 45minutes, complete pc set, all accessories and startup reagents. 3 year warranty of machine, ups and battery must be written on affidavit, brochure should be attached. 58.0 blood & body sterile fluid culture instrument the system should be a fully automated, walk away system capable of culture and detection of bacteria & fungi from blood and sterile body fluids. the same system should be capable of mycobacterium culture. should have capacity to hold at least 120 bottles at a time. the capacity should be upgradable. the system should continuously monitor the samples for growth and report it as and when it occurs. system is based on colorimetric / fluorescence technology for interpretation of results. the culture media provided should have sufficient mechanism to neutralize the inhibitory effect of antibiotics and other substances in blood. a ) culture media should be available for detecting bacteria and fungi, including fastidious organisms. b ) the culture bottles should be unbreakable in normal conditions. c ) the culture system should be suitable for processing blood and sterile body fluids. should be capable of processing both adult and the pediatric samples. the system should be maintenance free without any need for regular calibrations, controls or standards run by the user. the system should use leak proof and on noninvasive system to avoid contamination of equipment and environment. the culture bottles should have high stability and ( 4 6 ) months shelf life. the system should be supplied in a complete system with all accessories and startup reagents. any software or database updates should be done free of cost by the firm, during the life of equipment, as and when it is released by the manufacturer. required training, technical literature and support should be provided by the firm. safety feature should have ce ( conformite europeene ) from european union notified body having 4 digit safety identification number and us fda there should be provision for demonstration of equipment before final purchase if required. should be supplied 2kva online ups with battery backup 45minutes. 3 years warranty of machine, ups and battery must be written on affidavit. brochure should be attached. 59.0 microbial identification and susceptibility testing system the system should be fully automated, walk away system for identification and antibiotic susceptibility testing for bacterial isolates. including automated filling of cards / test system / dispensing based on colorimetric technology with sealed bar coded disposables cards. the system should be capable of simultaneous testing of minimum of 55 samples, ( either 55 id or ast ) . should be able to anaerobic identification & sensitivity analysis of gram positive bacteria, gram negative bacteria and yeast like organisms. the system should be capable of identifying for fastidious organisms like h. influenza, n.meningitidis etc. the system should be able to detect antibiotic resistant organism like mrsa, vre, hlar, vrsa, b lactamase and esbl production. it should be an intelligent system and should give alert for any unusual antimicrobial resistance. the system should have barcode scanning system for easy management of samples and which capable of testing for antimicrobial susceptibility of yeast and yeast like organisms. the system should be maintenance free without any need for regular calibrations, controls or standards run by the user. the system should use leak proof and noninvasive system to avoid contamination of equipment and the environment. the identification system should complete in itself without the need of an additional test done manually. the system should have panels for identification alone or antibiotic susceptibility alone. the reagents / strips should have high stability and ( 4 6 ) months shelf life the system should have facilities for data management and storage and quality control. the system should be supplied in a complete system with all accessories, hardwares like computer, printer etc and the required software and startup reagents. the system should have expert software for analyzing the raw data and provide detailed interpretive results. any software or database updates should be done free of cost by the firm, during the life of the equipment, as and when it is released by the manufacturer. should have ce ( conformite europeene ) from european union notified body having 4 digit identification number and us fda. there should be provision for demonstration of equipment before final purchase if required. should be 2kva online ups with battery backup 45minutes. 3 years warranty of machine, ups and battery most be written on affidavit. brochure should be attached. 60.0 large bath tub for adult ( l 152 cm ) 61.0 radiant heat warmer ( servo controlled ) 62.0 multipara monitor with infant & pediatrics spo2 probe & pedia cuff 63.0 syringe pump 64.0 blood gas machine 65.0 bubble cpap with compressor with 5 disposable interface 66.0 hfnc with compressor with baby interface 67.0 portable oae instrument 68.0 o2 hood 69.0 o2 flowmeter 70.0 pediatric laryngoscope ( curved & straight ) 71.0 pediatric ambu bag with different size mask 72.0 emergency crash cart trolley 73.0 portable suction 74.0 endotracheal tube from 2.6 to 6 no. 75.0 o2 nasal cannula neonatal & infant 76.0 procedure spot light 77.0 digital bp machine 78.0 glucometer 79.0 platelet concentration system centrifugal machine 80.0 battery operated drill & saw • dual function drill • combines the function of acetabulum reaming and normal drilling. • 1200 rpm & high torque. • 1drill hand piece. 1drill chuck, 1reamer adopter. 2nos. battery. 1c arger, 1chuck key, 2 ring in safety box. • saw spec: rpm 0 18000 osc / min. • oscilating saw. • powerfu1 , portable. variable speed without step. • 1 saw hand piece, 2 saw blade, 2 battery, 1 charger. 1chuck key, 2ring • company should be ce & iso 9001: 2015certified 81.0 pneumatic tourniquet double cuff • cuff pressure range: 10 to 460mmhg. • pressure regulation: better then+ 5mmhg of set point. • battery backup: 3 hrs battery backup ( in case of full charge ) • digital display: digital display of set pressure, actual pressure, elapsed time and set time • cuff: different sizes of five cuffs washable and easy fitting large, big, medium, small & pediatric ) . 82.0 horizontal high pressure steam sterilizer ( autoclave ) • autoclave should be shell consist of chamber jacket. the chamber is made of thick stainless steel sheet. to minimize the heat loss the shell has been insulated with glass wool and covered with ss 304g cover. • the shell is mounted on a sturdy ms tubular stand. boiler id fitted with auto pressure control device to set and maintain the chamber pressure. • door and ring should be made of thick stainless, steel plate. fitted with semi automatic temp. control system steam lock mechanism & jointless silicon gasket. • should be supplied with: water inlet / outlet valve, water level indicator with safety valve fitted with boiler, pressure gauge. semi automatic temp. controller & low water cut of system with alarm. • size: 20x48, load 12 kw. 83.0 c arm machine : microprocessor controlled c arm machine with fpd should provides the excellent image quality at low radiation ideally suited for general surgeries in many application fields and special application such as orthopedics, urology, gastroenterology, pain management. spine fixation. neurology & angiography procedures. a ) flat panel detftcor:•receptor type should be of amorphous silicon technology • conversion screen should be of csi• fpd with 20 x 20cm size should be provided • image matrix should be 1k x 1k or more • pixel pitch should be 210 um or less. • adc conversion should be 16bit or more. b ) monitor on trolley: 1 no. 32 colored monitor with split screen for live & reference image display is provided on mobile trolley c ) monitor on c carriage: touch screen console mounted on c carriage for the operator.d ) c arm movements: fully counter balanced all movements 1. rotation: +180 degrees. 2. motorized up / down: 430mm or more.3. horizontal travel: 210 mm or more 4. arc orbital movement: 120 degrees.5. wig wag: ±12.5 degrees. 6. source to image distance should be more than 950mm. 7. depth of c should be at least 650mm free space should be 750mm or more steering handle with + / 90 degree movement for both side diagonal scan. e ) x ray generator: i. high frequency ( 50 khz ) . 2. output power should be 6kw or more. 3. fluoro & rad. kv 40 to 120 kv. 4.digital spot: 60m.a or more 5.pulse fluoroscopic ma ( peak ) : • up to 10ma or more ( normal mode ) • up to 70ma or boost flouro mode ) . f ) x ray tube: • monoblock tube head having dual focus rotating anode x ray tube of focal spot 0.3mm ( small focus ) & large focus ( 0.6mm ) should be provided. • anode heat storage capacity should be min 300khu. lead collimator shutters with preview radiation free should be provided. g ) control: control should have the following: touch screen monitor mounted on c aria carriage for image & exposure parameters control is provided with following functions and indications: on gui screen • fluoro and radio mode selection. • image rotation & flip • image transfer to 2nd monitor. • fluoroscopy timer ( five minute cumulative timer with buzzer that activates after the completion of 300 seconds of exposure to reinitiate the exposure reset switch is provided ) . • abs ( automatic brightness stabilization ) selection for hand free operation also known as adr • kv and mas increase and decrease switches. • x ray on indicator. • collimator open / close switches. other • switches for updown movement of c on both side of machine frame. • emergency off switches mounted on monitor. • machine on / off key switch. • flouro, cine & sport switch on both side of panel h ) memory system include the following: image acquisition: • image processing software with real time image capturing, storage, and display in 1k, x , 1k format. • digital radiography ( spot ) exposure mode is available. user selectable view on single monitor with 4k resolution. • user selectable image display for live & reference view. dsa: • up to 4 fps image acquisition for dsa • r mask • land marking • pixel shift. roadmap: • real time path map • roadmap clear • peak hold image processing: • real time noise with reduction with averaging up to 16 • recursive filter lot• image smoothing, drc, contrast, brightness, sharpness • interactive zoom and pan • dynamic zoom up to 400% • pre programming for image setting for different operating modes • image inversion • user selectable preset setting. • ww / wl level adjustments • image flipping and image rotation clockwise or anti clockwise. • live to reference view on single monitor • cine loop play ( auto and frame wise ) • real time image flip ( horizontal / vertical ) • metal compensation with abs • fluoro navigation compatible. collimator: ultra fast preview collimator. dap module: • dap dose integrated in software and total summary for fluoro / cine saved. • real time patient dose monitoring display with overdose warning message. mag: • real time three step digital mag. touch monitor • touch based console for frequently used parameters along with image display. j ) other requirements: • the company should be iso certified company.• the quoted model should be european ce certified with notified body no.• the unit should be approved by aerb.• the company should have a service center in state.• the company should have proven track record in govt. sector. dicom features •connectivity with dicom workstation / pacs • dicom send / storage commitment • dicom print • dicom work l ist. storage: • upto 780 gb hard disk for storing images • fluoro saving as per user need • lih saving as per user need. annotation: • rectangle, ellipse. line, text. measurement: • stenosis measurement. length measurement. i ) power requirement: • the unit should be operable en single phase 230 v = 10% ac, 50 hz. • inbuilt electronic ‘, 31, a2e stabilizer should be provided. • ups for power backup of the software should be provided. 84.0 o t table electromechanical c arm ot table with orth attachment table should be 304 ss ( all attachment ) • table should be stainless steel grade 304 to avoid rust. • flexible, interchangeable components and a wide range of positioning accessories allow it to be configured individually for separate disciplines. • radiolucent table top material compatible for c arm. • in built kidney bridge. • battery backup available • table can be operated with selector switch & handle when remote failure. table should be supplied with ortho. attachments & standard accessories. 85.0 stethoscope ( single bell tube ) 86.0 olfactometer 87.0 self illuminating snellen’s chart 88.0 centrifuge machine platelet concentration system or centrifugal machine 1. maximum speed should note exceed3500 rpm 2. should have half hp brushless dc centrifuge motor. 3. can be programmable to 0 to 99 minutes. 4. machine should have 2 stage horizontal roter can hold 4 tube buckets at a time 5. machine should have air flow system to cools down the rotor chamber protect the blood samples and maximize the sample intefrity. 6. machine should equipped with shatterproof clear lid and with safety interlock system. 7. machine should have lock and unlock iner on the panel. 8. machine can be used to prepare30 ml 60 ml prp and same amount of bone marrow concentration 89.0 microtome 90.0 digital physiograph with data acquisition system • number of inputs 4 channels. 2 amplifiers for recording bio potentials & 2 general purpose amplifiers channels. • 1 stimulation unit capable of delivering square wave pulse of over defined parameters, voltage range 0 10v, pulse duration range 1 1000msec, frequency range 0 100hz, current range 0 20ma, integrated and synchronised with software. • data sampling frequency more than 10khz and linked to the computer through high speed usb2 port. • facility for ecg leads ( i, ii, ill, avl, avf, avr etc ) with real time cardiac axis and vector analysis. • four force sensor balance board for body sway analysis that communicate with the software. • online & offline analysis with various export options for common formats. • software with step by step instructions, protocol and experimental design for performing various experiments in physiology teaching applications. also should have sample data for animal experiments for demonstrating to the students. • online facility for students to preview and analyse the data from anywhere outside the laboratory through internet would be preferable. ( optional ) • licensed software it should have various automatic analysis modules for ecg, hrv, blood pressure, peak analysis, spike histogram etc • real time data streaming with excel, matlab and other common formats. • necessary certificate for safe use for human. • dual core 13 processor based desktop computers with dvd rw, 4 gb ram, 11013 500 gb, 19’’ led monitor, original windows os, ups and suitable printer should be supplied. • demonstration and training at site. • iso, iec and other safety and quality certificate. 91.0 cal for amphibian experiment • the software program should be a user friendly interactive desktop application, capable of running several applications simultaneously within one program including: data collection, background materials, data analyses, and reporting options. • the software should have interactive experiments including content, procedure, literature, videos etc. • it should allow students to save their laboratory progress and pdf report of their data. • human physiology, airflow, autonomic nervous system ( ans ) , blood clotting, blood counting, blood pressure, body temperature, breathing, cerdiorespiratory effects of exercise, cardiovascular effects of exercise, diving response, electroencephalography ( eeg ) , electro oculography ( egg ) , energy expenditure & exercise, glucose absorption heart & ecg, licari & peripheral circulation, lean sound, kidney & urine, lung volumes mechanics of ventilation, muscle & emg, peripheral nerve function, reflexes and reaction times, sensory illusions, sensory physiology, skeletal muscle function spinal reflexes, stroop test, water balance. • animal physiology animal metabolism, frog i lean, frog nerve, frog neuromuscular junction, frog skeletal muscle, gin trap closure reflex, intracellular action potentials. • in vitro experiments guinea pig ileum experiment dose response curve, guinea pig trachea experiments physiological antagonism, experiments on the isolated, perfused mammalian heart. • in vivo experiments effect of drugs on blood pressure dog blood pressure, • 58 effect of miotics and mydriatics on rabbit eye , study the effects of several pharmacological agents on rat blood pressure • other experiments pharmacology airways resistance and vascular resistance mammalian atria, heart, jejunum, uterus stimulated ileum, rat vas dcfcrens unstimulated ileum, rat vas deferens. rota rod experiments to test sedative agents. cookes climbing experiment to differentiate between sedative agents and anti psychotic drugs analgesic drugs using hot plate, using tail flick test and writhing test, anti inflammatory drugs using carrageenan rat paw edema model, local anesthetics rabbit corneal reflex, guinea pig infiltration anesthesia, frog withdrawal relex • compatible computer with 19 inch led monitor, to be provided with system. • lifetime license cost for offline model and subscription cost ( 5 years ) can be provided separately. the software must have a facility to edit and customize lesion and create their own experiments as per the lecturer choice for at least warranty terms. • the system should be upgradable to online cloud based system in future so that the student can the data from any¬where using internet facility. • instrument four channeldata acquisition system for human & animal physiology experiments for biophysical parameters interfaced with above cited software for better hands on training to students. • mandatory demonstration and training. • necessary certificate for safe use for human. 92.0 software ex pharm version t2.00 and ei for windows 93.0 mannequins for intravenous arm training adult 94.0 ophthalmoscope 95.0 schiotz tonometer 96.0 over head shadowless light ( for dissection work ) 97.0 scalpel blade no 22 98.0 knife handle ( bp handle ) no 4 l 99.0 knife handle ( bp handle ) no 4 100.0 knife handle ( bp handle ) no 3 101.0 surgical rectangular tray 102.0 surgical rectangular tray 103.0 gastric lavage tube 104.0 ryle’s tube 105.0 plain rubber catheter size 12 106.0 digital weighing machine for viscera 107.0 complete set of fmt projector slides 108.0 machine for pointing of knife 109.0 presser machine for washing 110.0 fully automatic immuno analyzer ( clia machine ) fully automated immunodiagnostic system, should be based on enhanced micro well based chemiluminiscence , walkaway, high throughput system for hiv i & ii ( 4th generation ) , hbsag, hcv and syphilis with latest acceptable technology. machine should be newly branded. it should have a capability to do the assay in continuous, random or batch mode. it should have continuous loading capacity of 80 or more samples. it should have the disposable tip sampling system to overcome the carryover and or cross contamination probability. it should have an ability to do on board dilution and tube dilution for high and abnormal samples. it should have the disposable tips system to avoid reagent carryover. pipette tips should be disposable & non carbonated non conductive type. it may have continuous random access to loading and unloading reagents. equipment should be latest version and must not be refurbished. at least 4 parameters must be done at one time. the instrument should provide comprehensive process check that performs monitors and verifies each step throughout sample and assay processing. throughput of at least 70 or more tests / hr. the software should provide flexibility to use small tips for samples, large tips for reagents or similar tips for both samples and reagents. instrument should not be more than 20 minutes start up time after switching on. software should be capable of bi directional host data interface, facilitating the creation of new worklist. software should have an option of automatic creation of lj graphs for qc samples. software should allow retrieving the older calibration curves and can be readjusted according to new values of one or two calibrators. software should provide flexibility to use control and calibrator positions for sample loading. software should be windows based software or any secured software with easy handling facility. should be provided 2kva online ups with battery backup 45minutes. brochure must be attached of the equipment. system with ups & battery should have five years warranty and it’s must be written in affidavit. 111.0 hi speed centrifuge machine ( digital ) should be automated rotor detection. should be maximum speed 15000 rpm or more rpm, rotor tube capacity 24 or more ( 5 7ml ) . should be controlled by microprocessor and backlit color lcd display. should be brushless motor and maintenance free and no carbon deposits. 112.0 platelet incubator with agitator platelet incubator – should have single pane tempered glass door for safety and better visibility of platelet bags should have built in microcontroller based temperature recorder and controller unit ( trcu ) positioned at eye level for better visibility must have 7 day circular chart recorder and accuracy should be + / 1 degree celsius should be able to maintain a temperature of 22 degrees with + / 1 degrees variations should have display of 4*7 segment led with 0.5ºc display resolution should have refrigeration with thermo electric cooling method & 4w led tube for uniform lighting should comply iec safety / emi / emc standards, iso 9001 , iso 13485 certified and ce marked should have chamber mounted electrical outlet agitator should have built in voltage stabilizer should have cfl lamp inside the incubator should have magnetic gaskets for doors to prevent loss of air must incorporate a inbuilt battery back up of 2 hours to ensure continuous operation of the trcu during power failure should have cfc free pu insulatiom platelet agitator should be able to store minimum of 48 platelet bags should have 65 + / 7 cycles motions per min should have agitation pause function for 10 sec should have led indication for blown fuse should have ss304 grade sliding stainless steel trays should comply iec safety / emi / emc standards, iso 9001 , iso 13485 certified 113.0 conference room: 1. supply and installation of conference table one side semi circular 35’x 5.5’, with 1.5’ space in the middle for walkway, wire management, etc., 2 nos. of electrical socket for all seats. 2. podium with required sockets, switches, gooseneck mic. etc. 3. supply of revolving executive chair high back cushioned. 4. supply of revolving without wheel chair medium back cushioned with arm 30nos. 5. providing fixing cabinet matching to table 6’x3’ for storage. 6.supply of computer table & revolving computer chair. 7.laptop: intel i5 processor, 8gb ram, 512 gb m.2 ssd, windows 10, microsoft office, with anti virus software. 8. laser mfd with more than 20ppm printing capacity. 9. full hd pan / tilt / zoom ( ptz ) camera with usb 3.0 video output interface. equipped with 1 / 2.7 inch image sensor with full hd 1080p output resolution. 10x optical zoom, wide shooting angle, low light compatible. with ir remote control. 10. ceiling tile microphone for clutter free setup with built in aec, dare feedback eliminator algorithm as well as voice lift & noise cancellation. 11. audio dsp which provides professional grade audio with built in aec, noise cancellation and feed back eliminator. 12. av usb hub for unififed connectivity on a single cable. 13. powerful, energy efficient class d amplifier with 240w power driving capability. 14. 2 way performance speaker suitable for a wide variety of applications, ensuring true to nature, high fidelity reproduction of music and speech. 15. 4k uhd 75” interactive flat panel with atleast 20 points multi touch capability. 16. laser pointer. 17.laser pointer. 18.installation and programming of the conference system including all wires, cables, connectors and accessories as required. 19. providing fixing auto door closure in door, curtains including providing curtain rods, good quality. 20. providing fixing auto door closure in door, curtains including providing curtain rods, good quality. 21. supply and installation of electrical wiring, switches, led ceiling lights, fans, etc. as required. 22. light dimming facility for central lights. 23. supply and installation of 1.5t 5star inverter split ac with all connection and suitable stabilizers. 24. supply and installation of online ups 2 kvs with required 65ah smf batteries and it’s connection. 25. cutlery, flower vas, etc. 114.0 medical education unit: 1.auto tracking ptz camera is a professional grade high quality 10x zoom ptz camera that also can track a moving presenter automatically while shooting video. combining a high performance pan / tilt / zoom camera, motion sensitive tracking, ideal for mid to large size lecture capture, bridging the feature of webcam and professional ptz cameras in the market providing output over usb, hdmi & ip stream. 2. media station: all in one device to combine 2 video and upto 2 audio sources in a full hd mix video for recording, editing and live streaming. automatically perform backup to a server via ftp and sftp if configured or even cloud. 3.multimedia projector: short throw projector 16:10 aspect ratio, wxga resolution, 1280p full hd, 3400 ansi lumens, with bracket for the projector. 4. interactive white board 92” ceramic for projection display and writing with multi touch capability upto 10 touch points, with smart pens. 5. laser mfd ( scanner+ printer+ copier ) with more than 20ppm printing capacity. 6. laptop: intel i5 processor, 8gb ram, 512 gb m.2 ssd, windows 10, microsoft office, with anti virus software. 7. green chalkboard, magnetic, steel with aluminium frame 4’x3’. 8. interactive digital podium with controlling software, touch control panel, min. 22” interactive touch screen, ( cpu 10th gen core i5processor, 8gb ram, 1tb hdd, dvdrw optical drive, windows 10, microsoft office ) central control panel for one touch on and off switch and module for laptop connection. input / output port usb, xlr, hdmi, vga in & out, audio in & out, lan, power socket, led light with switch, digital camera, central power control with desired number of power output plugs. equipments / gadgets used in the podium should be based on international qualitative standard, space to incorporate amplifier, gooseneck microphone, document camera / visualiser and matrix switcher, etc. capable for presentation also from android & apple. with gooseneck microphone, easy to use all in one wired system for presenters. 9. webcam: 1080 full hd quality video with omnidirectional mics. 10. document camera / visualiser to capture a3size, min. 8 megapixels camera, min. 12x digital & 20 x optical zoom, led lights, 1080p full hd output, image tilt / rotation. 11. handheld microphone system, easy to use all in one wireless system for presenters. rely on a solid transmission with up to 10 compatible channels in a stable uhf band 2nos. 12. lapel microphone system, easy to use all in one wireless system for presenters. rely on a solid transmission with up to 10 compatible channels in a stable uhf band. 13. professional grade audio dsp to provide a single usb cable for clutter free, connection of peripheral devices like usb cameras, speakerphones as well as panels or displays to computer or laptop. 14. powerful, energy efficient class d amplifier with 240w power driving capability. 15. powerful 2 way performance speaker, high fidelity reproduction of music and speech 4nos. 16. oval table 4’x3’ wooden with good quality laminates 6nos. 17. executive table 6’x3’ with side drawers & cabinet wooden with good quality laminates 4nos. 18. executive revolving chair medium back 6nos. 19. supply of good quality cushioned chairs for participants 50nos. 20. auto door closure in door, curtains including curtain rods, good quality. 21. proving fixing vertical blinds good quality 4. 22. electrical wiring, switch socket, led lights and accessories as required. 23. installation and programming of the audio video system including all wires, cables, connectors and accessories as required. 24. supply and installation of 1.5t 5star inverter split ac with connection and stabilizers 2nos. 25. supply and installation of inverter 1700va ( 24v ) with 150ah battery and it’s connection....

Patliputra Medical College - Jharkhand

35568027 purchase of machine & equipment, misc. item, book and journal, chemical, glassware, chart and model, stationary, furniture & repaire maintenance 1.1 mortuary freezer 2.0 ac 3.0 fan 4.0 tube light 5.0 inverter+battery servicing 6.0 online ups – 2 kva 7.0 online ups – 4 kva 8.0 30 kva generator repair and change of battery 9.0 water purifier 10.0 computer 11.0 laptop 12.0 xerox machine 13.0 samsung multi xpress 2200 xerox 14.0 hp laserjet 1020 plus printer 15.0 printer 16.0 steriliser 17.0 ophthalmoscope 18.0 retinoscope 19.0 indirect ophthalmoscope 20.0 schiotz tonometer 21.0 change of lan switch 22.0 provision of internet connection 23.0 inverter point wiring with all accessories per mtr. 24.0 point wiring with all accessories 1.5 sq.mm / mtr. 25.0 point wiring with all accessories 2.5 sq.mm / mtr. 26.0 point wiring with all accessories 4 sq.mm / mtr. 27.0 point wiring with all accessories 6 sq.mm / mtr. 28.0 point wiring with all accessories 10 sq.mm / mtr. 29.0 3 ph. cable wiring for machine equipments 25 sq.mm / mtr. 30.0 3 ph. cable wiring for machine equipments 35 sq.mm / mtr. 31.0 3 ph. cable wiring for machine equipments 95 sq.mm / mtr. 32.0 3 ph. cable wiring for machine equipments 120 sq.mm / mtr. 33.0 3 ph. cable wiring for machine equipments 300 sq.mm / mtr. 34.0 chemical earthing for machine equipments 35.0 copper strip for earthing connection per mtr. 36.0 name plate rewriting per sq. inch 37.0 pvc pipe ½” for bathroom with supply and fixing 38.0 pvc pipe ¾” for bathroom with supply and fixing 39.0 pvc pipe 1” for bathroom with supply and fixing 40.0 pvc pipe 2” for bathroom with supply and fixing 41.0 supply and fixing of valve ½” 42.0 supply and fixing of valve ¾’” 43.0 supply and fixing of valve 1” 44.0 supply and fixing of valve 2” 45.0 drain pipe for wash basin 46.0 plastic angle cock 47.0 plastic bib / pillar cock 48.0 repair of revolving chair & wheel changing...

Health Department - Jharkhand

35055011 rate contract for supply of equipment and consumables at sadar hospital godda , drugs items : , digitalx ray film 12x12 , digitalx ray film 10x12 , digitalx ray film 8x10 , intracath for single use no. 18 , intracath for single use no. 20 , intracath for single use no. 22 , intracath for single use no. 24 , intracath for single use no. 26 , cat gut no. 0 ( plane ) , cat gut no. 1 ( cromic ) 1meter , cat gut no. 2 ( cromic ) 1 meter , vicryl no. 1 ( 180 cm ) , vicryl no. 2 ( 180 cm ) , mucus extractor , folys cathetar 16 no, 14 no. 12no. 10no. , cord clamp ( disposable ) , spinal needle 25 gauge , surgical gloves sterile bis 6 , surgical gloves sterile bis 6½ , surgical gloves sterile bis 7 , p.v. gloves sterile 6½ , p.v. gloves sterile 7 , surgical caps , bandage than , gouze than , savlon liquid 1ltr. , povidone iodine ointment , plaster of paris , rapidure pop cast 6 , rapidure pop cast 4 , cast pad 6 , cast pad 4 , betadine liquid , formallin liquid , cydex liqid , sanatory pad , baby dieper , uro bag , catheter 14, 16 , phenyle liquid , leucoplast 4 , leucopore 1 , leucopore 2 , surgical spirit bp 500ml , syringe 5ml , syringe 2ml , syringe 10ml , saline set bs ( 21g ) of 1.5 length , e.c. 500ml , cotton roll 400 gm , cotton roll 100 gm , e.c.g. roll , ultra sound gel , digital clinical thermometer bis , pedia drip set , sticking plaster ( surgical tape ) 2.5x9.10m , xylocaine jelly , prolin no 1 with round body needle , hydrogen peroxid solution 100ml , mersilk 3 / 0 , hand sanitizer , lactogen 1 ( pdr ) , lactogen 2b ( pdr ) , prenan 2bw ( pdr ) , o2 nasal cannula , ryls tube ( 6, 8 ) , suction tube ( 6, 8 ) , gluco strip , piricker , blood glucose ( strip ) + glucometer , suture trusilk ( 1 0, 2 0, 3 0 ) , curcuma oral gel , chloryexidine oral gel , intra oular lens ( lol ) , viscoelastic material , trypan blue dye , surgical dress , sterlium , povidone iodine scrub wash 10% , 26 gauge needle , crescent blade , blade keratome , blade side port , surgery mydriatic e / d , dark glass for eye surgery , rh view box , measuring cylinder ( glass ) , pasture pippette ( glass ) , tips rack ( big&small ) , beaker glass , vial rack , malascan ( rapid test for malaria ) , syphicheck ( vdrl ) , qualisa hbsag , qualisa malaria , qualisa hcv , qualisa hiv 4.0 , eryscreen plus , bovine serum albumin , anti ai lectin , anti h lectin , anti human globuin , hansaplast ( bandaid ) , injecta , virucheck , flaviscreen plus , sodiumhypochlorite , edta vial , plain vial , tissue roll , disposable swab , qualpro hiv ( raid ) , yellow tips , blue tips , blood bag single , requisition fror , blood bag sticker , terumo penpol graph paper 18% , b.t. set , donor form a4 size , hiv kit ( plan ) , hcv kit ( plan ) , printing materials , cover file , discharge slip , o.p.d. slip , referral slip , contingtion slip , monitoring sheet , wall clock with second hand , gauze cutting scissor stratight , dental probe , measuring tape , snellen vision chart , near vision chart , tongue depressor , mouth gag , mouth mirror , cheatle forceps , dressing tray with lid , suring needle curved , mask neonatal size ( 0 ) , mask neonatal size ( 1 ) , oxygen hood ( neonatal ) , designated new born tray ss with lid , ss tray with cover , scissors , artery forceps , sims speculum veginal double ended iss mediam , cord cutting scissor / surgical blade for cutting cord , bowl for antiseptic solution , kidney tray ( small ) , kidney tray ( big ) , episiotomy scissor , allis forceps , toothed forceps , thumb non toothed forceps , cuscoss / graves speculum vaginal ( large ) , cuscoss / graves speculum vaginal ( medium ) , cuscoss / graves speculum vaginal ( small ) , sponge holding forceps / cheatle forceps , ppiucd insertion forceps , screen seperator with stand , approan , pillow , pillow cover , side locker , chairsfor waiting area ( three seater ) , dari ( size 10x12 sft ) , executive office chair , electronic dental chair , dental compressor , root elevators set of 9 , periosteal elevators , extraction kit pedo ( set of 12 pcs. ) , extraction kit adult ( set of 12 pcs. ) , bone ronguer , mouth mirror tops magnified , cheek retractors , dental precision instrument ( probe + mouth mirror & handle + tweezer ) , spatula , composite spatula lm arte , non stick composite antorior / posterior placement instruments , gic mixing pad , gc gold label 1 luting & lining , gc gold label 2 glass inomer , plastic filling instrument kit set of 6 regular , fine grain silver alloy , mercury , scaler tips , vivadent tentric n collection system kit / n bond , confident 70 kva x ray machine , indian film developing clip , mouth probe , twiser , ball burnisher ( bb 22 / 23 ) # 1 , gic spatula , composit spatula , composite filling set , gic filling set , plastic spatula , amalgan + silver alloy , motor pistal , gic restorative material , gic luting material , composit ( ivoclar ) , ultrasonic scaler uds p , endo box with 72 holes , amalgan prepration bur 24 spk , scissor heath fior suture cutting , needle syringe destory 100% copper trausformer 100 watt , # 3 0 black braided suture , niddle holder mayo hegar , contrangle handpices fx 23 , imprint alginate powder , alginate mixing bowl , set up tray , conservative kit economy instrument set of 19 in pauch , orafil g 40 mg temprory filling material , zinc oxide engeol quick cement set , scalple handle no. 4 , bard parker blader # 12 / #15 , finger spreaders 21 mm , finger spreaders 25 mm , plugger 21 mm , plugger 25 mm , dental intraoral e speed film , dental x ray film holder , dental x ray film developer , dental x ray film fixer , light cure , k file set 06 / 08 / 10 / 15 / 20 / 25 / 30 / 35 / 40 / 45 / 50 / 55 / 60 / 65 / 70 / 75 / 80 number , sprader , dental round bur , dental stright bur , dental taper fissure bur , dental taper bur , fissure bur , pear bur dimoned , pear bur ( 330 ) , taper flat & bur , flade fissure bur , suture needle size 6 / 7 / 8 , suture scissor , x ray developing box , tray , dental stone , aerotar , micromotor complete set , imprassion tray dentulous perforated kit set of 8 , operating microscope , a scan , b scan , streak ratinoscope , o.t. table , operating chair , medicine trolly , sterlization set , surgical minor instrument , trial box+trial frame , rotating drum wall + near vision , retinoscope , opthalmoscope ( direct ) , kerotometer ( manual ) , torch o ( 3 cell ) , corneal loupe , slit lamp + autorofretometer + opthalmic chair , goniscopy , applanation tonometer , friedman visual field anaylosr , fundus photography machine , color vision chart , lencometer , retinal camera , tonometer , foreign body remover machine , trial lens set illuminated with 232 lens and trial frame , distant vision illuminated drum with snellens chart , jaeger eye chart , direct ophthalmoscope , indirect ophthalmoscope , retinoscope , 20 d lens , 90 d lens , 78 d lens , 4 mirror gonio lens , slit lamp ( aia 11 5s / 5l ) with applanation tonometer and motorised stand , autorefractokeratometer and motorised stand , non contact tonometer , abc dry powder 2kg. , abc dry powder 4kg. , abc dry powder 6kg. , co2 fireextinguisher 2kg. , co2 fireextinguisher 4.5kg. , co2 fireextinguisher 6.5kg. , co2fireextinguisher 9kg. , dcp 09 kg , abc dry powder 09 kg , abc dry powder 06 kg , fire ball , fire alarm , foam 09 liter , waterco2 , all in onedesktopcomputer ( withpreloaded ) intel corei5, operatingsystem:microsoftwindows10, 4gbram, 1tbhdd, dvdwriter, 20led ( lenovo / hp / dell ) +threeyearwarranty ( lenovo / hp / dell ) +threeyearwarranty , avretractor 1.stainlesssteel 2.doubleended, serrated 3.rustfree 4.sturdyconstruction 5.accuratedimensions , cctv ( 32dvr ) ( 32dvr:processorhighperformanceembeddedmicroprocessor, operatingsystemembeddedlinux, userinterfacegui, videoinput32channel, bnc, videooutput1hdmi, 1vga, videostandardanalog:32ch.@1080n ( 1~15fps ) , 24ch.@1080n, 16ch.@10 , colour coded bins black , colour coded bins yellow , colour coded bins red , colour coded bins blue , colourcodedbins yellow, redandblack ( bigandsmall ) , colourcodedplasticbags ( yellow, red, blueandblack ) , computer table fully wooden ( specification shouldbe attached in technical bid turms & condition ) , delivery tray , dental chair 1.shouldbeelectricallyoperatedwithzeroprogram. 2.shouldhaveaswitchoperatedoperatinglightwithminimumtwostepsof intensitycontrol. 3.shouldhaveautowaterconnectionforspittoonandtumblerwithautofilling sensor. 4.s , desktop computer ( with preloaded operating system ) intel corei3 7th gen. , operating system: microsoft windows 10, 4gbram, 1tb hdd, dvdwriter, 18.5 led ( lenovo / hp / dell ) +threeyearwarranty , desktopcomputer ( withpreloadedoperatingsystem ) intelcorei57thgen., operatingsystem:microsoftwindows10, 4gbram, 1tbhdd, dvdwriter, 18.5led ( lenovo / hp / dell ) +threeyearwarranty , hp laptop, i3 / 11th gen / 256ssd / 8gb ram with window10+office+quick heal antivirus installed labtop carry bag , hotairsterilizer ( oven ) digital construction: ovensaresturdy, withdoublewalledconstruction.innerchamberismadeofhighlypolishedstainlesssteel.outerchamberismadeofmildsteelsheetdulypre treatedinseventanksprocessforsurface , plastic appron disposible , plasticchair ( branded company ) ( witharm ) , portable o.t.ligh t ( absdoom19 single reflecter polycarbonate ) , portable o.t.light led , portable oxygen cylinder ( best quality ) , portable suction , ppiucd forcep ss , ppiucd insertion forceps , printer allone ( print, scan, copy, fax ) ( hp ) +threeyearwarranty , printer hp ( laserjet ) resolution 600x600 speedinppm18 ( a4size ) ( hp ) +threeyearwarranty , pulseoxymeter adult ( tabletop ) built inrechargeableli polymer battery for uninterrupted monitoring compactand flexible appearance, easy for carrying and be suitable for indoor and outdoor ( inambulance ) monitoring withuser friendly interface displ , pulse oxymeter baby ( fingertip ) type: bloodpressuremonitor powersupply: battery size: 57 ( l ) *33 ( w ) *32 ( h ) mm , radient baby warmer , refrigerator ( lg, whirpool ) , regional anaesthesia devices, epiduralset , revolving stool ( with cution hydrolic fully ss ) , electronic labour table , x ray machine 150 ma high freequecy , cr , printer double tray , cassette , online ups , ultrasound machine , ecg machine , mortury freezer ( capacity double body on two level, temperature range 0 10 degree ©, internal equipment n.2 steel body trays, structure and insulation stainless steel 18 / 10 aisi 304 inside and outside; insulation polyurethane thickness 70 mm, external dimensions ( w x d x h ) cm 94 x 238 x 184 ( tn and bt version ) ) , , spirometer , oxygen flow meter , oxygen high flow mask , hospital cleaning machine ( pneumatic wheels floor cleaning with scrubber & drye ) , portable x’ray machine ( high frequency portable ) , ac 1 tone , ac 1.5 tone , ac 2 tone , stablizer for ac 3 kba , stablizer for ac 4 kba , stablizer for ac 5 kba , blood gas analyser machine ( hand held arterial blood gas analyser ) , patient trolly with wheel...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

35054931 rate contract for supply .installation of eye equipment , name of equipment ( equipment for vision centre ) , direct ophthalmoscope , illuminated vision testing drum , snellens & near vision chart , battery operated torch 3 cells , name of equipment ( equipment for district hospital ) , surgical operating microscope ( basic ) , a scan with immersion , nd yag laser , phacoemulsifier...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

34617533 tender for supply of equipment. , a: medical equipments , stethoscope ( pediatric ) , sphygmomanometer with reusable pediatric cuff of 3 different sizes ( infant , child and adult ) , infantometer with integrated head piece and sliding leg positioner 10 99cm. , infantometer– for infants and small children , baby height measuring mat– for infants and small children. , electronic baby weighing scale , adult weighing scale , high measuring scale stadiometer , muac tape , head circumference tape non stretchable teflon synthetic material , b: for r.o.p , indirect ophthalmoscope with a 20, 28 or 30 d lens , a ) eye speculum ( alfonso infant wire speculum ) b ) scleral depressor ( wire vectis ) c ) rop speculum , laser console plus laser indirect ophthalmoscope with protective glass , retinal / fundus camera for neonatal screening , c: hearing equipment , screener pediatric audiometer , pediatric video auroscope ( otoscope ) , portable tympanometry / impedance audiometer instrument table top , oto acoustic emissions ( oae ) instrument , brainstem evoked response audiometer with insert phone bera or with both bone conduction auditory brain stem response ( bca br ) and air conducted ( ac ) . bone vibrator and baby insert phone abr with assr , tuning fork 1 set 4 tuning fork of 4 different frequencies 128 hz, 256 hz, 512 hz and 1024 hz , a utomatic abr screener without disposable electrodes ( rather with integrated electrodes ) stimulation level 35 dbhl , opd materials , sound proof room , d. vision equipments , torch penlight , direct ophthalmoscope , streak retinoscope , lea grating paddles , lea near single symbol playing cards , lea near single symbol with cord , hiding heidi , lea symbol low contrast 10m flip chart , e: tools for psychological test , receptive expressive emergent language test— third edition ( reel 3 ) , linguistic profile test ( lpt ) , developmental assessment scales for indian infant ( dasii ) , vineland social maturity scale , vineland adaptive behavior scales , developmental screening test ( dst ) by bharat raj , denver scale ii developmental screening test ii , stanford binet ( indian adaptation kulshreshta ) , *bayley iii screening test complete kit including manual, stimulation book, picture book, record forms 25 packs , d yslexia early screening test 4 6 years ( dest ) and dyslexia screening test junior ( 6 11 years ) , f: lab equipments , automated 3 part differential blood cell counter , microscope , semi automated analyzer , digital hemoglobinometer ( with cuvic & lancet ) , g: dentistry , pediatric dental chair , wall mounted dental x ray , table top front loading autoclave ( electrical ) , led curing light source ( composite ) , other dental equipments a. forceps set for extraction: set ( 1 adult +1 paediatric ) , b. restorative filling and carving instruments set , c. elevators set of 10 ( ten ) , d. airotor , e. dental ultrasonic scaler ( complete set ) , f. composite filling instruments: 1 kit , g. dental electric brushless micromotor , h. led curing light source: 1 complete unit , i. automatic water distiller: 1 , j. mouth mirrors:40 , k. probes straight: 40 , l. explorers: 40 , m. tweezers: 40 , n. cheatle forceps: 1 , o. kidney trays 10 , p. plastic cheek retractors 2 each , q. mouth props ( adult + pedo ) 1 each , r. cement spatula ( plastic and metal ) 1 each , s. matrix band and retainer ( both no1 & 8 ) 1 set , t. dental impression trays ( upper and lower ) 1 set each , u. rubber bowls 2 , v. plaster spatula straight and curved 1 each , w. suction tips ( metal ) 2 , x. mallet dental 1 , scissors 1 , needle holder 1 , bone chisel 1 , glass slab , scalpel handle : 1 , plastic patient drape 2 , hand scaler ( complete set ) 1 , mortar and pestel : 1 , lead apron: 1 , h: computers , computers with lan , i: physiotherapy equipments , therapy ball: a ) 65 cm b ) 45 cm and a pump for inflation , therapy mats 6ft x 3ft , 2ft long, diameter 8 inch ( bolster ) , 2ft long, diameter 10 inch ( bolster ) , small roll 13 inch long, diameter 3 inch , big height 14 inch; length 31 inch, breadth 17 inches ( prone wedge ) , small height 10 inch; length 26 inch, breadth 17 inches ( prone wedge ) , balanced board , kaye walker ( height 48 64 cm ) , bolster swing , wooden benches with cushion and rexene cover , splints ( ankle foot orthosis ) , special chairs with cut out tray ( tailor made according to need of the child ) , looking mirror , toy for play & stimulation ) , samll rattles , squeaky , puja bell ( clapper bell ) , soft toy , brush for tactile stimulation , theraputty , peg board , ball pool , balls of different size , gaiters , thick handle spoon , thick handle bent spoon , plastic spoon with long handle ( for babies ) , plastic glass with rim cut on one side , stainless steel plates with high rim , spouted cups , sensory integration equipments , pinspot and mirror ball bundle , mirror ball motor , led mirror ball , fire ball mounted on the roof , sound activated light , led bubble tube , optic fibers , blue led lights , blue led light chain , bubble tube , rotating drum , chime frame and beater , mirror chime bout , bolster swing , platform swing , tyre tube swing , rope ladder swing , rhythmic rocker , balance boards , bean bags , real size animal toys...

Health Department - Jharkhand

33743169 supply of medical equipments/chemicals/staionery etc. supply of medical equipments/chemicals/staionery etc. , list of lab instruments/chemiclas/staionery etc. , horrocks apparatus , a) horrocks black cup , b)horrocks white cup , c)test tube rack , glass beaker , flask(100ml) , flask(250ml) , pestle$mortar , centrifuge , chloroscope , test tube holder , stirrer , bunsen burner , innoculating loop , spirit lamp , height measuring tape , height measuring stand , stediometer , slide , shakirs tape , bp apparatus , pulse oximeter , stethoscope , glucometer with strips , lactometer , filter paper , burette and pipette , incubator,electric , ice lined refrigerator(i.l.r) , haemoglobinmeter , sound level meter , water sampling bottle from any depth , needle shredder , vaccine carrier , craft water testing kit , iodine teting kit , mosquito catching kit , clinical thermometer , first aid kit , otoscope , ophthal moscope , auto refractometer with keratometer , operating microscope , ab scan , direct ophthalmoscope , slit lamp , chemicals and kits , grams iodine solution(12ml) , sulphuric acid solution 20% (125ml) , methylene blue staining solutiin(125ml) , carbol fuschin staining solton(125ml) , safranine solution (125ml) , acetone (125ml) , bleaching powder(400gm) , immersion oil , leishman stain(125ml) , sodium hydrogen phosphate(na2 po4 500gms , sodium dihydrogen phosphate(na2 hpo4 500gms , sodium carbonate(na2 hc03) 500gms , sodium bicarbonate(na2 hc03) 500gms , whats mann no 1 filter paper(chromatography) , amino acids kit(all a.as) solids , ninhydrin 25gms , n butanol 500ml , n propanol 500ml , dethylbarbituric acid 100gms , sodium diethyl barbiturate 100gms , bromophenol blue(indicator) , zinc sulphate , sodium acetate 100gms , serum creatinine , serum bilirubin , alt/ats(sgot/sgpt) , alp(alkaline phosphatase) , serum uric acid , serum triglycerides , serum hdl cholesterol , micropipette(5 50ml) , micropipette(100u 1 ml) , list of models , activated sludge process , anthrax on face , berkefeld filter , biogas plant , broe hole latrine , chicken pox(vesicular stage) , deep well , dental caries , drainage system , goitre , horrocks apparatus , l.h entamoeba histolytica , h.l dipotharium latum , l.h taenai saginata , l.h ancyclostoma duodenal , l.h taenai solium , l.h malaria(plasmodium) , kala azar , measles , pellagra , pit latrine , prevention of typhoid fever , prevention and control of cholera , rapid sand filter , sanitary house , sanitary well , small pox (haemorrhage) , skin leprosy with nodulation , spread of typhoid fever , spread $prevention of cholera , spread of dysentery$ diarrhea , soil testing kit , sanitary slaughter house , septic tank , sewage disposal system , sewage treatment plant , slow sand filter , step well , trench latrine , water closet , mango toy , egg , amla , mites , rat flea , ticks , culex , black fly , anopheles , sand fly , house fiy , ades , tapeworm , schistosomia , cyticercus , liver fluke , echinococcus , amoeba proteus (entomology slides) , e. histolotica , malaria parasite in human blood(all stages) , malaria parasite oocystin mosquito , malarla parasite signet ring , liver fluke , tapeworm proglotid , tape worm proglotid mature , ancylostoma , pinworm , hard tick , soft tick , anopheles female , anopheles male , anopheles mouth part female , anopheles mouth part male , anopheles mouthpart male , anopheles mouth part female , anopheles wings , anopheles larva , anopheles pupa , culex female , culex male , culex mouth part male , culex mouth part female , culex wings , culex larva , culex egg , culex pupa , house fiy female , house fly male , house flymouth part male , house fly mouth part female , house fly wings , house fly egg , house fly pupa , body louse , pubic louse , head louse , rat flea male , rat flea fe male , pediculus eggs , bacteria lactobacillus , bacteria vibrio cholarae , bacteria shigella , bacteria staphylococcus , bacteria streptlococcus , mite , necator , plasmodium malariae , plasmodium falciparum , plasmodium vivex in blood , trichinella spiralis cyst in muscles , aedes female , aedes male , aedes mouth part male , aedes mouth part female , aedes wings , aedes larva , aedes egg , aedes pupa , (a) clinical pharmacy , special drug delivery systems like metered dose inhalers, spacers, rotahalers, nasal sprays, transdermal patches, insulin infusion pumps, insulin pen. , samples of dosage formulations of various types including rational and irrational fdc, essential medicines. , manikins for demonstration of intravenous injection, enema, local, intramuscular injections, intracardiac injection and other routes of drug administration. , (b) computer assisted learning laboratory , computers with standard configuration and connected to the internet, (preferably broadband) along with an av aids (multimedia projector and screen). the pc should be installed with cal programmes and other software for teaching experimental pharmacology. (the students must have access to the national essential drug lists, standard treatment guidelines, banned drugs list of the cdsco, pvpi, who, price controlled drugs list, antibiotic guidelines, hospital formulary, adverse drug reactions, and other resource material which the student can usefor learning the principles of rational prescribing.) , refrigrator , window curtains , door curtain , handwash , big dustbins , printers , computer cover , key holder/hanger , scissor , red pen , blue pen , face masks , window /split a.c (1.5 ton) , cup set , dinner set , photocopier , notice board , writing pads , induction stove , smart t .v , bed sheet 6.5ft x 4.5ft , pilo , stabilizer for(dead body deep freezer) , extension board , wall clock , articulated skeleto , pencil battery , remote battery , rubber gloves (big size till elbow , apron (for dissection) , plastic coloured shoes , chain, lock $ key set , disarticulated bones set , allotment register , ink for ink pad(blu$black) , stapler pin 10no , quick heal antivirus 3 user/1year , ricoh xerox machine mp2014ad , general register 10 no , general register 8 no , general register 6 no , general register 4 no , cello tape 2inch , issue register 10 no , dispatch register 10 no , printing items , examination copy printed12page(rulling)9x11per1000 , a4 size paper(one side)per100 , a4 size paper(both side)per100 , a3 size paper(one side)per100 , a3 size paper(both side)per100 , a8 size paper(one side)per100 , a8 size paper(both side)per100 , spirit 500ml , cotton 500gm , sodium hydroxide , acetic acid , alcohol 70% , alcohol 90% , alcohol 90% , alcohol 90% , hydrocloride acid 500ml , alcohol (absolute) , formaline , glycerine , hydrogen peroxide 500ml , pipet 200 micro ltr. , barcode roll (double sticker) , gloves no.65...

District Collector - Jharkhand

33035858 supply of equipments, ophthalmic ot table, operating microscope, a. scan biometey, keratometer, cataract surgical instrument, glaucoma surgical instrument, petrygium surgical instrument, chalazion surgical instrument, slit lamp (appasamy), autorefractometer (nidek), sterelization drum with all sterilization equipments, eye towel, opthalmic chair unit, ophthalmoscope, tonometer (schiotz), torch, instrument for syringing, o.t. trolley, revolving tool...

District Magistrate - Jharkhand

33032093 providing equipments ophthalmic ot table, operating microscope, a. scan biometey, keratometer, cataract surgical instrument, glaucoma surgical instrument, petrygium surgical instrument, chalazion surgical instrument, slit lamp (appasamy), autorefractometer (nidek), sterelization drum with all sterilization equipments, eye towel, opthalmic chair unit, ophthalmoscope, tonometer (schiotz), torch, instrument for syringing, o.t. trolley, revolving tool...

Department Of Health - Jharkhand

32971339 rate contract for machine upkaran , items : , tray instrument / dressing with cover , forceps, backhaus towel, ( 130 mm ( tungsten carbide tip anti rust quality ) , forceps, sponge holding, ( 228 mm ( tungsten carbide tip anti rust quality ) , artery forceps ( straight 140 rnrn ( titanium ) , artery forceps ( straight 180 mm ( titanium ) , artery forceps ( curved 140 rnrn ( titanium ) , artery forceps ( curved 180 mm ( titanium ) , forcep mosquito ( titanium ) , forceps, hemostatic, halsteads mosquito, straight, ( 125 mrn ss ( tungsten carbide tip anti rust quality ) , forcep lifting , forcep ppiucd , knife handle ( surgical for minor & major surgery # 3 ( ss anti rust quality ) , knife handle ( surgical for minor & major surgery # 4 ( ss anti rust quality ) , knife blade ( surgical, size 11 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 15 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 22 for major surgery ( ss anti rust quality ) , needles, suture triangular point, ( 7.3 cm ) , cheatles forceps , cuscos speculum ( medium ) , cuscos speculum ( large ) , sharp and blunt curette , ovum forceps , oral airway , needles, suture, round bodied, ( 3 / 8 circle no. 12 ) , plain forceps ( 8 ( tungsten carbide tip anti rust quality ) , tooth forceps ( 8 ( tungsten carbide tip anti rust quality ) , kidney tray ( 8 ) , kidney tray ( 10 ) , cord cutting scissor ( ss ( titanium ) , scissors, operating curved mayo blunt pointed ( 170 mm ( tungsten carbide tip anti rust quality ) , scissor operating straight ( 230 mm ( tungsten carbide tip anti rust quality ) , scissor, gauze, straight ( 230 rnrn, ss ( titanium ) , bowl, metal sponge ( 600 rnl, ref. is: 5782 ) , drum, sterilizing cylindrical ( 275 mm oia x 132 rnrn, ss as per is: ) , foetoscope , kellys pad ( for labour and ot table set ) , thermometers ( para ) , thermometers ( digital ) , b.p. instruments ( portable ) , measuring tape , glucometer , ambu bag ( baby ) ( silicon ) , sahlis haemoglobinometer , airway guedel or berman, autoclavable rubber , endotracheal catheter ( w / cuff, rubber ) , breathing tubes, hoses, connectors for item 1, ( anti static ) , tcdc count apparatus , counting chamber , esr stand with tubes , test tube stands , test tube rack , test tube holders , spirit lamp , forceps obstetric ( wrigleys, 280 mm, stainless steel ( titanium ) , speculum vaginal bi valve ( cusco medium, ( ss anti rust quality ) , speculum, vaginal, sims double ended # 3 ( ss anti rust quality ) , forceps obstetric, wrigleys ( 280 mrn, stainless steel ( tungsten carbide tip ) , forceps, vulselium, duplay double cured, 280 mm ss ( ( tungsten carbide tip ) , sound, uterine, simpson ( 300 mm with 200 mm graduations ( ss anti rust quality ) , dilator, uterine, double ended hegar ( set of 5 ( ss anti rust quality ) , curette, uterine, sims blunts ( titanium ) , anterior vaginal wall retractor stainless ( ( ss anti rust quality ) , clamp intestinal, doyen ( curved 225 mrn, ss ) , clamp intestinal, doyen ( straight 225 rnrn, ss ) , uterine elevator ( ranathlbod ) ( ss ) , bag, reathing, self inflating ( anti static rubber, set of 4 ) , b.p. instruments with stand , timer stop watch , 3 fold reclining bed manually , weighing machine baby electronic ( 5 kg capicity with fiber tray ) , fetal monitor ( ctg monitor ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ecg machine ( 12 chennel ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , semi auto analiser ( with installation ) ( specification should be attached in technical bid turms & condition ) , micro scope binoculor ( with installation ) ( specification should be attached in technical bid turms & condition ) , cardiac monitor with defribillator ( with 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , cardiac table , oxygen cylender stand with trolly , auto clave ( elec. ) dubble drum 6x12 , b.p. instrument digital , electronic strailiser 6x8 , electronic straliser 8x10 , electronic straliser 10x12 , auto clave ( elec. ) dubble drum 4x10 , dressing drum small 9x9 , dressing drum big 12x15 , dressing drum big 9x11 , dressing drum big 12x17 , delivery table ( 72x24x3 ) power coated , ambu bag silicon adult , electric strailiser foot oprated big , fetal doppler machine digital , fetal doppler machine table model , thump forcep with tooth ( titanium ) , thump forcep without tooth ( titanium ) , straight cocker ( titanium ) , curve cocker ( titanium ) , green armittage ( titanium ) , alis forcep 6 ( titanium ) , alis forcep 8 ( titanium ) , outlet forcep ( titanium ) , kocchers forcep ( titanium ) , tissue forcep 6 ( titanium ) , tissue forcep 8 ( titanium ) , stethoscope ( best quality ) , paediatric stethoscope ( best quality ) , baby tray ( ss , ce inbuild ) , x ray film processing tank 9 lit. , x ray film processing tank 13.5 lit. , oxygen flow meter ( best quality ) , mox with yolk assombily , examination table with matress ( 72x24x3 ) ( iron ) , pulse oxymeter ( multi para ) ( with installation & 1 yrs. warrenty ) ( 8.5 tft display with ecg ) , centrifuge machine for blood storeg unit ( with installation & 1 yrs. warrenty ) , vein detector led , besin boul ( with stand ) , foot step ( 2 step ) , bed side screen with cloth ( 1 round pipe with wheel ) , salin stand with wheel with four hook ( ss ) , nsv kit set ( ss ) ( specification acched ) , streture trolly ( 85x22x32 power coated with matress ) , cotton folding strecher for ambulance ( best quality ) , weighing machine adult ( best quality ) , bed side locker ( best quality ) , hospital bed ( best quality ) ( general ) , semi fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , circle absorber with soda lime ( for boyles apparatus ) , portable oxygen cylinder ( best quality ) , baby weighing machine digital , high vaccum suction machine , iucd kit ( specification acched ) , minilap kit ( specification acched ) , water bath ( pathology department ) ( • should have double walled chamber made of stainless steel and outer wall made of thick mild steel sheet duly powder coated. • should have concentric rings are also made of stainless steel. • should have temperature co , hot air sterilizer ( oven ) digital construction: ovens are sturdy, with double walled construction. inner chamber is made of highly polished stainless steel. outer chamber is made of mild steel sheet duly pre treated in seven tanks process for surface , pulse oxymeter baby ( finger tip ) type: blood pressure monitor power supply: battery size: 57 ( l ) * 33 ( w ) * 32 ( h ) mm , pulse oxymeter adult ( table top ) built in rechargeable li polymer battery for uninterrupted monitoring compact and flexible appearance, easy for carrying and be suitable for indoor and outdoor ( in ambulance ) monitoring with user friendly interface displ , nebuliser should be lightweight, portable and compact. should have a dust filter. should be able to deliver a flow rate = 7 lpm should h ave air pressure = 35 psi. should have a check valve to protect the device against contamination due to backward , fumigation machine input power : 220 vac, 3.5 amp, 50hz consistant particle size generation : 5 15 microns vmd reach : 20 30 ft distance & 18 20 ft height. space treatment : up to 7000 cuft & even larger. nozzle assembly : non rotating vortex design , non , otoscope 1. should be a convenient pocket type otoscope. 2. should be provided with a halogen light source. 3. should be able to detach the otoscope head. 4. should provide no reflections and obstructions. 5. should provide detachable accessories of var , straight needle , o.t. table hydrolic ss ( best quality ) , focus light led ( spot light ) , laboratory autoclaves , pulse oxymeter , pulse spo2 , infusion pump , vacuum extractor metal ( best quality ) , head box for oxygen ( best quality ) , tuning fork ( best quality ) , examination instruments set ( speculums, tongue dipressors, mirrors, bulls lamp ) ( best quality ) , cervical biopsy set ( best quality ) , endometrial biopsy set ( best quality ) , vaginal hysterectomy set ( best quality ) , g.i. operation set ( best quality ) , uretheral dilator set ( best quality ) , stomach wash equipment ( best quality ) , emergency resuscitation kit adult ( best quality ) , air way 0, 1, 2, 3, 4 adult , air way peadiartric , tongue depressors , oxygen cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small a type ) , nitrex cylinder for boyles ( small d type jumbo ) , wheel chair ( ss ) folding , nibulisyer adult with mask , nibulisyer child with mask , nibulisyer mask for adult , nibulisyer mask for child , anaesthesia work station ( include anaesthesia machine with vaporiser, ventilator, monitor ) , boyles machine, brain circuit, jr , magills forceps , blood transfusion set ( best quality ) , back rest , medicine trolley ( ss ) , basin assorted ( ss ) , basin stand assorted ( ss ) ( 2 basin type ) , bed pan ( ss ) , urinal female , urinal male , waste disposal bin / drums , waste disposal trolley ( ss ) , diet trolley stainless steel , doctors overcoat , hospital worker overcoat , patients housecoat for female , patients paiiarna ( for male ) shirt , mouth mirror , waste disposal colour coded buckets swine bing 60 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets swine bing 30 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , tharmometer , nasogastric tube ( 8, 10, 12 fg ) , flow meter with humidifier bottle , bed side locker ( fully ss ) ( best quality ) , instrument trolly ( best quality ) , central patient monitoring station , bronchoscope , adjustable walker , bipap machine , cpap cum hfnc for newnate , paediatric vein circuit , ecg monitor cable , plastic tray bigh heavy , plastic box big heavy with led , x rey hanger 12x15 , x rey hanger 12x12 , x rey hanger 12x10 , x rey hanger 8x10 , x rey grid ( lead ) 12x15 , x rey grid ( lead ) 10x12 , mva aspirator , glass pippette , forceps, uterine nelaton solid tip one eye ( ( tungsten carbide tip ) , suction tube ( 225 rnrn, ss ) , valve inhaler ( chrome plated brass, y shape ) , intravenous ( set in box ) , needle spinal stainless ( set of 4 ) , syringe, anesthetic ( control 5 ml luer mount glass ) , head light ( ordinary ) ( boyle davis ) , beds semi recilining , feeding equipments ( tubes, katoris & spoon ) , channel semi automatic coaglomater with regent , x ray machine 100 ma with dark room assoseries ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , standalone color doppler machine ( specification should be attached in technical bid turms & condition ) , portable ultra sound with pw ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , portable cooling unit ( vaccine / blood bags ) ( specification should be attached in technical bid turms & condition ) , o.t light ( dichroic reflector ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , hospital bed ( ss head & foot side rod ) ( specification should be attached in technical bid turms & condition ) , led light ( single ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) , ultra high speed laboratary centrifuge ( specifications attached ) , digital incubator ( specifications attached ) , boyles machine ( specifications attached ) , 72 led dome ( double dome ) , lux 1, 30, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , 48 led dome ( single dome ) , lux 1, 00, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , coutery machine ( 400 w ) , coutery machine ( 250 w ) , portable o.t. light ( abs doom 19 single reflecter polycarbonate ) , portable o.t. light led , vaccu suck suction tube ( titanium ) ( for suction machine ) , alis forcep 10 ( titanium ) , tissue forcep 10 ( titanium ) , convex array tranducer c343ua ( for ultra sound machine ) , phototherephy unit single surface ( stand model ) , phototherephy unit single surface led ( with led buld ) , silent genrator 10 kva ( with installation ) ( 10 kva, 3 phase, water cooled ) , silent genrator 15 kva ( with installation ) ( 15 kva, 3 phase, water cooled ) , silent genrator 20 kva ( with installation ) ( 20 kva, 3 phase, water cooled ) , silent genrator 50 kva ( with installation ) ( 50 kva, 3 phase, water cooled ) , silent genrator 82 kva ( with installation ) ( 82 kva, 3 phase, water cooled ) , magil circuit with mask ( for boyles apparatus ) , patho fast test kit ( for patho fast machine ) , blood gas analyser test kit ( for blood gas analyser ) , dossimeter , peak expiritory flow meter ( best quality ) , laryngoscope fibreoptic ent ( best quality ) , p.v. tray ( best quality ) , varicose vein set ( best quality ) , connector set of six for en ( best quality ) , tubes connecting for en ( best quality ) , leqqinqs , explorar , endo explorar , amalgam carrier in sliver , murcury ball burnisher , carver ( dimond ) , compactor , element carrier , gic ( glass ionomer cement ) , zinc phosphate cement , temporary filling material , room thermometer , electric ventouse , radient baby warmer , right angel artry 4 , right angel artry 6 , automated autoref stand ( for ophthalmic ) , 2 mirror cronioscope ( for ophthalmic ) , disposable needle 26 g ( for ophthalmic ) , ppiucd forcep , uterus collection ( sister u and mama u ) , water cooler with purifire ( 120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap , hemoglobinometer ( 1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g / dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd / us fda / isoapproved 6. automatic correction of hb. 7. 20 , digital x rey film ( konika ) 8x10 , digital x rey film ( konika ) 10x12 , digital x rey film ( konika ) 12x12 , digital x rey film ( konika ) 12x15 , x ray digitalisationwith high end cr system ( with installation & 1 yrs. warrenty ) console software with multi modality work station the cr system should have advanced workstation provided with 17” high resolution monitor, keyboard & mouse, with the fol , x ray 500 ma ( with 1 yrs. warrenty ) x ray genera tor: high frequency x ray generator of frequency 40khz should be provided. power output of generator should be of sokw. kv range should be: • radiographic kv: 40 to 12sky. • fluoroscopic kv: 40 to 120k , suction machine foot operated ( powder coated m.s. chassis. noise level of suction apparatus from is 50 db + / 03 db. leakage current of suction units is less than 84 ua. electrical requirement – 220 ~ 230v, 50hz, 1 phase. ideal for mtp / medical / surgic , suction apparatus ( electric ) suction machine with pump: power supply: 230 240v / 50hz vacuum capacity: 18 litres / mim maximum depression: 75kpa ( 563mmhg ) vacuum is created by a plastic piston and cylinder system, with four vacuum creating modules ( , phototherapy unit 1 led phototherapy with intensity upto 6 50microwatts / nm / cumm / mwatt, adjustable intensity. 2 .height adjustable and tiltable light unit. 3 digital time totaller of led usage time. 4 stainless steel tray. 5 –provision for double surf , opthalmoscope 1. should be rechargeable battery with charger / mains operated. 2. should have halogen / led light source 3. should have red free filters 4. should have small and large spot sizes, fixation targets, slit aperture, hemi spot and cobalt blu , wireless indirect ophthalmoscope ( led ) ( compact and light weight, stereo optical system has all pupil features rechargeable battery integrated on headbrilliant white light with uniform and well spread led illumination ( focus distance : 300 800 mm, inter p , dental chair 1. should be electrically operated with zero program. 2. should have a switch operated operating light with minimum two steps of intensity control. 3. should have auto water connection for spittoon and tumbler with auto filling sensor. 4. s , av retractor 1.stainless steel 2.double ended, serrated 3.rust free 4.sturdy construction 5.accurate dimensions , vulcellum stainless steel size: 10 inch colour: silver shape: curved , ppiucd forcep ss , baby forceps ss ( big – straight ) , baby forceps ss ( big – curve ) , baby forceps ss ( big – straight ) , baby forceps ss ( small – curve ) , baby forceps ss ( small – straight ) , folis catheter 24 no , lab incubator 1. should have 4 inch attractive lcd display 2.should have intelligent controller to help maintain temperature incase of sensor failure 3. should have battery backup for temperature controller 4. should have auto tuning of controller , electricentrifuge, table top ( table top electric centrifuge ) 1. should have stepless speed regulator 2. should have safety lid interlock to prevent cover opening during centrifugation. 3. dynamic brake for quick deceleration 4. wide choice of swing out , cbc machine ( 5 part blood cell counter machine ) 1. should have throughput – 50 samples / hour 2.the sample volume should be < 17 ?l 3.should have technology – impedance ( wbc, rbc, plt ) , spectrophotometry ( hcg ) , should have optical laser methodfor 5 , incubator for culture sensitivity , esr stand with tubes , elisa reader cum washer , glycosylated haemoglobinometer , blood collection monitor , intensifying screen x ray , dossimeter , peak expiritory flow meter ( best quality ) , baby incubators ( best quality ) , craniotomy ( best quality ) , static vaccum extractor ( best quality ) , head light ( ordinary ) ( boyle davis ) ( best quality ) , ent operation set including headlight, tonsils , ent nasal set ( smr, septoplasty, nasal endoscopic set ( 00 & 300 ) polypetcomy, dns, rhinoplasty ) ( best quality ) , laryngoscope led ( best quality ) adult , laryngoscope led ( best quality ) pediatric , tracheostomy set ( best quality ) , proctoscopy set adult ( best quality ) , proctoscopy set peadiartric ( best quality ) , p.v. tray ( best quality ) , abdominal hysterectomy set ( best quality ) , laparotomy set ( best quality ) , varicose vein set ( best quality ) , thomas splint ( best quality ) , laproscopy set for cholecystectomy , amputation set ( best quality ) , colposcope ( best quality ) , mouth prop , regional anaesthesia devices, epidural set , vascular clamp set ( best quality ) , steel cup board , case sheet holders with clip ( ss ) , draw sheet , pereneal sheets for ot , explorar , spoon excavator , twizer , endo explorar , amalgam carrier in silver , murcury ball burnisher , carver ( dimond ) , diathermy machine , doyess ( medium ) , gernes retractor , metal catheter , mayo scissor curved , lma ( adult ) , steel galipot small , dressing drum size 9x11 , sims vaginal speculam , epsiotomy scissor , ovum forcep , tailor scissor , doctor & nurse dress with designation ( paijama & kurta ) , doynes retroctor 1.5” ( german steel ) each , doynes retroctor 2” ( german steel ) each , doynes retroctor 2.5” ( german steel ) each , doynes retroctor 3” ( german steel ) each , doynes retroctor 3.5” ( german steel ) each , czernys retractor ( german steel ) each , formalin chamber ( 20x8x8x5 mm ) , formalin chamber ( 26x8x8x5 mm ) , lifter with jar , strraight scissor 5” ( german steel ) each , strraight scissor 6” ( german steel ) each , strraight scissor 7” ( german steel ) each , strraight scissor 8” ( german steel ) each , s.s. bowl30 cm ( super fine quality ) each , s.s. bowl36 cm ( super fine quality ) each , babcock clamp 6” ( german steel ) each , babcock clamp 8” ( german steel ) each , ambu bag adult ( silicorised ) ( super fine quality ) , ambu bag child ( silicorised ) ( super fine quality ) , ambu bag 250 ml , artery forceps 6” curved ( german steel ) , artery forceps 6” straight ( german steel ) , mayo scissor long curved 6.5” each ( german steel ) , mayo scissor long curved 7.5” each ( german steel ) , tooth forceps 6” each ( german steel ) , non tooth forceps 6” each ( german steel ) , tenaculum long each ( german steel ) , myome screw each ( german steel ) , morrisen retractor each ( german steel ) , sim speculum medium each ( german steel ) , sim speculum long each ( german steel ) , waste disposal colour coded buckets swine bing 80 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets ( black, red, yellow, blue ) ( neelkamal, cello, suprem ) , dust bin ( ss ) small ( best quality ) , dust bin ( ss ) big ( best quality ) , sauce pan with lid , chest stand for x rey unit , oropharyngeal airway ( 000 4 guydel size ) , oxygen cylinder 10 ltr. mo2 with valve , bipap machine , elvo gloves – per pair , lyarigoscope set adult with led – each , lyarigoscope set child with led – each , hemoglobino meter digital – each , massiring mug – each , hair tremer branded – each , hot air oven , urino meter , adk drain , concigated drain ( plastic ) , diatharmy plate for vally lab , laryngoscope adult set , laryngoscope ped. set , coutry pencil , crash card with steel drower , digital spirometer , carbonmonoxide monitor , pulse oximeterfor ccu ( specifications attached ) , pulse oximter with nib for ccu ( specifications attached ) , carm for ccu ( specifications attached ) , laryngoscope for ccu ( specifications attached ) , nibulisor adult with mask , nibulisor child with mask , nibulisor mask for adult , nibulisor mask for child , infant weighing scale , lc dcp and dcp basic instrument set ( specifications attached ) , small fragment lc dcp & dcp® instrument set, st. steel ( specifications attached ) , select lcp upgrade instrument set large & small fragment ( specifications attached ) , dhs / dcs instrument set ( specifications attached ) , css 4.5mm instrument set in vario case ( specifications attached ) , css 6.5mm instrument set in vario case , synream ( specifications attached ) , distractor set large ( specifications attached ) , distractor set medium ( specifications attached ) , bone forceps range ( specifications attached ) , general instrument set ( specifications attached ) , instruments for damaged screw removal ( specifications attached ) , chisel and impactor set ( specifications attached ) , tomofix instrumentset in syncase ( specifications attached ) , instrument set for minimally invasive plate insertion osteosynthesis ( mipo ) in vario case ( specifications attached ) , collinear reduction clamp in vario case ( specifications attached ) , reduction handles, toothed and rounded, small & large in modular tray ( specifications attached ) , mipo cerclage passer ( specifications attached ) , hohmann retractor ( specifications attached ) , soft tissue spreader set ( specifications attached ) , periarticular reduction forceps ( specifications attached ) , pelvic basic instruments ( specifications attached ) , pelvic reduction & retraction ( specifications attached ) , pelvic c clamp ( specifications attached ) , wire instrumnents set ( specifications attached ) , shoulder instruments ( specifications attached ) , gili pot ss , weight machine hanging ( for bmw ) , sterlizer indicator , bio west trolly single bin ( ss ) , bio west trolly doubble bin ( ss ) , bio west trolly triple bin ( ss ) , variable pipette ( ce certified ) , variable pipette ( ce certified ) , spirometer , carbon monoxide breath monitor , portable 3 channel ecg recorder , 300ma fixed x ray unit with multi position table , 100 ma, 100 pps line frequency mobile x ray , biphasic defebrillator with aed , ctg nst machine , digital radiography system high frequency ( digital x ray ) , high end premium ultrasound system , syringe pump...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

32694680 supply installation of eye equipment , name of equipment ( equipment for vision centre ) , tonometer , direct ophthalmoscope , illuminated vision testing drum , trial lens set with trial frames ( adult & child ) , snellens & near vision chart , battery operated torch 3 cells , slit lamp with motorized table , name of equipment ( equipment for district hospital ) , operating microscope ( basic ) , a scan bio meter ( digital ) , keratometer , slit lamp. refraction units , auto refractometer , streak retinoscope , tonometer ( schiotz ) , direct ophthalmoscope , nd yag laser , applanation tonometer , phacoemulsifier , indirect ophthalmoscope with 20 lens...

Patliputra Medical College - Jharkhand

31419369 purchase machine instrument eye snmmc dhanbad purchase machine instrument eye snmmc dhanbad , laying and jointing pvc pipe. heading , streak retininoscope , specular microscope with pachymeter cadevar cornea ( for eye bank ) type non contact objective lens, field of view: 450umx500um. ccd camera: monochrome. illumination: halogen lamp, 6v, 20w. power: 110 / 220c 50 / 60hz. dimension 7.25x9x17.75. certification: european ce / fda ( us ) . it should be protected bu online ups of reuired power. , green laser laser type: frequency doubled nd. yag , solid state, diode pumped, continuous wave. the double frequency laser can be upgraded to operate in multi spot mode without compromising the outcomes of the gold standard.a linear sequence of upto 12 laser pulses can be triggered at the touch of a button on the slit lamp joystick. focussing: laser should have parafocus zoom system to deliver a homogenous, sharply defined and reproducible laser spot on the retina and minimises heat related side effects on the patients cornea. wave length: 532 nm, max. power : 1.5 w at the cronea. aiming beam: diode 635nm max. 1mw, auto pulse: 100 6000 ms pulse interval, pulse duration : 10 2500 ms, cw, electric connection: 115 230v, 50 / 60 hz, max 400 watt, cooling: thermoelectric, slit lamp: slit lamp onlty, micromanipulator , servo electric micromanipulator, laser beam delivery: co axial via slit illumination, laser spot diameter: continuous adjustable from 50 1000nm, parafocal, magnification: 5 / 8 / 12 / 20 / 32x. phuysicians safety filter: true to colour, swings automatically into position. illumination: 12v, 30w, brightness continuously adjustable. slit adjustment: slit height 1 / 3 / 5 / 9 / 14 mm in steps. slit width: 0 14mm continuous. accessories: endo probes & laser indirect ophthalmoscope. after sales service should be available directly from the manufacturer witnavailability of spares parts in the region. certification: european ce / fda ( us ) . it should be protected by on line ups of required power. , gonio lens two mirror , gonio lens three mirror , applanation tonometer as per slit lamp , binocular loup ( head ) , amc % , cmc %...

East Central Railway - Jharkhand

30751413 auction sale of disposal of dead stock item such as [ a ] ( 1 ) patient trolley stretcher qty=7no.=70kg ( 2 ) patient examination table qty=1no.=20kg ( 3 ) spray machine ( rd from chi ) qty=2no.=10kg ( 4 ) iron chest qty=1no.=150kg ( 5 ) platform weighing machine qty=1no.=1000kg ( 6 ) arobic physiotherapy cycle qty=1no.=5kg ( 7 ) wheel chair qty=3no.=18kg ( 8 ) oxygen stand qty=4no.=12kg ( 9 ) oxygen regulator qty=16no.=8kg ( 10 ) view box qty=3no.=1.5kg ( 11 ) iv stand qty=3no.=6kg ( 12 ) gi bucket qty=7no.=7kg ( 13 ) big enamel tray qty=1no.=3kg ( 14 ) s s autoclave dressing drum medium qty=3no.=1.5kg ( 15 ) enamel bed pan qty=1no.=400gm ( 16 ) enamel urinal ( male ) qty=70no.=14kg ( 17 ) plastic gamia qty=50no.=10kg ( 18 ) food trolly ( big ) qty=1no.=8kg ( 19 ) plastic bucket qty=6no.=1.5kg ( 20 ) brasso gamla ( big ) qty=4no.=40kg ( 21 ) brasso gamla ( medium ) qty=1no.=4kg ( 22 ) brasso full handi qty=1no.=2kg ( 23 ) big tawa ( iron ) qty=1no.=8kg ( 24 ) feeding cup qty=90no.=9kg ( 25 ) sputum mug qty=95no.=9.5kg ( 26 ) enamel funnel qty=18no.=1.8kg ( 27 ) measure metric set qty=1no.=20kg ( 28 ) measure metric machine qty=1no.=3kg ( 29 ) iron rod qty=5no.=10kg ( 30 ) iron karahi ( big 1, small 2 ) qty=3no.=6.5kg ( 31 ) finit pump qty=1no.=2gm ( 32 ) tv set qty=7no.=14kg ( 33 ) pad lock qty=5no.=1kg ( 34 ) photo phone over head qty=1no.=3kg ( 35 ) aqua guard qty=1no.=5kg ( plastic ) ( 36 ) thermos qty=5no.=500gm ( 37 ) weighing machine qty=3no.=3kg ( 38 ) breast pump qty=5no.=50gm ( 39 ) saw plaster qty=1no.=100gm ( 40 ) room heater qty=2no.=1kg ( 41 ) carpenter saw qty=1no.=200gm ( 42 ) artificial eye qty=3no.=6gm ( 43 ) projector perimeter qty=1no.=5kg ( 44 ) stabilizer ( voltage ) qty=3no.=3kg ( 45 ) cross cylinder qty=1no.=50gm ( 46 ) needle cornier ( ss ) qty=10no. =10gm ( 47 ) iron box qty=2no.=1kg ( 48 ) first aid box qty=1no.=1kg ( 49 ) hand surch light ( dragon light ) qty=3no.=3kg [ b ] ( 1 ) iron general bed qty=18no.=360kg ( 2 ) s s chair with can seated qty=13no.=39kg ( 3 ) three seated iron chair with plastic top qty=4no.= 16kg ( fe=12kg, plastic=4kg ) ( 4 ) four seated iron chair with plastic top qty=3no.=16.5kg ( fe=12kg, plastic=4.5kg ) ( 5 ) iron table with sunmaica top qty=2no.=20kg ( 6 ) wooden chair with arm qty=10no.=50kg ( 7 ) wooden bench with arm & back qty=3no.=24kg ( 8 ) wooden stool qty=5no.=15kg ( 9 ) wooden chair with arm high leg qty=3no.=12kg ( 10 ) s s chiar foam seated qty=2no.=6kg ( 11 ) wooden cup board qty=1no.=5kg ( 12 ) wooden rack qty=1no.=2kg ( 13 ) wooden backrest qty=1no.=1kg ( 14 ) s s three seated chair back with arm qty=1no.=5kg ( 15 ) iron dressing table qty=1no.=4kg ( 16 ) iron locker qty=2no.=6kg ( 17 ) wooden sunmaica top table qty=2no.=20kg ( 18 ) iron table long type qty=1no.=20kg, [ c ] medical equipment such as ( 1 ) blood pressure qty=13nos.=6.5kg ( 2 ) b.p. instrument digital dr.morphen qty=5no.=500gm ( 5 ) hand ambylscope qty=1no.=200kg ( 6 ) trail set qty=2no. ( 7 ) diagnostic set qty=1no. ( 8 ) pelvic meter qty=2no.=400gm ( 9 ) streak ratinoscope qty=1no. ( 10 ) glucometer accuchek active qty=8no.=800gm ( 11 ) stethoscope qty=3no. ( 12 ) ophthalmoscope qty=1no. ( 13 ) ( a ) plain artery forceps qty=1no.=100gm ( b ) needle holder qty=2no.=100gm ( c ) tooth forceps qty=1no.=100gm ( d ) scissors qty=1no.=100gm ( 14 ) suction machine qty=2no.=6kg ( 15 ) nebulizer qty=3no.=1.5kg [ d ] medical equipment such as ( 1 ) refrigerator make zenith qty=4no.=84kg ( fe=80kg, cu=4kg ) ( 2 ) lioyd admiral 165ltrs qty=1no.=21kg ( f=20kg, c=1kg ) ( 3 ) kelvinator 155ltrs qty=1no.=21kg ( f=20kg, c=1kg ) , location divisional railway hospital, ecr, dhanbad. [ i ] loading by the labour of purchaser, [ ii ] delivery on the basis of numbers....

Health Department - Jharkhand

30557794 rate contract for machine upkaran and other labs chemicals rate contract for machine upkaran and other labs chemicals , items : , tray instrument / dressing with cover , forceps, backhaus towel, ( 130 mm ( tungsten carbide tip anti rust quality ) , forceps, sponge holding, ( 228 mm ( tungsten carbide tip anti rust quality ) , artery forceps ( straight 140 rnrn ( titanium ) , artery forceps ( straight 180 mm ( titanium ) , artery forceps ( curved 140 rnrn ( titanium ) , artery forceps ( curved 180 mm ( titanium ) , forceps, hemostatic, halsteads mosquito, straight, ( 125 mrn ss ( tungsten carbide tip anti rust quality ) , knife handle ( surgical for minor & major surgery # 3 ( ss anti rust quality ) , knife handle ( surgical for minor & major surgery # 4 ( ss anti rust quality ) , knife blade ( surgical, size 11 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 15 for minor surgery ( ss anti rust quality ) , knife blade ( surgical, size 22 for major surgery ( ss anti rust quality ) , needles, suture triangular point, ( 7.3 cm ) , cheatles forceps , cuscos speculum ( medium ) , cuscos speculum ( large ) , sharp and blunt curette , ovum forceps , oral airway , needles, suture, round bodied, ( 3 / 8 circle no. 12 ) , plain forceps ( 8 ( tungsten carbide tip anti rust quality ) , tooth forceps ( 8 ( tungsten carbide tip anti rust quality ) , kidney tray ( 8 ) , kidney tray ( 10 ) , cord cutting scissor ( ss ( titanium ) , scissors, operating curved mayo blunt pointed ( 170 mm ( tungsten carbide tip anti rust quality ) , scissor operating straight ( 230 mm ( tungsten carbide tip anti rust quality ) , scissor, gauze, straight ( 230 rnrn, ss ( titanium ) , bowl, metal sponge ( 600 rnl, ref. is: 5782 ) , drum, sterilizing cylindrical ( 275 mm oia x 132 rnrn, ss as per is: ) , foetoscope , kellys pad ( for labour and ot table set ) , thermometers ( para ) , thermometers ( digital ) , b.p. instruments ( portable ) , measuring tape , glucometer , ambu bag ( baby ) ( silicon ) , sahlis haemoglobinometer ( digital ) , airway guedel or berman, autoclavable rubber , endotracheal catheter ( w / cuff, rubber ) , breathing tubes, hoses, connectors for item 1, ( anti static ) , tcdc count apparatus , counting chamber , esr stand with tubes , test tube stands , test tube rack , test tube holders , spirit lamp , forceps obstetric ( wrigleys, 280 mm, stainless steel ( titanium ) , speculum vaginal bi valve ( cusco medium, ( ss anti rust quality ) , speculum, vaginal, sims double ended # 3 ( ss anti rust quality ) , forceps obstetric, wrigleys ( 280 mrn, stainless steel ( tungsten carbide tip ) , forceps, vulselium, duplay double cured, 280 mm ss ( ( tungsten carbide tip ) , sound, uterine, simpson ( 300 mm with 200 mm graduations ( ss anti rust quality ) , dilator, uterine, double ended hegar ( set of 5 ( ss anti rust quality ) , curette, uterine, sims blunts ( titanium ) , anterior vaginal wall retractor stainless ( ( ss anti rust quality ) , clamp intestinal, doyen ( curved 225 mrn, ss ) , clamp intestinal, doyen ( straight 225 rnrn, ss ) , uterine elevator ( ranathlbod ) ( ss ) , bag, reathing, self inflating ( anti static rubber, set of 4 ) , b.p. instruments with stand , timer stop watch , 3 fold reclining bed manually , weighing machine baby electronic ( 5 kg capicity with fiber tray ) , fetal monitor ( ctg monitor ) ( with installation & 1 yrs. warrenty ) ( specifications attached ) , ecg machine ( 12 chennel ) ( with installation & 1 yrs. warrenty ) ( specifications attached ) , semi auto analiser ( with installation ) ( specifications attached ) , micro scope binoculor ( with installation ) ( specifications attached ) , cardiac monitor with defribillator ( with 1 yrs. warrenty ) ( specifications attached ) , cardiac table , oxygen cylender stand with trolly , auto clave ( elec. ) dubble drum 6x12 , b.p. instrument digital , electronic strailiser 6x8 , electronic straliser 8x10 , electronic straliser 10x12 , auto clave ( elec. ) dubble drum 4x10 , dressing drum small 9x9 , dressing drum big 12x15 , delivery table ( 72x24x3 ) power coated , ambu bag silicon adult , electric strailiser foot oprated big , fetal doppler machine digital , fetal doppler machine table model , thump forcep with tooth ( titanium ) , thump forcep without tooth ( titanium ) , straight cocker ( titanium ) , curve cocker ( titanium ) , green armittage ( titanium ) , alis forcep 6 ( titanium ) , alis forcep 8 ( titanium ) , outlet forcep ( titanium ) , kocchers forcep ( titanium ) , tissue forcep 6 ( titanium ) , tissue forcep 8 ( titanium ) , stethoscope ( best quality ) , paediatric stethoscope ( best quality ) , baby tray ( ss , ce inbuild ) , x ray film processing tank 9 lit. , x ray film processing tank 13.5 lit. , oxygen flow meter ( best quality ) , examination table with matress ( 72x24x3 ) ( iron ) , pulse oxymeter ( multi para ) ( with installation & 1 yrs. warrenty ) ( 8.5 tft display with ecg ) , centrifuge machine for blood storeg unit ( with installation & 1 yrs. warrenty ) , besin boul ( with stand ) , foot step ( 2 step ) , bed side screen with cloth ( 1 round pipe with wheel ) , salin stand with wheel with four hook ( ss ) , nsv kit set ( ss ) , streture trolly ( 85x22x32 power coated with matress ) , cotton folding strecher for ambulance ( best quality ) , weighing machine adult digital ( best quality ) , bed side locker ( best quality ) , hospital bed ( best quality ) ( general ) , semi fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , fowler bed ( best quality ) with abs system ( 72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated ) , circle absorber with soda lime ( for boyles apparatus ) , portable oxygen cylinder ( best quality ) , suction machine for ot , trial box , trial frame, lens, metal rim ( 205x6 cye ) ( complete set ( for ophthalmic ) , baby weighing machine digital , high vaccum suction machine , trial frame adult ( for ophthalmic ) , trial frame children ( for ophthalmic ) , selfilluminated retinoscope ( for ophthalmic ) , ophthalmoscope ( for ophthalmic ) , conjunctival scisser ( for ophthalmic ) , corneal scisser ( for ophthalmic ) , dilar ( for ophthalmic ) , simko 21 no guage ( for ophthalmic ) , f.b. spnd ( for ophthalmic ) , 90 d lens ( for ophthalmic ) , fluorrescein strip ( for ophthalmic ) , iucd kit , minilap kit , water bath ( pathology department ) ( • should have double walled chamber made of stainless steel and outer wall made of thick mild steel sheet duly powder coated. • should have concentric rings are also made of stainless steel. • should have temperature co , hot air sterilizer ( oven ) digital construction: ovens are sturdy, with double walled construction. inner chamber is made of highly polished stainless steel. outer chamber is made of mild steel sheet duly pre treated in seven tanks process for surface , pulse oxymeter baby ( finger tip ) type: blood pressure monitor power supply: battery size: 57 ( l ) * 33 ( w ) * 32 ( h ) mm , pulse oxymeter adult ( table top ) built in rechargeable li polymer battery for uninterrupted monitoring compact and flexible appearance, easy for carrying and be suitable for indoor and outdoor ( in ambulance ) monitoring with user friendly interface displ , nebuliser should be lightweight, portable and compact. should have a dust filter. should be able to deliver a flow rate = 7 lpm should h ave air pressure = 35 psi. should have a check valve to protect the device against contamination due to backward , fumigation machine input power : 220 vac, 3.5 amp, 50hz consistant particle size generation : 5 15 microns vmd reach : 20 30 ft distance & 18 20 ft height. space treatment : up to 7000 cuft & even larger. nozzle assembly : non rotating vortex design , non , otoscope 1. should be a convenient pocket type otoscope. 2. should be provided with a halogen light source. 3. should be able to detach the otoscope head. 4. should provide no reflections and obstructions. 5. should provide detachable accessories of var , straight needle , o.t. table hydrolic ss ( best quality ) , focus light led ( spot light ) , slippers per pair ( rubber ) , laboratory autoclaves , pulse oxymeter , pulse spo2 , infusion pump , vacuum extractor metal ( best quality ) , head box for oxygen ( best quality ) , tuning fork ( best quality ) , examination instruments set ( speculums, tongue dipressors, mirrors, bulls lamp ) ( best quality ) , cervical biopsy set ( best quality ) , endometrial biopsy set ( best quality ) , vaginal hysterectomy set ( best quality ) , g.i. operation set ( best quality ) , uretheral dilator set ( best quality ) , stomach wash equipment ( best quality ) , emergency resuscitation kit adult ( best quality ) , air way 0, 1, 2, 3, 4 adult , air way peadiartric , tongue depressors , 02 cylinder for boyles , n20 cylinder for boyles , wheel chair ( ss ) folding , nebuliser adult with mask , nebuliser child with mask , nebuliser mask for adult , nebuliser mask for child , anaesthesia work station ( include anaesthesia machine with vaporiser, ventilator, monitor ) , boyles machine, brain circuit, jr , magills forceps , blood transfusion set ( best quality ) , back rest , medicine trolley ( ss ) , basin assorted ( ss ) , basin stand assorted ( ss ) ( 2 basin type ) , bed pan ( ss ) , urinal female , urinal male , waste disposal bin / drums , waste disposal trolley ( ss ) , diet trolley stainless steel , doctors overcoat , hospital worker overcoat , patients housecoat for female , patients paiiarna ( for male ) shirt , mouth mirror , waste disposal colour coded polybags ( black, red, yellow, blue ) , waste disposal colour coded buckets swine bing 60 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets swine bing 30 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , rubber / plastic sheet ( 4 sets of 2.5 m x 2 = 20 meter for each facility ) , tharmometer , nasogastric tube ( 8, 10, 12 fg ) , flow meter with humidifier bottle , bed side locker ( fully ss ) ( best quality ) , instrument trolly ( best quality ) , central patient monitoring station , bronchoscope , adjustable walker , dynaplast , bipap machine , plastic tray bigh heavy , plastic box big heavy with led , gas roti bhatta big 4 fit , potato pealer machine 20 ltr. , x rey hanger 12x15 , x rey hanger 12x12 , x rey hanger 12x10 , x rey hanger 8x10 , x rey grid ( lead ) 12x15 , x rey grid ( lead ) 10x12 , mva aspirator , glass pippette , forceps, uterine nelaton solid tip one eye ( ( tungsten carbide tip ) , suction tube ( 225 rnrn, ss ) , valve inhaler ( chrome plated brass, y shape ) , intravenous ( set in box ) , needle spinal stainless ( set of 4 ) , syringe, anesthetic ( control 5 ml luer mount glass ) , head light ( ordinary ) ( boyle davis ) , beds semi recilining , 32 lcd telivision , ledtv 42’’ , ledtv 55’’ , cd / dvd player ( home theater with 5 sound box ) , domestic refrigetor 190 ltr. , feeding equipments ( tubes, katoris & spoon ) , channel semi automatic coaglomater with regent , all types of dental extraction forceps ( each set 3 sets minimum required which includes upper and lower molars and anterior forceps. , x ray machine 100 ma with dark room assoseries ( with installation & 1 yrs. warrenty ) ( specifications attached ) , standalone color doppler machine ( specifications attached ) , portable ultra sound with pw ( with installation & 1 yrs. warrenty ) ( specifications attached ) , portable cooling unit ( vaccine / blood bags ) ( specifications attached ) , o.t light ( dichroic reflector ) ( with installation & 1 yrs. warrenty ) ( specifications attached ) , hospital bed ( ss head & foot side rod ) ( specifications attached ) , led light ( single ) ( with installation & 1 yrs. warrenty ) ( specifications attached ) , ultra high speed laboratary centrifuge ( specifications attached ) , digital incubator ( specifications attached ) , boyles machine ( specifications attached ) , 72 led dome ( double dome ) , lux 1, 30, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , 48 led dome ( single dome ) , lux 1, 00, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. , coutery machine ( 400 w ) , coutery machine ( 250 w ) , portable o.t. light ( abs doom 19 single reflecter polycarbonate ) , portable o.t. light led , vaccu suck suction tube ( titanium ) ( for suction machine ) , alis forcep 10 ( titanium ) , tissue forcep 10 ( titanium ) , convex array tranducer c343ua ( for ultra sound machine ) , phototherephy unit single surface ( stand model ) , phototherephy unit single surface led ( with led buld ) , silent genrator 10 kva ( with installation ) ( 10 kva, 3 phase, water cooled ) , silent genrator 15 kva ( with installation ) ( 15 kva, 3 phase, water cooled ) , silent genrator 20 kva ( with installation ) ( 20 kva, 3 phase, water cooled ) , silent genrator 50 kva ( with installation ) ( 50 kva, 3 phase, water cooled ) , silent genrator 60 kva ( with installation ) ( 60 kva, 3 phase, water cooled ) , silent genrator 82 kva ( with installation ) ( 82 kva, 3 phase, water cooled ) , silent genrator 100 kva ( with installation ) ( 100 kva, 3 phase, water cooled ) , magil circuit with mask ( for boyles apparatus ) , patho fast test kit ( for patho fast machine ) , blood gas analyser test kit ( for blood gas analyser ) , dossimeter , peak expiritory flow meter ( best quality ) , laryngoscope fibreoptic ent ( best quality ) , p.v. tray ( best quality ) , varicose vein set ( best quality ) , connector set of six for en ( best quality ) , tubes connecting for en ( best quality ) , leqqinqs , explorar , endo explorar , amalgam carrier in sliver , murcury ball burnisher , carver ( dimond ) , compactor , element carrier , gic ( glass ionomer cement ) , zinc phosphate cement , temporary filling material , electric ventouse , radient baby warmer , right angel artry 4 , right angel artry 6 , automated autoref stand ( for ophthalmic ) , 2 mirror cronioscope ( for ophthalmic ) , disposable needle 26 g ( for ophthalmic ) , ppiucd forcep , uterus collection ( sister u and mama u ) , water cooler with purifire ( 120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap , water cooler with purifire ( 40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap , hemoglobinometer ( 1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g / dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd / us fda / isoapproved 6. automatic correction of hb. 7. 20 , digital x ray film ( konika ) 8x10 , digital x ray film ( konika ) 10x12 , digital x ray film ( konika ) 12x12 , digital x ray film ( konika ) 12x15 , coin operated water atm machine ( ro plant and chiller ) specification · power : 100 270vac · solenoid: 12vdc ( internal ) · flow sensor: pulse type· level sensing: treated water level floaty · display: 2.8 tft, monochrome · programming keys: 5 · activation , water atm machine • easy to use and lend a lot of convenience • plug and play module kiosk can be installed in 3 hours • kiosk can produce up to 12000 liters of pure mineralized water per day, the lft units can produce 30, 000 liters per day • automatic , x ray digitalisationwith high end cr system ( with installation & 1 yrs. warrenty ) console software with multi modality work station the cr system should have advanced workstation provided with 17” high resolution monitor, keyboard & mouse, with the fol , x ray 500 ma ( with 1 yrs. warrenty ) x ray genera tor: high frequency x ray generator of frequency 40khz should be provided. power output of generator should be of sokw. kv range should be: • radiographic kv: 40 to 12sky. • fluoroscopic kv: 40 to 120k , micro scope binoculor ( with 1 yrs. amc ) ( ? stand: should be robust and sterile aluminum dye cast base ? observation: binocular tube should be inclined at 45deg and rotatable up to 360deg.mechanical tube length of 160mm. ? noise piece: quadruple revolvi , electrolyte analyser ( principle: direct measurement with lon selective electrode ( ise ) sample: 120 ?l for whole blood, serum, plasma 700 ?l for diluted ( 1:5 ) urine data storage: 100 patients result qc up to 30 results of normal, low, and high each. output: , suction machine foot operated ( powder coated m.s. chassis. noise level of suction apparatus from is 50 db + / 03 db. leakage current of suction units is less than 84 ua. electrical requirement – 220 ~ 230v, 50hz, 1 phase. ideal for mtp / medical / surgic , suction apparatus ( electric ) suction machine with pump: power supply: 230 240v / 50hz vacuum capacity: 18 litres / mim maximum depression: 75kpa ( 563mmhg ) vacuum is created by a plastic piston and cylinder system, with four vacuum creating modules ( , phototherapy unit 1 led phototherapy with intensity upto 6 50microwatts / nm / cumm / mwatt, adjustable intensity. 2 .height adjustable and tiltable light unit. 3 digital time totaller of led usage time. 4 stainless steel tray. 5 –provision for double surf , opthalmoscope 1. should be rechargeable battery with charger / mains operated. 2. should have halogen / led light source 3. should have red free filters 4. should have small and large spot sizes, fixation targets, slit aperture, hemi spot and cobalt blu , wireless indirect ophthalmoscope ( led ) ( compact and light weight, stereo optical system has all pupil features rechargeable battery integrated on headbrilliant white light with uniform and well spread led illumination ( focus distance : 300 800 mm, inter pupillary distance 50 74 mm, pupil size optics 1.00 mm, illumination : ledillumination , dental chair 1. should be electrically operated with zero program. 2. should have a switch operated operating light with minimum two steps of intensity control. 3. should have auto water connection for spittoon and tumbler with auto filling sensor. 4. s , pa system ( • recessed mount ( ceiling ) , surface mount, column and / or horn speakers, 12 watts with inbuilt transformer , wooden body , pressure level 97db, range 200 15000hz, rated voltage 100v, impedence 833 amplifier rated voltage output 100v, 150watts, mu , token display system ( token dispenser with issue keys , thermal printer, calling unit with keys for calling next token number, token display unit for showing token on cabin outdoor, central led display unit for showing token number with cabin numberconne , cctv ( 32 dvr ) ( 32 dvr :processor high performance embedded microprocessor, operating system embedded linux, user interface gui, video input 32 channel, bnc, video output 1 hdmi, 1 vga, video standard analog:32ch. @1080n ( 1~15fps ) , 24ch. @1080n, 16ch. @10 , intercom ( 24 extensions, expandable upto 32, micro controller based spc space division multiplexing, extension loop resistance : 600 ohms, operating temperature : 0 c to 45 c, power consumption : max. 100 watts, operating voltage : 220v 10% ) , av retractor 1.stainless steel 2.double ended, serrated 3.rust free 4.sturdy construction 5.accurate dimensions , vulcellum stainless steel size: 10 inch colour: silver shape: curved , ppiucd forcep ss , baby forceps ss ( big – straight ) , baby forceps ss ( big – curve ) , baby forceps ss ( big – straight ) , baby forceps ss ( small – curve ) , baby forceps ss ( small – straight ) , folis catheter 24 no , lab incubator 1. should have 4 inch attractive lcd display 2.should have intelligent controller to help maintain temperature incase of sensor failure 3. should have battery backup for temperature controller 4. should have auto tuning of controller , electricentrifuge, table top ( table top electric centrifuge ) 1. should have stepless speed regulator 2. should have safety lid interlock to prevent cover opening during centrifugation. 3. dynamic brake for quick deceleration 4. wide choice of swing out , cbc machine ( 5 part blood cell counter machine ) 1. should have throughput – 50 samples / hour 2.the sample volume should be < 17 ?l 3.should have technology – impedance ( wbc, rbc, plt ) , spectrophotometry ( hcg ) , should have optical laser methodfor 5 , incubator for culture sensitivity , hpcl machine . system should be compact bench top hplc system. 2. system should use cation exchange hplc principle for estimation of stable a1c. 3. system should have built in computer with the system software and must be able to work independent of exte , esr stand with tubes , elisa reader cum washer , glycosylated haemoglobinometer , blood collection monitor , intensifying screen x ray , dossimeter , peak expiritory flow meter ( best quality ) , baby incubators ( best quality ) , craniotomy ( best quality ) , static vaccum extractor ( best quality ) , head light ( ordinary ) ( boyle davis ) ( best quality ) , ent operation set including headlight, tonsils , ent nasal set ( smr, septoplasty, nasal endoscopic set ( 00 & 300 ) polypetcomy, dns, rhinoplasty ) ( best quality ) , laryngoscope led ( best quality ) adult , laryngoscope led ( best quality ) pediatric , tracheostomy set ( best quality ) , proctoscopy set adult ( best quality ) , proctoscopy set peadiartric ( best quality ) , p.v. tray ( best quality ) , abdominal hysterectomy set ( best quality ) , laparotomy set ( best quality ) , varicose vein set ( best quality ) , thomas splint ( best quality ) , laproscopy set for cholecystectomy , amputation set ( best quality ) , colposcope ( best quality ) , mouth prop , regional anaesthesia devices, epidural set , vascular clamp set ( best quality ) , steel cup board , case sheet holders with clip ( ss ) , draw sheet , pereneal sheets for ot , explorar , spoon excavator , twizer , endo explorar , amalgam carrier in silver , murcury ball burnisher , carver ( dimond ) , diathermy machine , doyess ( medium ) , gernes retractor , metal catheter , mayo scissor curved , lma ( adult ) , steel galipot small , dressing drum size 9x11 , sims vaginal speculam , epsiotomy scissor , ovum forcep , tailor scissor , doctor & nurse dress with designation ( paijama & kurta ) , doynes retroctor 1.5” ( german steel ) each , doynes retroctor 2” ( german steel ) each , doynes retroctor 2.5” ( german steel ) each , doynes retroctor 3” ( german steel ) each , doynes retroctor 3.5” ( german steel ) each , czernys retractor ( german steel ) each , formalin chamber ( 20x8x8x5 mm ) , formalin chamber ( 26x8x8x5 mm ) , lifter with jar , strraight scissor 5” ( german steel ) each , strraight scissor 6” ( german steel ) each , strraight scissor 7” ( german steel ) each , strraight scissor 8” ( german steel ) each , s.s. bowl30 cm ( super fine quality ) each , s.s. bowl36 cm ( super fine quality ) each , babcock clamp 6” ( german steel ) each , babcock clamp 8” ( german steel ) each , ambu bag adult ( silicorised ) ( super fine quality ) , ambu bag child ( silicorised ) ( super fine quality ) , artery forceps 6” curved ( german steel ) , artery forceps 6” straight ( german steel ) , mayo scissor long curved 6.5” each ( german steel ) , mayo scissor long curved 7.5” each ( german steel ) , tooth forceps 6” each ( german steel ) , non tooth forceps 6” each ( german steel ) , tenaculum long each ( german steel ) , myome screw each ( german steel ) , morrisen retractor each ( german steel ) , sim speculum medium each ( german steel ) , sim speculum long each ( german steel ) , waste disposal colour coded buckets swine bing 30 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets swine bing 60 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets swine bing 80 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , waste disposal colour coded buckets ( black, red, yellow, blue ) ( neelkamal, cello, suprem ) , dust bin ( ss ) small ( best quality ) , dust bin ( ss ) big ( best quality ) , sauce pan with lid , chest stand for x rey unit , oropharyngeal airway ( 000 4 guydel size ) , oxygen cylinder 10 ltr. mo2 with valve , bipap machine , shoe cover – per pair , elvo gloves – per pair , lyarigoscope set adult with led – each , lyarigoscope set child with led – each , hemoglobino meter digital – each , disposable syringe 20 ml – each , massiring mug – each , hair tremer branded – each , hot air oven , urino meter , adk drain , concigated drain ( plastic ) , diatharmy plate for vally lab , laryngoscope adult set , laryngoscope ped. set , coutry pencil , crash card with steel drower , spoon ( stenless steel ) , digital spirometer , carbonmonoxide monitor , ecg machine computarized for ccu ( specifications attached ) , ecg machine ordinary ( specifications attached ) , cardiac monitor for ccu ( specifications attached ) , cardiac monitor for ccu ( specifications attached ) , cardiac monitor for ccu ( specifications attached ) , defebrillator for ccu ( specifications attached ) , ventillator ( adult ) for ccu ( specifications attached ) , ventillator ( paediatric ) for ccu ( specifications attached ) , pulse oximeterfor ccu ( specifications attached ) , pulse oximter with nib for ccu ( specifications attached ) , carm for ccu ( specifications attached ) , laryngoscope for ccu ( specifications attached ) , nibulisor adult with mask , nibulisor child with mask , nibulisor mask for adult , nibulisor mask for child , infant weighing scale , lc dcp and dcp basic instrument set , small fragment lc dcp & dcp® instrument set, st. steel , select lcp upgrade instrument set large & small fragment , dhs / dcs instrument set , css 4.5mm instrument set in vario case , css 6.5mm instrument set in vario case , synream , distractor set large , distractor set medium , bone forceps range , general instrument set , instruments for damaged screw removal , chisel and impactor set , tomofix instrumentset in syncase , instrument set for minimally invasive plate insertion osteosynthesis ( mipo ) in vario case , collinear reduction clamp in vario case , reduction handles, toothed and rounded, small & large in modular tray , mipo cerclage passer , hohmann retractor , soft tissue spreader set , periarticular reduction forceps , pelvic basic instruments , pelvic reduction & retraction , pelvic c clamp , wire instrumnents set , shoulder instruments , gili pot ss , weight machine hanging ( for bmw ) , sterlizer indicator , bio west trolly single bin , bio west trolly doubble bin , bio west trolly triple bin , scissor gauze cutting , 2.4mm lps distal radial plate, volar , 2.4mm lps distal radial plate, volar buttress , 2.4mm lps distal radial plate, extra articular , 2.4mm lps t distal radial plate , 2.4mm lps distal radial plate, straight , 2.4mm lps l distal radial plate, right angled , 2.4mm lps l distal radial plate, oblique angled , 2.4mm lps distal radial plate, long , 2.4mm lps volar rim distal radial plate , 2.4mm lps double column distal radial plate, volar 19.5 mm , 2.4mm lps double column distal radial plate, volar 22.5 mm , ø 2.4mm locking screw t8, self tapping , ø 2.4mm cortex screw t8, self tapping , ø 2.4mm headless compression screw short thread , ø 2.4mm headless compression screw long thread , 3.5mm lps small compression plate , 3.5mm lps small metaphyseal plate , 3.5mm lps reconstruction round hole plate , 3.5mm lps reconstruction combined hole plate , 3.5mm lps t plate right angled , 3.5mm lps cloverleaf plate , 3.5mm lps t plate oblique angled , 3.5mm lps proximal humerus plate short , 3.5mm lps proximal tibia plate , 3.5mm lps medial proximal tibial plate , 3.5mm lps medial distal tibia low bend plate , 3.5mm lps one third tubular plate , 3.5mm lps proximal humerus locking plate , 3.5mm lps calcaneal plate , 3.5mm lps calcaneal plate , 3.5mm lps calcaneal plate , 3.5mm lps calcaneal plate , 3.5mm lps calcaneal plate , 3.5mm lps calcaneal plate , 3.5mm lps periarticular proximal lateral tibia plate , 3.5mm lps periarticular proximal lateral humeral plate , 3.5mm lps proximal tibia plate, posteromedial , 2.7mm / 3.5mm lps lateral distal fibula plate , ø 3.5mm locking screw, self tapping , ø 3.5mm cortex screw, self tapping , ø 4.0mm cancellous screw, short thread , ø 4.0mm cancellous screw, full thread screw , ø 3.5mm locking cancellous screw, self tapping , 2.7mm / 3.5mm superior anterior clavicle plate , 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension , 2.7mm / 3.5mm posterolateral distal humerus plate , 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support , 2.7mm / 3.5mm medial distal humerus plate , 2.7mm / 3.5mm lps medial distal humerus metaphyseal plate , 3.5mm lps distal humerus extra articular plate , 3.5mm lps olecranon plate , 3.5mm lps clavicle hook plate , ø 3.5mm locking screw, self tapping , ø 3.5mm cortex screw, self tapping , ø 4.0mm cancellous screw, full thread , ø 2.7mm locking screw, t8 self tapping , 4.5mm lps compression plate narrow , 4.5mm lps compression plate broad , 4.5mm lps distal femur plate , 4.5mm lps proximal lateral tibia plate , 4.5mm lps t plate , 4.5mm lps t buttress plate , 4.5mm lps large metaphyseal plate , ø 5.0mm locking screw, self tapping , ø 4.5mm cortex screw, self tapping , ø 6.5mm cancellous screw, full thread length , ø 6.5mm cancellous screw, 16mm thread length , ø 4.5mm cannulated screw, self drilling, short thread , ø 10.0mm washer , 6.5mm cannulated screw, self drilling, 16mm thread length , ø 13.0mm washer , chemiluminiscence instrument ( specifiction attached ) , heamatology analyzer ( specifiction attached ) , gel centrifuge ( specifiction attached ) , gel card reader ( specifiction attached ) , variable pipette ( ce certified ) , variable pipette ( ce certified ) , spirometer , operating microscope , phaco machine , nasal endoscope ( full set ) , laparoscopy set , hplc / high performance lequied chromatography , carbon monoxide breath monitor ( specifiction attached ) , portable 3 channel ecg recorder ( specifiction attached ) , 300ma fixed x ray unit with multi position table ( specifiction attached ) , 100 ma, 100 pps line frequency mobile x ray ( specifiction attached ) , biphasic defebrillator with aed ( specifiction attached ) , ctg nst machine ( specifiction attached ) , digital radiography system high frequency ( digital x ray ) ( specifiction attached ) , high end premium ultrasound system ( specifiction attached ) , syringe pump ( specifiction attached ) , 12 channel ecg test equipment treadmill ( specifiction attached ) , defibrillator ( specifiction attached ) , ventilator – adult ( specifiction attached ) , central patient monitoringstation ( specifiction attached ) , incubation kit ( specifiction attached ) , bronchoscope ( specifiction attached ) , portable ultra sound machine ( specifiction attached ) , colour doppler ( specifiction attached ) , non invasive ventilator ( specifiction attached ) , shortwave diathermy , analogbubble c pap , urineanalyser ( routine ) , centrifuge machine , hot air over , incubator , abg machine , urine culture cabinet , a.c hitachi / voltas / blustar / daikain 1.5 ton 5 star , fire extingusher co2 / abc, 5kg, 10kg, 15kg , cholorimeter ( standard quality ) , three seater waitting chair ( standard quality ) , corbon monoxide breath monitor ( standard quality ) , spirometer ( standard quality ) , portable audio system with cordless mike ( standard quality ) , projector ( standard quality ) , ppiucd forcep ( standard quality ) , grass cutter machine ( standard quality ) , high back chair ( standard quality ) , office table big size 5*3 feet ( standard quality ) , glucometer strip ( standard quality ) , haemoglobinometer strip ( standard quality ) , laptop lenovo / dell / hp, inter core i 6th generation, windows 10 home, 4gbddr , 8gb ram, 1 tb hdd, 5400rpm, 2gb graphics card, 15.6 inch hd led , hd web camera, 1 year onsite warranty , inverter microtec / luminious / vgaurd 1200va , inverter microtec / luminious / vgaurd 1600va , battery 150a microtec / luminious / vgaurd / exide , battery 180a microtec / luminious / vgaurd / exide , battery 210a microtec / luminious / vgaurd / exide , battery 240a microtec / luminious / vgaurd / exide , portable x ray machine 100ma , phenyl 5litre ( standard quality ) , wiper ( standard quality ) , handwash ( standard quality ) , broom ( standard quality ) , bleaching powder ( standard quality ) , bucket 10 litre ( standard quality ) , dettol soap ( standard quality ) , aquagaurd water purifier ( ro +uv ) ( standard quality ) , aquagaurd water purifier big size ( standard quality ) , ceiling fan ( standard quality ) , wall fan ( standard quality ) , exhaust fan ( standard quality ) , curtain for windows ( standard quality ) , curtain for doors ( standard quality ) , four folded bedside screen curtain ( standard quality ) , led bulb ( standard quality ) , plastic mug ( standard quality ) , plastic chair with arms ( standard quality ) , plastic chair without arms ( standard quality ) , red / black zipper bags ( standard quality ) , colour coded bio disposable bags ( standard quality ) , official almirah big size ( standard quality ) , official almirah with shelf ( standard quality ) , revised national tuberculosis control programme ( rntcp ) , ethanol 500 mlpack companysuch asstabio, ranbaxy, emerk etc. , methylated spirit 5 ltrpack , distilled water ( d ionised water ) clear with neutral ph , basic fuschin chemicalnamepararosanilinehydrochloridec20h20 n2 cin mol wt. 337.86 dye content approx 85% 88% ( dyecontentmust be mentionedon thecontainer ) colour metalic green, pack size 25 gm, reputed company like ranbaxy / emerk , carbolic acid / phenol crystal chemical name ; phenol c6 h5 oh2 and molecular wc 94.11 melting point 40 degree c+2, purity 99.5% pack size500gmsbottle, reputedfirmsuchassigma / ranbaxy / emerk etc. , sulphuric acid 5 ltr size. h2so4, molecular wt. 98.08 minimum assay 98%colourclearanyreputedfirmsuchasemerk / ranbaxy , liquid parraffin ( heavy grade ) 400 / 450mlpack.refractiveindexof1.48shouldbe colourless odorness transparent free from florescence in day light with relative density of 0.827 to 0.890 vescosity of 110 to 230 mpas specific gravity of 0.76 to 0.78at15.50canyreputedfirmsuchasheavygr gradesigma / fluka / ranbaxy / bdh / qualigens / emerk / nice , glass slide plain, size=75mmx25mmx25mmx1.35mm, clean scratchfree withsmoothedge uniformrefractive index, pack of 50, isi marked, of reputed company like axiva / blue star etc. , plastic disposable container with label cups made of special medical grade polypropylene thin plastic, transparentdiameter4cm, capacity30ml, srewablecapshouldalsobemadeofspecialmedical grade polypropylene and should be air tight, leak proof. company such as mangalam, stanbio etc. , absorbent cotton absorbent each roll of 0.5 kg / 500 gm , slide box for 25 slides / 50 slides / 100 slides , measuring cylinder glass 100 ml / 500 ml company such as borosil etc , pipet 5ml , pipet 10 ml , amber bottle colour bottle , falcon tube conicalgraduatedcentrifugetubes, tubesmadeof specialmedicalgradeclarifiedpolypropylene resistant toalcohols andmildorganicsolvents, material should bestablefrom80degreeto121degreecentigrade, shouldwithstandcentrifuge forcesupto12000xrcf, transparent / translucent walls for easy viewing, 50 ml capacity, 30mmouter diameter, 115mmlength, flat top, conical base ( 2ml capacity ) , screw cap ( at least 2.5 threads ) also madeofmedicalgradepolypropylene air tight leak proof, printed graduations on the tube, sterlized by gamma irradiation and non pyrogenic , diamond marker 6” ( 15.24 ) holderwithartificial diamond ( hardstone ) embedded ofoneend withscrewcaptomark on microscope glass slides , staining rod stainless steel / glass , phunal glass make borosil / stanbio etc. , tissue paper , lens paper soft microscope lens cleaning tissue 4” x 6” size booklet of 100 sheets , filter paper waterman no. 1 packs of 100 2” x 2” , gloves pvc each pair , auramine ‘o’ 100 gm company such as ranbaxy / emerck / sigma / titan etc. , absolute alcohol 500 ml company such as ranbaxy / emerck / sigma etc. , potassium permagnet 500 gm company like as mereck / emerck , hydrochloride acid concentrated 500 ml size , oxalic acid 500 gm such as mereck / emerck etc. , conical flask 500 ml / 1 ltr size company such as borosil etc. , methanol 5 ltr pack such as emerck etc. , mask general user mask 100 pcs. pack , mask n 95 or higher good quality standard company make per pc. , national programme for control of blindness ( npcb ) , operating microscope , a scan , b scan , streak ratinoscope , o.t. table , operating chair , medicine trolly , sterlization set , surgical minor instrument , trial box+trial frame , rotating drum wall + near vision , retinoscope , opthalmoscope ( direct ) , kerotometer ( manual ) , torch o ( 3 cell ) , corneal loupe , slit lamp + autorofretometer + opthalmic chair , goniscopy , applanation tonometer , friedman visual field anaylosr , fundus photography machine , color vision chart , lencometer , retinal camera , tonometer , foreign body remover machine , ac , trial lens set illuminated with 232 lens and trial frame , distant vision illuminated drum with snellens chart , jaeger eye chart , direct ophthalmoscope heines beta 200 , indirect ophthalmoscope appasamy associaties , retinoscope heines , 20 d lens volk , 90 d lens volk , 78 d lens volk , 4 mirror gonio lens ocular , slit lamp ( aia 11 5s / 5l ) with applanation tonometer and motorised stand appasamy associaties , autorefractokeratometer and motorised stand potec prk 7000 ( appasamy associates ) , non contact tonometer reichert 7 ( appasamy associates ) , national oral health programme ( nohp ) , electronic dental chair confident meenakshi , dental compressor 55 l confident dental air compresser oil free , root elevators set of 9 orocract , periosteal elevators dingman , extraction kit pedo ( set of 12 pcs. ) gdc , extraction kit adult ( set of 12 pcs. ) gdc , bone ronguer apical , mouth mirror tops magnified gdc , cheek retractors , dental precision instrument ( probe + mouth mirror & handle + tweezer ) gdc , spatula indian agate , composite spatula lm arte lm dental , non stick composite antorior / posterior placement instruments cosmodent , gic mixing pad , gc gold label 1 luting & lining gc gold , gc gold label 2 glass inomer gc gold , plastic filling instrument kit set of 6 regular api , fine grain silver alloy dpi , mercury dpi , scaler tips woodpocker , vivadent tentric n collection system kit / n bond ivoclar , confident 70 kva x ray machine confident , indian film developing clip indian , mouth probe gdc , twiser gdc , ball burnisher ( bb 22 / 23 ) # 1 gdc , gic spatula gdc , composit spatula gdc , composite filling set gdc , gic filling set gdc , plastic spatula , amalgan + silver alloy , motor pistal , gic restorative material , gic luting material , composit ( ivoclar ) , ultrasonic scaler uds p woodpocker , endo box with 72 holes , amalgan prepration bur 24 spk , scissor heath fior suture cutting , needle syringe destory 100% copper trausformer 100 watt , # 3 0 black braided suture , niddle holder mayo hegar , contrangle handpices fx 23 , imprint alginate powder , alginate mixing bowl , set up tray , conservative kit economy instrument set of 19 in pauch , orafil g 40 mg temprory filling material , zinc oxide engeol quick cement set , scalple handle no. 4 , bard parker blader # 12 / #15 , finger spreaders 21 mm , finger spreaders 25 mm , plugger 21 mm , plugger 25 mm , dental intraoral e speed film , dental x ray film holder , dental x ray film developer , dental x ray film fixer , light cure , k file set 06 / 08 / 10 / 15 / 20 / 25 / 30 / 35 / 40 / 45 / 50 / 55 / 60 / 65 / 70 / 75 / 80 number , sprader , dental round bur prima dental , dental stright bur prima dental , dental taper fissure bur prima dental , dental taper bur prima dental , fissure bur prima dental , pear bur dimoned prima dental , pear bur ( 330 ) prima dental , taper flat & bur prima dental , flade fissure bur prima dental , suture needle size 6 / 7 / 8 supergold , suture scissor , x ray developing box prime dental , tray , dental stone , aerotar , micromotor complete set , imprassion tray dentulous perforated kit set of 8 , rods for door curtains ( per running fit ) , buckets ( ss with lid ) ( ( ss with lid ) 20 ) , waste disposal twin bucket for hypochlorite solution / bleach ( big ) , towels ( small ) ( 15x30 ) , towels ( big ) ( 60x30 ) , baby towel ( ( 24x36 ) , sauce pan with lid ( ss ) , drum with tap for storing water ( 100 ltr. plastic ) , bed sheet ( multi colour ) cotton ( 60x90 long cloth best quality colour ) , pillow ( senthatic ) 14x24 ( 1 kg ) , pillow coverbest quality ( 16x26 ) , blanket ( 2 kg ) , lpg cylinder5kg ( iron ) , . lpg stove ( iron ) , macintosh, rubber sheet cloth pasted ( per mtr. ) , catheter, urethral, rubber, foleys 14 er ( 14 er ) , kerosene stove ( iron ) , hub cutter ( heavy ) , hub cutter with needle destroyer ( electric ) , x ray view box ( doubble file ss body ) , xerox machine ( minimum copying speed ( cpm ) : 15 / 15 ) ( specifications attached ) , xerox machine ( minimum copying speed ( cpm ) : 20 / 20 ) ( specifications attached ) , xerox machine ( minimum copying speed ( epm ) : 25 / 25 ) ( specifications attached ) , exuctive table with pedestal and credistal ( specifications attached ) , exuctive chair lather ( specifications attached ) , office table wood & steel ( 5x3 ) ( specifications attached ) , office table singal side drawer ( 4x2.25 ) ( specifications attached ) , computer table fully wooden ( specifications attached ) , work station sme model ( single unit ) ( specifications attached ) , four door vertical fitting cabinet steel ( specifications attached ) , four door book case steel ( specifications attached ) , office almirah storewell plain 4 selves ( specifications attached ) , mid back chair ( specifications attached ) , mid back revolving chair ( specifications attached ) , steel rack iron ( 78x36x15 ) ( 4 selves ) , plastic chair ( branded company ) ( with arm ) , three seater crome ( ss ) , two seater crome ( ss ) , three seater crome with cution ( ss ) , three seater iron ( with arm ) , book selves ( 66x36x15 ) ( 4 selves ) , revolving stool ( wihh cution hydrolic fully ss ) , rubibrized core matress ( 6x3x4 with rackcin cover ) , stool fixed ( iron ) , mosquito net ( 6 x 4 ) , abdominal sheet small ( best quality ) , abdominal sheet big ( best quality ) , abdominal sheet big ( best quality ) , cloths for new born ( disposable diapers, cap & socks ) , gowns for mothers , foam mattress ( • 10cms thick, 32 / 40 density foam mattress covered with rexine closed for plain bed. ) , 2 fold foam mattress ( • 10cms thick, 32 / 40 density foam mattress covered with rexine closed for plain bed. ) , 3 fold foam mattress ( • 10cms thick, 32 / 40 density foam mattress covered with rexine closed for plain bed. ) , cardiacfoam mattress ( • 10cms thick, 32 / 40 density foam mattress covered with rexine closed for plain bed. ) , vip chair with cuition ( with arm ) , office table general sanmica top ( 2.5x5 ) both side three drower ( both side three drower ) , office table general sanmica top ( 2.5x4 ) one side three drower ( one side three drower ) , gas refiling of fire extinguishers ( 5 kg ) , mfs tab biometric ( complete set ) ( tab ) , mfs100 biometric ( fingure scanner ) , telephone ( set ) , autometic stabilizer for ac , three sheeter crom reparining , card printing ( a4 size ) ( 120 gsm, art paper, multi colour printing one side ) , card printing ( a4 size ) ( 120 gsm, art paper, multi colour printing both side ) , card printing ( 1 / 8 size ) ( 120 gsm, art paper, multi colour printing one side ) , card printing ( 1 / 8 size ) ( 120 gsm, art paper, multi colour printing both side ) , card printing ( 1 / 6 size ) 120 gsm, art paper, multi colour printing one side , card printing ( 1 / 6 size ) 120 gsm, art paper, multi colour printing both side , register with printing ( 45 cm x 30 cm ) 25 page ( laser paper 54 gsm ) , register with printing ( 45 cm x 30 cm ) 50 page ( laser paper 54 gsm ) , register with printing ( 45 cm x 30 cm ) 75 page ( laser paper 54 gsm ) , register with printing ( 45 cm x 30 cm ) 100 page ( laser paper 54 gsm ) , candel set refiling & servicing forkent ro aquaguard 10 ltr. , desktop computer ( with preloaded operating system ) intel core i3 10th gen., operating system : microsoft windows 10, 4 gb ram, 1 tb hdd, dvd writer, 18.5 led ( lenovo / hp / dell ) + one year warranty , desktop computer ( with preloaded operating system ) intel core i5 10th gen., operating system : microsoft windows 10, 8 gb ram, 1 tb hdd, dvd writer, 18.5 led ( lenovo / hp / dell ) + one year warranty , all inone desktop computer ( with preloaded ) intel core i3 10th gen, operating system : microsoft windows 10, 8 gb ram, 1 tb hdd, dvd writer, 21 led ( lenovo / hp / dell ) ( lenovo / hp / dell ) + one year warranty , all inone desktop computer ( with preloaded ) intel core i5 10th gen, operating system : microsoft windows 10, 8 gb ram, 1 tb hdd, dvd writer, 21 led ( lenovo / hp / dell ) + three year warranty ( lenovo / hp / dell ) + one year warranty , printer hp 1020 plus ( laser jet ) resolution 600x600 speed in ppm 18 ( a4 size ) , printer hp 1108 ( laser jet ) resolution 600x600 speed in ppm 18 ( a4 size ) , printer hp 1005 mfp ( print, scan, copy ) ( hp ) , printer hp 1136 mfp ( print, scan, copy ) ( hp ) , laptop / notebook ( intel core i3 10th gen., operating system : win 10 ( hp / dell / lenovo ) , laptop / notebook ( intel core i5 10th gen., operating system : win 10 ( hp / dell / lenovo ) , laptop / notebook ( intel core i7, 10th gen, operating system : windows 10 ( hp / dell / lenovo ) , ups 1 kv ( double battary ) , scanner flatbet a4 size ( hp / canon ) , cctv camera 2 mp ( hikvision / huniwell ) , cctv camera 3 mp ( hikvision / huniwell ) , power supply 20 amp , cctv copper wire 3+1 ( 90 miters ) , hd dvr 8 channel matal body, 1080 p resolutation, 2 & 3 mp camera sapported , hd dvr 16 channel matal body, 1080 p resolutation, 2 & 3 mp camera sapported , servilance hdd 2 tb . , west disposal colour coated poly beg ( black, red, yellow, bule ) ( per kg. ) , air conditioner ( 2 ton ) 3 star , mother & child name tag belt printed ( per pair ) , a4 size paper ( century ) 75gsm 500 sheets copy , a3 size paper ( century ) 75gsm 500 sheets copy , notesheet , arch lever file , fly leaf , ring file a4size , nylon tag , file board 28mm 14x10 , box file , paper flag ( 3 colour prompts ) oddy , resositionable notes ( sticks notes 3x 3 ) oddy , cello tape 0.5 inch , cello tape 1 inch , cello tape 2 inch , steel scale30 cm , envelope 10 x 4.25 brown , envelope 10 x 14 lamination , fevi stick 15gm , apsara pencil , stamp pad ( 110mm x 69mm ) faber castle , stamp pad ( big ) ( 157mm x 96mm ) , dak dispatch register 425 pages printed laser paper green colour 70gsm ( 21cm x 34 cm ) , peon book 196 pages printed laser pad green colour 70gsm ( 18cm x 21 cm ) , stapler small 10 no. , stapker pin 10 no. , stapler big 24 no. , stapler pin 24 / 6 1m , highlighter luxor , siganture pad , reynold trymax pen , add gel pen , jetter pen , ball pen , luxor green pen , calculator ( small ) casio 10 digit , calculator ( big ) casio 12digit , sharpner , erasser , correction pen , single hold punch kangaroo fb20 , scissor heath fior suture cutting , takua plastic handle , permanent marker luxor , notebook ( p.a ) 58gsm white 21cm x 34 cm 16 page , paper clips , paper binder clips ( small 25mm ) , paper binder clips ( medium 32mm ) , paper binder clips ( big 41mm ) , vechile log book 192 pages printed laser pad green clolur 70 gsm 18cm x 21 cm , vechile log book 192 pages printed white ever look 58gsm 20cm x 32 cm , movement register 192 pages printed white ever look 58gsm 20cm x 32 cm , index register 192 pages printed white ever look 58gsm 20cm x 32 cm , attendanceregister 46 pages printed laser paper green colour 70gsm ( 21cm x 34 cm ) , register 4 no. ruled paper 82 page ( laser paper green colour, thickness 70gsm size 34cm x 21 cm ) , register 8 no. ruled paper 192 page ( laser paper green colour, thickness 70gsm size 34cm x 21 cm ) , register 10 no. ruled paper 240 page ( laser paper green colour, thickness 70gsm size 34cm x 21 cm ) , register 12 no. ruled paper 288 page ( laser paper green colour, thickness 70gsm size 34cm x 21 cm ) , register 16 no. ruled paper 384 page ( laser paper green colour, thickness 70gsm size 34cm x 21 cm ) , register 24 no. ruled paper 575 page ( laser paper green colour, thickness 70gsm size 34cm x 21 cm ) , l size plastic folder , stick file , hp 12 a cartridge ( hp laserjet 1020 plus printer , hp laserjer m11336 mfp printer cartriadge , canon scan machine , pencil battery , remote battery , stamp pad ink blue / green / black , jharan , wireless mouse , wireless keyboard , keyboard , mouse , executive leather folder , notepad , towel for drying and wrapping the baby , green bedsheetspecification 3x6 size , white bedsheet specification 3x6 size...

Health Department - Jharkhand

29775934 rate contract for supply of material , machine and other essential item rate contract for supply of material , machine and other essential item , items : , 02cylinderforboyles , 10nasogastrictubesno , 200wattbulb , 2mirrorcronioscope ( forophthalmic ) , 32lcdtelivision , 3foldrecliningbedmanually , 3seaterchairsforwaitingarea , 5lplastictubforkeepingchlorinesolution , 90dlens ( forophthalmic ) , abcdrypowder2kg. , abcdrypowder4kg. , abcdrypowder6kg. , abdominalhysterectomyset ( bestquality ) , abdominalretractors , abdominalsheetbig ( bestquality ) , abdominalsheetbig ( bestquality ) , abdominalsheetsmall ( bestquality ) , ac ( airconditioner ) 1.starrating 3, 2.capacity1.5ton, 3.splitac , adultstethoscope , adultstethoscope , aircondisnor ( 1.5ton5starwithstabelizer ) , aircondisnor ( 1ton5starwithstabelizer ) , airway , airway0, 1, 2, 3, 4 adult , airwayguedelorberman, autoclavablerubber , airwaypeadiartric , alisforcep10 ( titanium ) , alisforcep6 ( titanium ) , alisforcep8 ( titanium ) , all inonedesktopcomputer ( withpreloaded ) intelcorei5, operatingsystem:microsoftwindows10, 4gbram, 1tbhdd, dvdwriter, 20led ( lenovo / hp / dell ) +threeyearwarranty ( lenovo / hp / dell ) +threeyearwarranty , allisforceps , allisforceps , alltypesofdentalextractionforceps ( eachset3sets minimumrequiredwhichincludesupperandlowermolarsandanteriorforceps. , almira , amalgamcarrierinsilver , amalgamcarrierinsliver , ambubag , ambubag ( baby ) ( silicon ) , ambubagsiliconadult , amputationset ( bestquality ) , anaesthesiaworkstation ( includeanaesthesiamachinewithvaporiser, ventilator, monitor ) , anteriorvaginalwallretractorstainless ( ( ssantirustquality ) , applanationtonometer , arteryforceps , arteryforceps ( curved140rnrn ( titanium ) , arteryforceps ( curved180mm ( titanium ) , arteryforceps ( straight140rnrn ( titanium ) , arteryforceps ( straight180mm ( titanium ) , autoclave ( elec. ) dubbledrum4x10 , autoclave ( elec. ) dubbledrum6x12 , autoclavemachine , automatedautorefstand ( forophthalmic ) , automatedexternaldefabrillator ( desirable ) , avretractor 1.stainlesssteel 2.doubleended, serrated 3.rustfree 4.sturdyconstruction 5.accuratedimensions , b.p.instrumentswithstand , babyblankets , babyforcepsss ( big–curve ) , babyforcepsss ( big–straight ) , babyforcepsss ( big–straight ) , babyforcepsss ( small–curve ) , babyforcepsss ( small–straight ) , babyincubators ( bestquality ) , babytowel ( 24x36 ) ( softcotton ) , babytray ( ss, ceinbuild ) , babyweighingmachinedigital , babyweighingscale , backrest , bag, reathing, selfinflating ( anti staticrubber, setof4 ) , basin , basin825mlsswithwheels , basinassorted ( ss ) , basinstandassorted ( ss ) ( 2basintype ) , bedpan ( ss ) , beds ( manualsemi fowlerbedswithcastors ) , bedsheetmulticolourcottonsize60x90longclothbestqualitycolour. , bedsheets , bedsidechair ( stypoewitharms ) , bedsidelocker ( bestquality ) , bedsidelocker ( fullyss ) ( bestquality ) , bedsidescreen4folds , bedsidescreenwithcloth ( 1roundpipewithwheel ) , bedssemi recilining , bedwithmatress , besinboul ( withstand ) , blankets , blankets , blanketweight2kgredcoloursize60x90 , bloodcollectionmonitor , bloodgasmachine , bloodtransfusionset ( bestquality ) , boilerorautoclave , bookselves ( 66x36x15 ) ( 4selves ) , bowl, metalsponge ( 600rnl, ref.is:5782 ) , bowlforantisepticsolution , bowlforantisepticsolution , boylesmachine ( specificationsattached ) , boylesmachine, braincircuit, jr , boylesmachinewithventilator ( ansthesiaventilator ) , bpapparatusdialtype , bpapparatusled , bpapparatusmerucry , bpapparatusstandmodel , bpappratusdigital , bphandle 3 / 4no ( titanium ) , breathingtubes, hoses, connectorsforitem1, ( anti static ) , bubblecpapmachinewithcompressor , bucketbig , bucketforkeeping1%chlorinesolution ( forspillage ) , bucketforkeeping1%chlorinesolution ( forspillage ) , buckets , bucketsmall , caps , cardiacbed ( specificationshouldbeattachedintechnicalbidturms&condition ) , carver ( dimond ) , carver ( dimond ) , case5heetholderswithclip ( ss ) , catheterurethral, rubber, foleys14er ( 14er ) , cctv ( 32dvr ) ( 32dvr:processorhighperformanceembeddedmicroprocessor, operatingsystemembeddedlinux, userinterfacegui, videoinput32channel, bnc, videooutput1hdmi, 1vga, videostandardanalog:32ch.@1080n ( 1~15fps ) , 24ch.@1080n, 16ch.@10 , cdplayer ( hometheaterwith5soundbox ) , cervicalbiopsyset ( bestquality ) , chair , chairsforwaitingarea ( threeinoneset ) , cheatleforceps , cheatlesforceps , cheststandforx reyunit , chlorinetablets , clampintestinal, doyen ( curved225mrn, ss ) , clampintestinal, doyen ( straight225rnrn, ss ) , cleaningmaterialanddetergents , clothsfornewborn ( disposablediapers, cap&socks ) , co2fireextinguisher2kg. , co2fireextinguisher4.5kg. , co2fireextinguisher6.5kg. , co2fireextinguisher9kg. , colourcodedbins black , colourcodedbins blue , colourcodedbins red , colourcodedbins yellow , colourcodedbins yellow, redandblack ( bigandsmall ) , colourcodedplasticbags ( yellow, red, blueandblack ) , colposcope ( bestquality ) , compactor , computertablefullywooden ( specificationshouldbeattachedintechnicalbidturms&condition ) , condombox , conjunctivalscisser ( forophthalmic ) , connectorsetofsixforen ( bestquality ) , convexarraytranducerc343ua ( forultrasoundmachine ) , cordcuttingscissor ( ss ( titanium ) , cordcuttingscissor / surgicalbladeforcuttingcord , cordcuttingscissor / surgicalbladeforcuttingcord , cornealscisser ( forophthalmic ) , cot , cottondari12x15 , cottondari12x158 , cottonfoldingstrecherforambulance ( bestquality ) , cottonswab ( roll ) , countingchamber , craniotomy ( bestquality ) , crashcard ( ss ) , ctscan , curette, uterine, simsblunts ( titanium ) , curtains , curvecocker ( titanium ) , cusco’s / gravesspeculumvaginalbi valvelarge , cusco’s / gravesspeculumvaginalbi valvemedium , cusco’s / gravesspeculumvaginalbi valvesmall, , cuscoss / gravesspeculumvaginal ( large ) , cuscoss / gravesspeculumvaginal ( medium ) , cuscoss / gravesspeculumvaginal ( small ) , cuscosspeculum ( large ) , cuscosspeculum ( medium ) , dariwithroomsize. , defibrillator , deliverytable ( 72x24x3 ) powercoated , deliverytray , deliverytroly , dentalchair 1.shouldbeelectricallyoperatedwithzeroprogram. 2.shouldhaveaswitchoperatedoperatinglightwithminimumtwostepsof intensitycontrol. 3.shouldhaveautowaterconnectionforspittoonandtumblerwithautofilling sensor. 4.s , dentalprobe , dentalprobe , dentalx rayfilm , designatednewborntraysswithlid , designatednewborntraysswithlid , desktopcomputer ( withpreloadedoperatingsystem ) intelcorei37thgen., operatingsystem:microsoftwindows10, 4gbram, 1tbhdd, dvdwriter, 18.5led ( lenovo / hp / dell ) +threeyearwarranty , desktopcomputer ( withpreloadedoperatingsystem ) intelcorei57thgen., operatingsystem:microsoftwindows10, 4gbram, 1tbhdd, dvdwriter, 18.5led ( lenovo / hp / dell ) +threeyearwarranty , dextrose10%, 25%, 50% , diettrolley stainlesssteel , digitalhemoglobinometer , digitalincubator ( specificationsattached ) , digitalthermometer , digitalthermometer , digitalweighingmachine ( adult ) ( 1.capacity:160kg2.accuracy:100g3.plattersize:350mmx300mm ( tolerance+ / 10% ) 4.thescaleshouldbemadeupofheavyduty.castironstructureplatformwithpowdercoatedframes.5.theelectronicadult , digitalweighingmachine ( child ) whogmp, ce, iso9001, iso13485 , digitalxreyfilm ( konika ) 10x12 , digitalxreyfilm ( konika ) 12x12 , digitalxreyfilm ( konika ) 12x15 , digitalxreyfilm ( konika ) 8x10 , dilar ( forophthalmic ) , dilator, uterine, double endedhegar ( setof5 ( ssantirustquality ) , disposablecordclamp , disposabledeliverykitfordeliveringhivpatients ( emergency ) , disposabledeliverykitfordeliveringhivpatients ( emergency ) , disposabledeliverykitfornormaldelivery , disposableneedle26g ( forophthalmic ) , disposableneedles22, 23, 26g , doctorappronwhitefreesize ( halfslaveterrycot ) , doctorcoatfreesizefull , doctorcoatfreesizehalf , doctorsovercoat , domesticrefrigetor190ltr. , doorcurtaincotton48 , doorcurtainsenthatic48 , doppler , dossimeter , drawsheet , dressingdrumbig12x15 , dressingdrumsmall9x9 , dressingdrumwithlid , dressingtraywithlid , drum, sterilizingcylindrical ( 275mmoiax132rnrn, ssasperis: ) , drumwithtapforstoringwater100ltr.plasticshouldbemadeupofvirginplasticgranuals ) , drycell / battery , dustbin ( ss ) big ( bestquality ) , ecgmachine , electricstrailiserfootopratedbig , electricventouse , electronicstrailiser6x8 , electronicstraliser10x12 , electronicstraliser8x10 , elementcarrier , elisareadercumwasher , emergencycrashcarttrolley , emergencycrashcarttrolley , emergencyresuscitationkit adult ( bestquality ) , emergencytrolley , endoexplorar , endometrialbiopsyset ( bestquality ) , endotrachealcatheter ( w / cuff, rubber ) , endotrachealintubationtubes , entnasalset ( smr, septoplasty, nasalendoscopicset ( 00&300 ) polypetcomy, dns, rhinoplasty ) ( bestquality ) , entoperationsetincludingheadlight, tonsils , episiotomyscissor , episiotomyscissor ( titanium ) , episiotomytray , esrstandwithtubes , examinationgloves , examinationinstrumentsset ( speculums, tonguedipressors, mirrors, bullslamp ) ( bestquality ) , examinationlampled , examinationtable , examinationtablewithmatress ( 72x24x3 ) ( iron ) , executivetable withpedestalandcredistal ( specificationshouldbeattachedintechnicalbidturms&condition ) ] , explorar , exuctivechairleather ( specificationshouldbeattachedintechnicalbidturms&condition ) wxh:61cmx90cmapprox, framematerialmetal. , f.b.spnd ( forophthalmic ) , fans , feedingequipments ( tubes, katoris&spoon ) , feedingtube , feedingtubesno8 , fireextinguisher , flashlight / torchbox typepre focused ( 4cell ) , floormoppingstick , flowmeterwithhumidifierbottle , fluorresceinstrip ( forophthalmic ) , foammattress ( •10cmsthick, 32 / 40densityfoammattresscoveredwithrexineclosedforplainbed. ) , foammattressforottable , focuslamp , focuslightled ( spotlight ) , foetoscope , foleyscatheter , foliscatheter24no , footoperatedsuctionapparatus , footstep , footstep ( 2step ) , forceps, backhaustowel, ( 130mm ( tungstencarbidetipantirustquality ) , forceps, hemostatic, halsteadsmosquito, straight, ( 125mrn ss ( tungstencarbidetipantirustquality ) , forceps, spongeholding, ( 228mm ( tungstencarbidetipantirustquality ) , forceps, uterinenelatonsolid tipone eye ( ( tungstencarbidetip ) , forceps, vulselium, duplaydoublecured, 280mm ss ( ( tungstencarbidetip ) , forcepsobstetric ( wrigleys, 280mm, stainlesssteel ( titanium ) , forcepsobstetric, wrigleys ( 280mrn, stainlesssteel ( tungstencarbidetip ) , fourdoorbookcasesteel ( specificationshouldbeattachedintechnicalbidturms&condition ) , fourdoorverticalfittingcabinetsteel ( specificationshouldbeattachedintechnicalbidturms&condition ) , fowlerbed ( bestquality ) withabssystem ( 72x36x19, 16gforhead&legside•finish:pretreated&epoxypowdercoated ) , fumigationmachine inputpower:220vac, 3.5amp, 50hz consistantparticlesizegeneration:5 15micronsvmd reach:20 30ftdistance&18 20ftheight. spacetreatment:upto7000cuft&evenlarger. nozzleassembly:nonrotatingvortexdesign, non , functionalrefrigerator. , g.i.operationset ( bestquality ) , gauzecuttingscissorstratight , gauzecuttingscissorstratight , gauzepiece ( roll ) , generalsterileproceduretrays , generalsterileproceduretrays , gic ( glassionomercement ) , glasspippette , glassrods , glassslides , glucometer , glucometer , glucometertestingstrips , glycosylatedhaemoglobinometer , gown / apron , gownsformothers , greenarmittage ( titanium ) , haemogobinometer , handrub , handtowels , hbtestmachinewithstrips ( standardmake ) , headboxforoxygen ( bestquality ) , headlight ( ordinary ) ( boyledavis ) , headlight ( ordinary ) ( boyledavis ) ( bestquality ) , heavydutygloves , hemoglobinometer ( 1.samplevolume<10ul2.totalhbconcentrationmeasurementrange0.25g / dl3.toimefortotalconcentrationmeasurement<5seconds4.shouldhaveerrorratelessthan5%5.cd / usfda / isoapproved6.automaticcorrectionofhb.7.200strip / cuvettemustbesuppliedwiththemeter8.shelflifeofcuvette / stripmustbe1year9.memoryfacilitydesired , highflow ( hfnc ) machine , highvaccumsuctionmachine , hospitalbed ( bestquality ) ( general ) , hospitalbed ( sshead&footsiderod ) ( specificationshouldbeattachedintechnicalbidturms&condition ) , hospitalworkerovercoat , hotairsterilizer ( oven ) digital construction: ovensaresturdy, withdoublewalledconstruction.innerchamberismadeofhighlypolishedstainlesssteel.outerchamberismadeofmildsteelsheetdulypre treatedinseventanksprocessforsurface , hpprinter3inone ( printer, scan&photocopy ) , hubcutter ( heavy ) , hubcutterandneedledestroyer , hubcuttermannual , hubcutterwithneedledestroyer ( electric ) , icepackbox , infantventilatorwithcompressor , infusionpump , insecticidetreatednets , insectisidetreatednet , instrumenttrolly ( bestquality ) , intensifyingscreenx ray , intercom ( 24extensions, expandableupto 32, micro controllerbasedspcspacedivisionmultiplexing, extensionloopresistance:600ohms, operatingtemperature:0cto45c, powerconsumption:max.100watts, operatingvoltage:220v10% ) , interdentalcleaningaid , intravenous ( setinbox ) , iucd ( 375, 380a ) , iucdkit , ivcannula ( 16, 18, 20, 22 ) , ivcannula ( 16, 18, 20, 22 ) , ivcannulae ( size20, 22or24, 26g ) , threeway , ivinfusionsets / dosiflow , ivset , ivset , ivstand , ivstandwithwheels , kellysheamostatforcepsstraight140mms , kellyspad ( forlabourandottable set ) , kellyspads , kellyspads , kidneytray , kidneytray , kidneytray ( 10 ) , kidneytray ( 8 ) , kidneytray ( big ) , kidneytray ( small ) , knife blade ( surgical, size11forminorsurgery ( ssantirustquality ) , knife blade ( surgical, size15forminorsurgery ( ssantirustquality ) , knife blade ( surgical, size22formajorsurgery ( ssantirustquality ) , knife handle ( surgicalforminor&majorsurgery#3 ( ssantirustquality ) , knife handle ( surgicalforminor&majorsurgery#4 ( ssantirustquality ) , kocchersforcep ( titanium ) , laboratoryautoclaves , labourtable , laparotomyset ( bestquality ) , laproscopysetforcholecystectomy , laptop / notebook ( intelcorei37thgen., operatingsystem:win10 ( hp / dell / lenovo ) +threeyearwarranty , laptop / notebook ( intelcorei57thgen., operatingsystem:win10 ( hp / dell / lenovo ) +threeyearwarranty , laptop / notebook ( intelcorei7, operatingsystem:windows10 ( hp / dell / lenovo ) +threeyearwarranty , laryngoscope , laryngoscopefibreopticent ( bestquality ) , laryngoscopefibreopticent ( bestquality ) , ledtv42’’ , ledtvforiec , leqqinqs , lpg cylinder , lpg stove , macintoshrubbersheetclothpastedpermtr.madeupofhiqualitynaturalrubber.doublefacecoloursheet.softandhighqualitybreakingandtearingstrength. , mackintosh , mackintosh , mackintoshsheet5meter , magillsforceps , markingcloth48 , mask neonatalsize ( 0 ) , mask neonatalsize ( 1 ) , masks , matsforyoga , matsforyoga , mattress6x3x4 , mattressforexaminationtable , measuringtape , measuringtape , measuringtape , measuringtape , medicinechest , medicinetrolley ( ss ) , mfs100biometric ( fingurescanner ) , mfstabbiometric ( completeset ) ( tab ) , microporetape , microporetape , microporetapes* , microtripset , midbackchair ( specificationshouldbeattachedintechnicalbidturms&condition ) , midbackrevolvingchair ( specificationshouldbeattachedintechnicalbidturms&condition ) , minilapkit , moppingstick , mosquitonet ( 6x4 ) nylon , mouthgag , mouthmirror , mouthmirror , mouthprop , mriscan , mucusextractor , mugs , multiparamonitorswithinfantandpediatricspo2probesandinfantandpediatricbpcuffs ( catalogrequired ) , murcuryballburnisher , murcuryballburnisher , mvaaspirator , n / 10hydrochloricacid , n20cylinderforboyles , nasogastrictube ( 8, 10, 12fg ) , nasogastrictubes ( sizes6, 8, 10, 16fr ) , nearvisionchart , nearvisionchart , nebuliser , nebuliser , shouldbelightweight, portableandcompact. , shouldhaveadustfilter. , shouldbeabletodeliveraflowrate=7lpm , shouldhaveairpressure=35psi. , shouldhaveacheckvalvetoprotectthedeviceagainstcontaminationdueto , backward , nebulizer , needledestroyerelectric , needleholder , needleholder, mayo, straight, narrowjaw ( 175mm ss ( tungstencarbidetipantirustquality ) , needles, suture, roundbodied, ( 3 / 8circleno.12 ) , needles, suturetriangularpoint, ( 7.3cm ) , needlespinalstainless ( setof4 ) , newbornthermometer , nibpwithallcuffsizes , nibulisyeradultwithmask , nibulisyerchildwithmask , nibulisyermaskforadult , nibulisyermaskforchild , nsvkitset ( ss ) , ntra osseousneedle , o.t.greenapproxcasmetclothfreesize , o.t.tablehydrolicss ( bestquality ) , o.tcapcotton , o.tcapdisposable , o.tmaskcotton , o.tmaskdisposable , officealmirahstorewellplain4selves ( specificationshouldbeattachedintechnicalbidturms&condition ) , officetable , officetable3*2onesidedrower ( bestquality ) , officetablegeneralsanmicatop ( 2.5x4 ) onesidethreedrower ( onesidethreedrower ) , officetablegeneralsanmicatop ( 2.5x5 ) bothsidethreedrower ( bothsidethreedrower ) , officetablesingalsidedrawer ( 4x2.25 ) ( specificationshouldbeattachedintechnicalbidturms&condition ) , officetablewood&steel ( 5x3 ) ( specificationshouldbeattachedintechnicalbidturms&condition ) , onlineups1kvawith60minutebackup , ophthalmoscope ( forophthalmic ) , opthalmoscope 1.shouldberechargeablebatterywithcharger / mainsoperated. 2.shouldhavehalogen / ledlightsource 3.shouldhavered freefilters 4.shouldhavesmallandlargespotsizes, fixationtargets, slitaperture, hemi spotandcobaltblu , oral / nasopharyngealairways ( differentped.sizes ) , oralairway , oropharyngealairway ( 000 4guydelsize ) , otoscope 1.shouldbeaconvenientpockettypeotoscope. 2.shouldbeprovidedwithahalogenlightsource. 3.shouldbeabletodetachtheotoscopehead. 4.shouldprovidenoreflectionsandobstructions. 5.shouldprovidedetachableaccessoriesofvar , outletforcep ( titanium ) , overbedtable , ovumforceps , oxygenconcentetor 10 lpm , oxygencylinder10ltr.mo2withvalve , oxygencylinderdtype , oxygencylinderwithtrolly , oxygencylinderwithtrolybtype , oxygendeliverydevices:nasalprongs, simplefacemasks, non rebreathingmasks, oxygenhood , oxygenflowmeter , oxygenflowmeter ( bestquality ) , oxygenhood ( largesize ) , oxygenhood ( neonatal ) , oxygenhood ( neonatal ) , oxygenmask , oxygenmaskandtubings , oxygennasalcannulaneonatalandinfant , oxygennasalcannulapediatric , oxygennasalcannulapediatric , oxygenset ( maskwithtubing ) , p.v.tray ( bestquality ) , p.v.tray ( bestquality ) , paediatricstethoscope ( bestquality ) , paedstethoscope , partographincasesheets , pasystem ( •recessedmount ( ceiling ) , surfacemount, columnand / orhornspeakers, 12wattswithinbuilttransformer, woodenbody, pressurelevel97db, range200 15000hz, ratedvoltage100v, impedence833amplifierratedvoltageoutput100v, 150watts, mu , patientshousecoatforfemale , patientspaiiarna ( formale ) shirt , peadiatriccot , peakexpiritoryflowmeter ( bestquality ) , peakexpiritoryflowmeter ( bestquality ) , pediatricambubagswithdifferentsizemask , pediatricambubagswithdifferentsizemasks , pediatricinfusionset / pediadripset , pediatricinvasiveventilatorwithcompressor , pediatriclaryngoscope ( curvedandstraightblades ) , pediatricnrbmmasks, simplefacemasksandnasalcannulaofallsizes , perenealsheetsforot , phototherapyunit 1 ledphototherapywithintensityupto6 50microwatts / nm / cumm / mwatt, adjustable intensity. 2 .heightadjustableandtiltablelightunit. 3 digitaltime totallerofledusagetime. 4 stainlesssteeltray. 5–provisionfordoublesurf , phototherephyunitsinglesurface ( standmodel ) , phototherephyunitsinglesurfaceled ( withledbuld ) , pillow , pillowcover , pillowcoverbestquality ( 16x26 ) , pillowsenthatic1kgsize14x24 , plainforceps , plainforceps ( 8 ( tungstencarbidetipantirustquality ) , plasticappron , plasticapprondisposible , plasticchair ( brandedcompany ) ( witharm ) , portableo.t.light ( absdoom19singlereflecterpolycarbonate ) , portableo.t.lightled , portableoxygencylinder ( bestquality ) , portablesuction , portablesuction , portablex ray , povidone iodineforlocalapplication, spiritswabs , ppiucdforcep , ppiucdforcepss , ppiucdinsertionforceps , printerallone ( print, scan, copy, fax ) ( hp ) +threeyearwarranty , printerhp ( laserjet ) resolution600x600speedinppm18 ( a4size ) ( hp ) +threeyearwarranty , procedurespotlight ( portable ) , procedurespotlight ( portable ) , proctoscopysetadult ( bestquality ) , proctoscopysetpeadiartric ( bestquality ) , pulseoxymeter , pulseoxymeter ( multipara ) ( withinstallation&1yrs.warrenty ) ( 8.5tftdisplaywithecg ) , pulseoxymeter, pulsespo2 , pulseoxymeteradult ( tabletop ) built inrechargeableli polymerbatteryforuninterruptedmonitoring compactandflexibleappearance, easyforcarryingandbesuitableforindoorandoutdoor ( inambulance ) monitoring withuser friendlyinterface displ , pulseoxymeterbaby ( fingertip ) type: bloodpressuremonitor powersupply: battery size: 57 ( l ) *33 ( w ) *32 ( h ) mm , rack / tableforkeepingtrays, fluids , rackforkeepingsleepers / shoecoversoutsidelabourroom , radiantwarmer , radiantwarmer / tablewithsiderails , radientbabywarmer , refrigerator ( lg, whirpool ) , regionalanaesthesiadevices, epiduralset , revolvingstool ( wihhcutionhydrolicfullyss ) , rightangelartry4 , rightangelartry6 , rodsfordoorcurtains ( perrunningfit ) size4ftapprox, typealumunium / ss. , roundslit ( hole ) towel , rubber / plasticsheet ( 4setsof2.5mx2=20meterforeachfacility ) , rubber / plasticshutting , rubibrizedcorematress ( 6x3x4withrackcincover ) , sahlishaemoglobinometer , salinstandwithwheelwithfourhook ( ss ) , sanitarynapkins , sanitarynapkins , saucepanwithlid , saucepanwithlid , saucepanwithlid ( ss ) 2liter, lid 18cms, , scannerflatbeta4size , scissor, gauze, straight ( 230rnrn, ss ( titanium ) , scissoroperatingstraight ( 230mm ( tungstencarbidetipantirustquality ) , scissors , scissors , scissors, operatingcurvedmayo bluntpointed ( 170mm ( tungstencarbidetipantirustquality ) , screenseperatorwithstand , selfilluminatedretinoscope ( forophthalmic ) , semifowlerbed ( bestquality ) withabssystem ( 72x36x19, 16gforhead&legside•finish:pretreated&epoxypowdercoated ) , setoftablewith4chairs ( neelkamal, cello, supreme ) , sharpandbluntcurette , sheetsfordryingandwrappingbaby , sheetsfordryingandwrappingbaby , shoecover , sidelocker , sidelocker , sidelockermadeupofcrcapipe / sheetswithsstop, providedwithonestorageboxandonedrawer, crctabularleg, twoismountedonpvcstupmandtwoon5cmscastors, pretreatedandepoxypowdercoatedandapproxdimension:405mml*405mmw*810mmh. , simko21noguage ( forophthalmic ) , simsretractor / depressor , simsspeculumveginaldoubleendedissmediam , slidedryingrack , slippersperpair ( rubber ) , slitlampbiomicroscope , snellenvisionchart , snellenvisionchart , soap , sound, uterine, simpson ( 300mmwith200mmgraduations ( ssantirustquality ) , spacersandmasks , specimencollectionbottle , speculum , speculum, vaginal, simsdouble ended#3 ( ssantirustquality ) , speculumvaginalbi valve ( cusco medium, ( ssantirustquality ) , spiritlamp , spiritlamp , spirometer , spongeholdingforceps / cheatleforceps , spoonexcavator , sstraywithcover , sstraywithcover , sstraywithcover , stadiometer ( heightmeasurement ) , staticvaccumextractor ( bestquality ) , steelcup board , steelrackiron ( 78x36x15 ) ( 4selves ) , sterilesurgicalgloves , sterileswabs , stethoscope , stethoscope ( bestquality ) , stomachwashequipment ( bestquality ) , stool , stoolfixed ( iron ) , straightcocker ( titanium ) , straightneedle , stretcherontrolley , streturetrolly ( 85x22x32powercoatedwithmatress ) , suctionmachinewithpump: powersupply:230 240v / 50hz vacuumcapacity:18litres / mim maximumdepression: 75kpa ( 563mmhg ) vacuumiscreatedbyaplasticpistonandcylindersystem, withfourvacuum creatingmodules ( , suctionmachinefootoperated ( powdercoatedm.s.chassis. noiselevelofsuctionapparatusfromis50db+ / 03db. leakagecurrentofsuctionunitsislessthan84ua. electricalrequirement–220~230v, 50hz, 1phase. idealformtp / medical / surgic , suctionmachineforot , suctiontube ( 225rnrn, ss ) , sunctionmachineelectric / footoperatedsuctionapparatus , sunctionmachineelectricapparatus , suringneedlecurved , sutureneedlecurved , sutureneedlestraight 10 , suturingthread , suturingtraywithlidss small , syringe, anesthetic ( control5mlluermountglass ) , syringepump , syringes1ml, 2ml, 5ml, 10ml , tableclothpermeter , tallquisthbscale , tcdccountapparatus , telephone ( set ) , temporaryfillingmaterial , testtubeholders , testtubeholdingclamp , testtuberack , testtuberack , testtubes , testtubestands , tharmometer , thermometerrectal , thermometers ( digital ) , thermometers ( para ) , thomassplint ( bestquality ) , threeseatercrome ( ss ) , threeseatercromewithcution ( ss ) , threeseateriron ( witharm ) , threesheetercromreparining , thumbforceps , thumbnontoothedforceps , timerstopwatch , tissueforcep10 ( titanium ) , tissueforcep6 ( titanium ) , tissueforcep8 ( titanium ) , tokendisplaysystem ( tokendispenserwithissuekeys, thermalprinter, callingunitwithkeysforcallingnexttokennumber, tokendisplayunitforshowingtokenoncabinoutdoor, centralleddisplayunitforshowingtokennumberwithcabinnumberconne , tonguedepressor , tonguedepressor , tonguedepressors , toothedforceps , toothedforceps , toothforceps ( 8 ( tungstencarbidetipantirustquality ) , torch , torch / torchbox typepre focused ( 4cell ) , towel , towelsbig ( 60x30 ) ( softcotton ) , towelssmall ( 15x30 ) ( softcotton ) , tracheostomyset ( bestquality ) , trayinstrument / dressingwithcover , trialbox, trialframe, lens, metalrim ( 205x6cye ) ( completeset ( forophthalmic ) , trialframeadult ( forophthalmic ) , trialframechildren ( forophthalmic ) , tubesconnectingforen ( bestquality ) , tuningfork , tuningfork ( bestquality ) , tuningfork. , twizer , twoseatercrome ( ss ) , ultrahighspeedlaboratarycentrifuge ( specificationsattached ) , ups1kvdoublebattary , uretheraldilatorset ( bestquality ) , urinalfemale , urinalmale , urinebags , urinebags , urinebags* , uterineelevator ( ranathlbod ) ( ss ) , uterinesound ( foriucd ) , uteruscollection ( sisteruandmamau ) , vaccinecarrier , vaccusucksuctiontube ( titanium ) ( forsuctionmachine ) , vacuumextractormetal ( bestquality ) , vaginalhysterectomyset ( bestquality ) , valveinhaler ( chrome platedbrass, y shape ) , varicoseveinset ( bestquality ) , varicoseveinset ( bestquality ) , vascularclampset ( bestquality ) , vipchairwithcuition ( witharm ) , vulcellum stainlesssteel size:10inch colour:silver shape:curved , vulsellumuterineforcepscurved25.5cm , wallclockwithsecondhand , wallclockwithsecondhand , wastedisposal bin / drums , wastedisposalcolourcodedbuckets ( black, red, yellow, blue ) ( neelkamal, cello, suprem ) , wastedisposalcolourcodedbucketsswinebing30ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , wastedisposalcolourcodedbucketsswinebing60ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , wastedisposalcolourcodedbucketsswinebing80ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) , wastedisposalcolourcodedpolybags ( black, red, yellow, blue ) , wastedisposal trolley ( ss ) , wastedisposaltwinbucketforhypochloritesolution / bleach ( big ) , watercoolerwithpurifire ( 120ltr.storagecapacity, 80ltr.coolingcapacity, stainlesssteel, twotap , watercoolerwithpurifire ( 40ltr.storagecapacity, 20ltr.coolingcapacity, stainlesssteel, twotap , watercoolerwithpurifire ( 80ltr.storagecapacity, 60ltr.coolingcapacity, stainlesssteel, twotap , waterreceptacle , weighingmachine ( adult ) digital , weighingmachine ( infant ) digital , weighingmachineadult ( bestquality ) , weighingmachinebabyelectronic ( 5kgcapicitywithfibertray ) , weighingscalesforinfantsandchildren , westdisposalcolourcoatedpolybeg ( black, red, yellow, bule ) ( perkg. ) , wheelchair , wheelchair ( ss ) folding , whitewrightingboard , windowscreens , windowscreens , woodenspatula , woodenspatula , workstationsmemodel ( singleunit ) ( specificationshouldbeattachedintechnicalbidturms&condition ) , xeroxmachine ( minimumcopyingspeed ( epm ) :25 / 25 ) ( specificationshouldbeattachedintechnicalbidturms&condition ) , x rayfilmprocessingtank13.5lit. , x rayfilmprocessingtank9lit. , x rayviewbox , x rayviewbox ( doubblefilessbody ) , zincphosphatecement...

Health Department - Jharkhand

29071579 rate contract for machine equipments and cansumables rate contract for machine equipments and cansumables , items : , 02cylinderforboyles , 10nasogastrictubesno , 200wattbulb , 2mirrorcronioscope(forophthalmic) , 32lcdtelivision , 3foldrecliningbedmanually , 3seaterchairsforwaitingarea , 5lplastictubforkeepingchlorinesolution , 90dlens(forophthalmic) , abcdrypowder2kg. , abcdrypowder4kg. , abcdrypowder6kg. , abdominalhysterectomyset(bestquality) , abdominalretractors , abdominalsheetbig(bestquality) , abdominalsheetbig(bestquality) , abdominalsheetsmall(bestquality) , ac(airconditioner)1.starrating 3,2.capacity1.5ton,3.splitac , adultstethoscope , adultstethoscope , aircondisnor(1.5ton5starwithstabelizer) , aircondisnor(1ton5starwithstabelizer) , airway , airway0,1,2,3,4 adult , airwayguedelorberman,autoclavablerubber , airwaypeadiartric , alisforcep10(titanium) , alisforcep6(titanium) , alisforcep8(titanium) , all inonedesktopcomputer(withpreloaded)intelcorei5,operatingsystem:microsoftwindows10,4gbram,1tbhdd,dvdwriter,20led(lenovo/hp/dell)+threeyearwarranty(lenovo/hp/dell)+threeyearwarranty , allisforceps , allisforceps , alltypesofdentalextractionforceps(eachset3sets minimumrequiredwhichincludesupperandlowermolarsandanteriorforceps. , almira , amalgamcarrierinsilver , amalgamcarrierinsliver , ambubag , ambubag(baby)(silicon) , ambubagsiliconadult , amputationset(bestquality) , anaesthesiaworkstation(includeanaesthesiamachinewithvaporiser,ventilator,monitor) , anteriorvaginalwallretractorstainless((ssantirustquality) , applanationtonometer , arteryforceps , arteryforceps(curved140rnrn(titanium) , arteryforceps(curved180mm(titanium) , arteryforceps(straight140rnrn(titanium) , arteryforceps(straight180mm(titanium) , autoclave(elec.)dubbledrum4x10 , autoclave(elec.)dubbledrum6x12 , autoclavemachine , automatedautorefstand(forophthalmic) , automatedexternaldefabrillator(desirable) , avretractor1.stainlesssteel2.doubleended,serrated3.rustfree4.sturdyconstruction5.accuratedimensions , b.p.instrumentswithstand , babyblankets , babyforcepsss(big–curve) , babyforcepsss(big–straight) , babyforcepsss(big–straight) , babyforcepsss(small–curve) , babyforcepsss(small–straight) , babyincubators(bestquality) , babytowel(24x36)(softcotton) , babytray(ss,ceinbuild) , babyweighingmachinedigital , babyweighingscale , backrest , bag,reathing,selfinflating(anti staticrubber,setof4) , basin , basin825mlsswithwheels , basinassorted(ss) , basinstandassorted(ss)(2basintype) , bedpan(ss) , beds(manualsemi fowlerbedswithcastors) , bedsheetmulticolourcottonsize60x90longclothbestqualitycolour. , bedsheets , bedsidechair(stypoewitharms) , bedsidelocker(bestquality) , bedsidelocker(fullyss)(bestquality) , bedsidescreen4folds , bedsidescreenwithcloth(1roundpipewithwheel) , bedssemi recilining , bedwithmatress , besinboul(withstand) , blankets , blankets , blanketweight2kgredcoloursize60x90 , bloodcollectionmonitor , bloodgasmachine , bloodtransfusionset(bestquality) , boilerorautoclave , bookselves(66x36x15)(4selves) , bowl,metalsponge(600rnl,ref.is:5782) , bowlforantisepticsolution , bowlforantisepticsolution , boylesmachine(specificationsattached) , boylesmachine,braincircuit,jr , boylesmachinewithventilator(ansthesiaventilator) , bpapparatusdialtype , bpapparatusled , bpapparatusmerucry , bpapparatusstandmodel , bpappratusdigital , bphandle 3/4no(titanium) , breathingtubes,hoses,connectorsforitem1,(anti static) , bubblecpapmachinewithcompressor , bucketbig , bucketforkeeping1%chlorinesolution(forspillage) , bucketforkeeping1%chlorinesolution(forspillage) , buckets , bucketsmall , caps , cardiacbed(specificationshouldbeattachedintechnicalbidturms&condition) , carver(dimond) , carver(dimond) , case5heetholderswithclip(ss) , catheterurethral,rubber,foleys14er(14er) , cctv(32dvr) (32dvr:processorhighperformanceembeddedmicroprocessor,operatingsystemembeddedlinux,userinterfacegui,videoinput32channel,bnc,videooutput1hdmi,1vga,videostandardanalog:32ch.@1080n(1~15fps),24ch.@1080n,16ch.@10 , cdplayer(hometheaterwith5soundbox) , cervicalbiopsyset(bestquality) , chair , chairsforwaitingarea(threeinoneset) , cheatleforceps , cheatlesforceps , cheststandforx reyunit , chlorinetablets , clampintestinal,doyen(curved225mrn,ss) , clampintestinal,doyen(straight225rnrn,ss) , cleaningmaterialanddetergents , clothsfornewborn(disposablediapers,cap&socks) , co2fireextinguisher2kg. , co2fireextinguisher4.5kg. , co2fireextinguisher6.5kg. , co2fireextinguisher9kg. , colourcodedbins black , colourcodedbins blue , colourcodedbins red , colourcodedbins yellow , colourcodedbins yellow,redandblack(bigandsmall) , colourcodedplasticbags(yellow,red,blueandblack) , colposcope(bestquality) , compactor , computertablefullywooden(specificationshouldbeattachedintechnicalbidturms&condition) , condombox , conjunctivalscisser(forophthalmic) , connectorsetofsixforen(bestquality) , convexarraytranducerc343ua(forultrasoundmachine) , cordcuttingscissor(ss(titanium) , cordcuttingscissor/surgicalbladeforcuttingcord , cordcuttingscissor/surgicalbladeforcuttingcord , cornealscisser(forophthalmic) , cot , cottondari12x15 , cottondari12x158 , cottonfoldingstrecherforambulance(bestquality) , cottonswab(roll) , countingchamber , craniotomy(bestquality) , crashcard(ss) , ctscan , curette,uterine,simsblunts(titanium) , curtains , curvecocker(titanium) , cusco’s/gravesspeculumvaginalbi valvelarge , cusco’s/gravesspeculumvaginalbi valvemedium , cusco’s/gravesspeculumvaginalbi valvesmall, , cuscoss/gravesspeculumvaginal(large) , cuscoss/gravesspeculumvaginal(medium) , cuscoss/gravesspeculumvaginal(small) , cuscosspeculum(large) , cuscosspeculum(medium) , dariwithroomsize. , defibrillator , deliverytable(72x24x3)powercoated , deliverytray , deliverytroly , dentalchair1.shouldbeelectricallyoperatedwithzeroprogram.2.shouldhaveaswitchoperatedoperatinglightwithminimumtwostepsof intensitycontrol.3.shouldhaveautowaterconnectionforspittoonandtumblerwithautofilling sensor.4.s , dentalprobe , dentalprobe , dentalx rayfilm , designatednewborntraysswithlid , designatednewborntraysswithlid , desktopcomputer(withpreloadedoperatingsystem)intelcorei37thgen.,operatingsystem:microsoftwindows10,4gbram,1tbhdd,dvdwriter,18.5led(lenovo/hp/dell)+threeyearwarranty , desktopcomputer(withpreloadedoperatingsystem)intelcorei57thgen.,operatingsystem:microsoftwindows10,4gbram,1tbhdd,dvdwriter,18.5led(lenovo/hp/dell)+threeyearwarranty , dextrose10%,25%,50% , diettrolley stainlesssteel , digitalhemoglobinometer , digitalincubator(specificationsattached) , digitalthermometer , digitalthermometer , digitalweighingmachine(adult)(1.capacity:160kg2.accuracy:100g3.plattersize:350mmx300mm(tolerance+/ 10%)4.thescaleshouldbemadeupofheavyduty.castironstructureplatformwithpowdercoatedframes.5.theelectronicadult , digitalweighingmachine(child) whogmp,ce,iso9001,iso13485 , digitalxreyfilm(konika)10x12 , digitalxreyfilm(konika)12x12 , digitalxreyfilm(konika)12x15 , digitalxreyfilm(konika)8x10 , dilar(forophthalmic) , dilator,uterine,double endedhegar(setof5(ssantirustquality) , disposablecordclamp , disposabledeliverykitfordeliveringhivpatients(emergency) , disposabledeliverykitfordeliveringhivpatients(emergency) , disposabledeliverykitfornormaldelivery , disposableneedle26g(forophthalmic) , disposableneedles22,23,26g , doctorappronwhitefreesize(halfslaveterrycot) , doctorcoatfreesizefull , doctorcoatfreesizehalf , doctorsovercoat , domesticrefrigetor190ltr. , doorcurtaincotton48 , doorcurtainsenthatic48 , doppler , dossimeter , drawsheet , dressingdrumbig12x15 , dressingdrumsmall9x9 , dressingdrumwithlid , dressingtraywithlid , drum,sterilizingcylindrical(275mmoiax132rnrn,ssasperis:) , drumwithtapforstoringwater100ltr.plasticshouldbemadeupofvirginplasticgranuals) , drycell/battery , dustbin(ss)big(bestquality) , ecgmachine , electricstrailiserfootopratedbig , electricventouse , electronicstrailiser6x8 , electronicstraliser10x12 , electronicstraliser8x10 , elementcarrier , elisareadercumwasher , emergencycrashcarttrolley , emergencycrashcarttrolley , emergencyresuscitationkit adult(bestquality) , emergencytrolley , endoexplorar , endometrialbiopsyset(bestquality) , endotrachealcatheter(w/cuff,rubber) , endotrachealintubationtubes , entnasalset(smr,septoplasty,nasalendoscopicset(00&300)polypetcomy,dns,rhinoplasty)(bestquality) , entoperationsetincludingheadlight,tonsils , episiotomyscissor , episiotomyscissor(titanium) , episiotomytray , esrstandwithtubes , examinationgloves , examinationinstrumentsset(speculums,tonguedipressors,mirrors,bullslamp)(bestquality) , examinationlampled , examinationtable , examinationtablewithmatress(72x24x3)(iron) , executivetable withpedestalandcredistal(specificationshouldbeattachedintechnicalbidturms&condition)] , explorar , exuctivechairleather(specificationshouldbeattachedintechnicalbidturms&condition)wxh:61cmx90cmapprox,framematerialmetal. , f.b.spnd(forophthalmic) , fans , feedingequipments(tubes,katoris&spoon) , feedingtube , feedingtubesno8 , fireextinguisher , flashlight/torchbox typepre focused(4cell) , floormoppingstick , flowmeterwithhumidifierbottle , fluorresceinstrip(forophthalmic) , foammattress(•10cmsthick,32/40densityfoammattresscoveredwithrexineclosedforplainbed.) , foammattressforottable , focuslamp , focuslightled(spotlight) , foetoscope , foleyscatheter , foliscatheter24no , footoperatedsuctionapparatus , footstep , footstep(2step) , forceps,backhaustowel,(130mm(tungstencarbidetipantirustquality) , forceps,hemostatic,halsteadsmosquito,straight,(125mrn ss(tungstencarbidetipantirustquality) , forceps,spongeholding,(228mm(tungstencarbidetipantirustquality) , forceps,uterinenelatonsolid tipone eye((tungstencarbidetip) , forceps,vulselium,duplaydoublecured,280mm ss((tungstencarbidetip) , forcepsobstetric(wrigleys,280mm,stainlesssteel(titanium) , forcepsobstetric,wrigleys(280mrn,stainlesssteel(tungstencarbidetip) , fourdoorbookcasesteel(specificationshouldbeattachedintechnicalbidturms&condition) , fourdoorverticalfittingcabinetsteel(specificationshouldbeattachedintechnicalbidturms&condition) , fowlerbed(bestquality)withabssystem(72x36x19,16gforhead&legside•finish:pretreated&epoxypowdercoated) , fumigationmachine inputpower:220vac,3.5amp,50hzconsistantparticlesizegeneration:5 15micronsvmdreach:20 30ftdistance&18 20ftheight.spacetreatment:upto7000cuft&evenlarger.nozzleassembly:nonrotatingvortexdesign,non , functionalrefrigerator. , g.i.operationset(bestquality) , gauzecuttingscissorstratight , gauzecuttingscissorstratight , gauzepiece(roll) , generalsterileproceduretrays , generalsterileproceduretrays , gic(glassionomercement) , glasspippette , glassrods , glassslides , glucometer , glucometer , glucometertestingstrips , glycosylatedhaemoglobinometer , gown/apron , gownsformothers , greenarmittage(titanium) , haemogobinometer , handrub , handtowels , hbtestmachinewithstrips(standardmake) , headboxforoxygen(bestquality) , headlight(ordinary)(boyledavis) , headlight(ordinary)(boyledavis)(bestquality) , heavydutygloves , hemoglobinometer(1.samplevolume<10ul2.totalhbconcentrationmeasurementrange0.25g/dl3.toimefortotalconcentrationmeasurement<5seconds4.shouldhaveerrorratelessthan5%5.cd/usfda/isoapproved6.automaticcorrectionofhb.7.200strip/cuvettemustbesuppliedwiththemeter8.shelflifeofcuvette/stripmustbe1year9.memoryfacilitydesired , highflow(hfnc)machine , highvaccumsuctionmachine , hospitalbed(bestquality)(general) , hospitalbed(sshead&footsiderod)(specificationshouldbeattachedintechnicalbidturms&condition) , hospitalworkerovercoat , hotairsterilizer(oven) digitalconstruction:ovensaresturdy,withdoublewalledconstruction.innerchamberismadeofhighlypolishedstainlesssteel.outerchamberismadeofmildsteelsheetdulypre treatedinseventanksprocessforsurface , hpprinter3inone(printer,scan&photocopy) , hubcutter(heavy) , hubcutterandneedledestroyer , hubcuttermannual , hubcutterwithneedledestroyer(electric) , icepackbox , infantventilatorwithcompressor , infusionpump , insecticidetreatednets , insectisidetreatednet , instrumenttrolly(bestquality) , intensifyingscreenx ray , intercom (24extensions,expandableupto 32,micro controllerbasedspcspacedivisionmultiplexing,extensionloopresistance:600ohms,operatingtemperature:0cto45c,powerconsumption:max.100watts,operatingvoltage:220v10%) , interdentalcleaningaid , intravenous(setinbox) , iucd(375,380a) , iucdkit , ivcannula(16,18,20,22) , ivcannula(16,18,20,22) , ivcannulae(size20,22or24,26g),threeway , ivinfusionsets/dosiflow , ivset , ivset , ivstand , ivstandwithwheels , kellysheamostatforcepsstraight140mms , kellyspad(forlabourandottable set) , kellyspads , kellyspads , kidneytray , kidneytray , kidneytray(10) , kidneytray(8) , kidneytray(big) , kidneytray(small) , knife blade(surgical,size11forminorsurgery(ssantirustquality) , knife blade(surgical,size15forminorsurgery(ssantirustquality) , knife blade(surgical,size22formajorsurgery(ssantirustquality) , knife handle(surgicalforminor&majorsurgery#3(ssantirustquality) , knife handle(surgicalforminor&majorsurgery#4(ssantirustquality) , kocchersforcep(titanium) , laboratoryautoclaves , labourtable , laparotomyset(bestquality) , laproscopysetforcholecystectomy , laptop/notebook(intelcorei37thgen.,operatingsystem:win10(hp/dell/lenovo)+threeyearwarranty , laptop/notebook(intelcorei57thgen.,operatingsystem:win10(hp/dell/lenovo)+threeyearwarranty , laptop/notebook(intelcorei7,operatingsystem:windows10(hp/dell/lenovo)+threeyearwarranty , laryngoscope , laryngoscopefibreopticent(bestquality) , laryngoscopefibreopticent(bestquality) , ledtv42’’ , ledtvforiec , leqqinqs , lpg cylinder , lpg stove , macintoshrubbersheetclothpastedpermtr.madeupofhiqualitynaturalrubber.doublefacecoloursheet.softandhighqualitybreakingandtearingstrength. , mackintosh , mackintosh , mackintoshsheet5meter , magillsforceps , markingcloth48 , mask neonatalsize(0) , mask neonatalsize(1) , masks , matsforyoga , matsforyoga , mattress6x3x4 , mattressforexaminationtable , measuringtape , measuringtape , measuringtape , measuringtape , medicinechest , medicinetrolley(ss) , mfs100biometric(fingurescanner) , mfstabbiometric(completeset)(tab) , microporetape , microporetape , microporetapes* , microtripset , midbackchair(specificationshouldbeattachedintechnicalbidturms&condition) , midbackrevolvingchair(specificationshouldbeattachedintechnicalbidturms&condition) , minilapkit , moppingstick , mosquitonet(6x4)nylon , mouthgag , mouthmirror , mouthmirror , mouthprop , mriscan , mucusextractor , mugs , multiparamonitorswithinfantandpediatricspo2probesandinfantandpediatricbpcuffs(catalogrequired) , murcuryballburnisher , murcuryballburnisher , mvaaspirator , n/10hydrochloricacid , n20cylinderforboyles , nasogastrictube(8,10,12fg) , nasogastrictubes(sizes6,8,10,16fr) , nearvisionchart , nearvisionchart , nebuliser , nebuliser , shouldbelightweight,portableandcompact. , shouldhaveadustfilter. , shouldbeabletodeliveraflowrate=7lpm , shouldhaveairpressure=35psi. , shouldhaveacheckvalvetoprotectthedeviceagainstcontaminationdueto , backward , nebulizer , needledestroyerelectric , needleholder , needleholder,mayo,straight,narrowjaw(175mm ss(tungstencarbidetipantirustquality) , needles,suture,roundbodied,(3/8circleno.12) , needles,suturetriangularpoint,(7.3cm) , needlespinalstainless(setof4) , newbornthermometer , nibpwithallcuffsizes , nibulisyeradultwithmask , nibulisyerchildwithmask , nibulisyermaskforadult , nibulisyermaskforchild , nsvkitset(ss) , ntra osseousneedle , o.t.greenapproxcasmetclothfreesize , o.t.tablehydrolicss(bestquality) , o.tcapcotton , o.tcapdisposable , o.tmaskcotton , o.tmaskdisposable , officealmirahstorewellplain4selves(specificationshouldbeattachedintechnicalbidturms&condition) , officetable , officetable3*2onesidedrower(bestquality) , officetablegeneralsanmicatop(2.5x4)onesidethreedrower(onesidethreedrower) , officetablegeneralsanmicatop(2.5x5)bothsidethreedrower(bothsidethreedrower) , officetablesingalsidedrawer(4x2.25)(specificationshouldbeattachedintechnicalbidturms&condition) , officetablewood&steel(5x3)(specificationshouldbeattachedintechnicalbidturms&condition) , onlineups1kvawith60minutebackup , ophthalmoscope(forophthalmic) , opthalmoscope1.shouldberechargeablebatterywithcharger/mainsoperated.2.shouldhavehalogen/ledlightsource3.shouldhavered freefilters4.shouldhavesmallandlargespotsizes,fixationtargets,slitaperture,hemi spotandcobaltblu , oral/nasopharyngealairways(differentped.sizes) , oralairway , oropharyngealairway(000 4guydelsize) , otoscope1.shouldbeaconvenientpockettypeotoscope.2.shouldbeprovidedwithahalogenlightsource.3.shouldbeabletodetachtheotoscopehead.4.shouldprovidenoreflectionsandobstructions.5.shouldprovidedetachableaccessoriesofvar , outletforcep(titanium) , overbedtable , ovumforceps , oxygenconcentetor 10 lpm , oxygencylinder10ltr.mo2withvalve , oxygencylinderdtype , oxygencylinderwithtrolly , oxygencylinderwithtrolybtype , oxygendeliverydevices:nasalprongs,simplefacemasks,non rebreathingmasks,oxygenhood , oxygenflowmeter , oxygenflowmeter(bestquality) , oxygenhood(largesize) , oxygenhood(neonatal) , oxygenhood(neonatal) , oxygenmask , oxygenmaskandtubings , oxygennasalcannulaneonatalandinfant , oxygennasalcannulapediatric , oxygennasalcannulapediatric , oxygenset(maskwithtubing) , p.v.tray(bestquality) , p.v.tray(bestquality) , paediatricstethoscope(bestquality) , paedstethoscope , partographincasesheets , pasystem(•recessedmount(ceiling),surfacemount,columnand/orhornspeakers,12wattswithinbuilttransformer,woodenbody,pressurelevel97db,range200 15000hz,ratedvoltage100v,impedence833amplifierratedvoltageoutput100v,150watts,mu , patientshousecoatforfemale , patientspaiiarna(formale)shirt , peadiatriccot , peakexpiritoryflowmeter(bestquality) , peakexpiritoryflowmeter(bestquality) , pediatricambubagswithdifferentsizemask , pediatricambubagswithdifferentsizemasks , pediatricinfusionset/pediadripset , pediatricinvasiveventilatorwithcompressor , pediatriclaryngoscope(curvedandstraightblades) , pediatricnrbmmasks,simplefacemasksandnasalcannulaofallsizes , perenealsheetsforot , phototherapyunit1 ledphototherapywithintensityupto6 50microwatts/nm/cumm/mwatt,adjustable intensity.2 .heightadjustableandtiltablelightunit.3 digitaltime totallerofledusagetime.4 stainlesssteeltray.5–provisionfordoublesurf , phototherephyunitsinglesurface(standmodel) , phototherephyunitsinglesurfaceled(withledbuld) , pillow , pillowcover , pillowcoverbestquality(16x26) , pillowsenthatic1kgsize14x24 , plainforceps , plainforceps(8(tungstencarbidetipantirustquality) , plasticappron , plasticapprondisposible , plasticchair(brandedcompany)(witharm) , portableo.t.light(absdoom19singlereflecterpolycarbonate) , portableo.t.lightled , portableoxygencylinder(bestquality) , portablesuction , portablesuction , portablex ray , povidone iodineforlocalapplication,spiritswabs , ppiucdforcep , ppiucdforcepss , ppiucdinsertionforceps , printerallone(print,scan,copy,fax)(hp)+threeyearwarranty , printerhp(laserjet)resolution600x600speedinppm18(a4size)(hp)+threeyearwarranty , procedurespotlight(portable) , procedurespotlight(portable) , proctoscopysetadult(bestquality) , proctoscopysetpeadiartric(bestquality) , pulseoxymeter , pulseoxymeter(multipara)(withinstallation&1yrs.warrenty)(8.5tftdisplaywithecg) , pulseoxymeter,pulsespo2 , pulseoxymeteradult(tabletop)built inrechargeableli polymerbatteryforuninterruptedmonitoring compactandflexibleappearance,easyforcarryingandbesuitableforindoorandoutdoor(inambulance)monitoring withuser friendlyinterface displ , pulseoxymeterbaby(fingertip) type: bloodpressuremonitorpowersupply: batterysize: 57(l)*33(w)*32(h)mm , rack/tableforkeepingtrays,fluids , rackforkeepingsleepers/shoecoversoutsidelabourroom , radiantwarmer , radiantwarmer/tablewithsiderails , radientbabywarmer , refrigerator(lg,whirpool) , regionalanaesthesiadevices,epiduralset , revolvingstool(wihhcutionhydrolicfullyss) , rightangelartry4 , rightangelartry6 , rodsfordoorcurtains(perrunningfit)size4ftapprox,typealumunium/ss. , roundslit(hole)towel , rubber/plasticsheet(4setsof2.5mx2=20meterforeachfacility) , rubber/plasticshutting , rubibrizedcorematress(6x3x4withrackcincover) , sahlishaemoglobinometer , salinstandwithwheelwithfourhook(ss) , sanitarynapkins , sanitarynapkins , saucepanwithlid , saucepanwithlid , saucepanwithlid(ss)2liter,lid 18cms, , scannerflatbeta4size , scissor,gauze,straight(230rnrn,ss(titanium) , scissoroperatingstraight(230mm(tungstencarbidetipantirustquality) , scissors , scissors , scissors,operatingcurvedmayo bluntpointed(170mm(tungstencarbidetipantirustquality) , screenseperatorwithstand , selfilluminatedretinoscope(forophthalmic) , semifowlerbed(bestquality)withabssystem(72x36x19,16gforhead&legside•finish:pretreated&epoxypowdercoated) , setoftablewith4chairs(neelkamal,cello,supreme) , sharpandbluntcurette , sheetsfordryingandwrappingbaby , sheetsfordryingandwrappingbaby , shoecover , sidelocker , sidelocker , sidelockermadeupofcrcapipe/sheetswithsstop,providedwithonestorageboxandonedrawer,crctabularleg,twoismountedonpvcstupmandtwoon5cmscastors,pretreatedandepoxypowdercoatedandapproxdimension:405mml*405mmw*810mmh. , simko21noguage(forophthalmic) , simsretractor/depressor , simsspeculumveginaldoubleendedissmediam , slidedryingrack , slippersperpair(rubber) , slitlampbiomicroscope , snellenvisionchart , snellenvisionchart , soap , sound,uterine,simpson(300mmwith200mmgraduations(ssantirustquality) , spacersandmasks , specimencollectionbottle , speculum , speculum,vaginal,simsdouble ended#3 (ssantirustquality) , speculumvaginalbi valve(cusco medium,(ssantirustquality) , spiritlamp , spiritlamp , spirometer , spongeholdingforceps/cheatleforceps , spoonexcavator , sstraywithcover , sstraywithcover , sstraywithcover , stadiometer(heightmeasurement) , staticvaccumextractor(bestquality) , steelcup board , steelrackiron(78x36x15)(4selves) , sterilesurgicalgloves , sterileswabs , stethoscope , stethoscope(bestquality) , stomachwashequipment(bestquality) , stool , stoolfixed(iron) , straightcocker(titanium) , straightneedle , stretcherontrolley , streturetrolly(85x22x32powercoatedwithmatress) , suctionmachinewithpump: powersupply:230 240v/50hz vacuumcapacity:18litres/mim maximumdepression: 75kpa( 563mmhg)vacuumiscreatedbyaplasticpistonandcylindersystem,withfourvacuum creatingmodules( , suctionmachinefootoperated(powdercoatedm.s.chassis.noiselevelofsuctionapparatusfromis50db+/ 03db.leakagecurrentofsuctionunitsislessthan84ua.electricalrequirement–220~230v,50hz,1phase.idealformtp/medical/surgic , suctionmachineforot , suctiontube(225rnrn,ss) , sunctionmachineelectric/footoperatedsuctionapparatus , sunctionmachineelectricapparatus , suringneedlecurved , sutureneedlecurved , sutureneedlestraight 10 , suturingthread , suturingtraywithlidss small , syringe,anesthetic(control5mlluermountglass) , syringepump , syringes1ml,2ml,5ml,10ml , tableclothpermeter , tallquisthbscale , tcdccountapparatus , telephone(set) , temporaryfillingmaterial , testtubeholders , testtubeholdingclamp , testtuberack , testtuberack , testtubes , testtubestands , tharmometer , thermometerrectal , thermometers(digital) , thermometers(para) , thomassplint(bestquality) , threeseatercrome(ss) , threeseatercromewithcution(ss) , threeseateriron(witharm) , threesheetercromreparining , thumbforceps , thumbnontoothedforceps , timerstopwatch , tissueforcep10(titanium) , tissueforcep6(titanium) , tissueforcep8(titanium) , tokendisplaysystem(tokendispenserwithissuekeys,thermalprinter,callingunitwithkeysforcallingnexttokennumber,tokendisplayunitforshowingtokenoncabinoutdoor,centralleddisplayunitforshowingtokennumberwithcabinnumberconne , tonguedepressor , tonguedepressor , tonguedepressors , toothedforceps , toothedforceps , toothforceps(8(tungstencarbidetipantirustquality) , torch , torch/torchbox typepre focused(4cell) , towel , towelsbig(60x30)(softcotton) , towelssmall(15x30)(softcotton) , tracheostomyset(bestquality) , trayinstrument/dressingwithcover , trialbox,trialframe,lens,metalrim(205x6cye)(completeset(forophthalmic) , trialframeadult(forophthalmic) , trialframechildren(forophthalmic) , tubesconnectingforen(bestquality) , tuningfork , tuningfork(bestquality) , tuningfork. , twizer , twoseatercrome(ss) , ultrahighspeedlaboratarycentrifuge(specificationsattached) , ups1kvdoublebattary , uretheraldilatorset(bestquality) , urinalfemale , urinalmale , urinebags , urinebags , urinebags* , uterineelevator(ranathlbod)(ss) , uterinesound(foriucd) , uteruscollection(sisteruandmamau) , vaccinecarrier , vaccusucksuctiontube(titanium)(forsuctionmachine) , vacuumextractormetal(bestquality) , vaginalhysterectomyset(bestquality) , valveinhaler(chrome platedbrass,y shape) , varicoseveinset(bestquality) , varicoseveinset(bestquality) , vascularclampset(bestquality) , vipchairwithcuition(witharm) , vulcellumstainlesssteelsize:10inchcolour:silvershape:curved , vulsellumuterineforcepscurved25.5cm , wallclockwithsecondhand , wallclockwithsecondhand , wastedisposal bin/drums , wastedisposalcolourcodedbuckets(black,red,yellow,blue)(neelkamal,cello,suprem) , wastedisposalcolourcodedbucketsswinebing30ltr.(black,red,yellow,blue)(neelkamal,cello,suprem,nayasa) , wastedisposalcolourcodedbucketsswinebing60ltr.(black,red,yellow,blue)(neelkamal,cello,suprem,nayasa) , wastedisposalcolourcodedbucketsswinebing80ltr.(black,red,yellow,blue)(neelkamal,cello,suprem,nayasa) , wastedisposalcolourcodedpolybags(black,red,yellow,blue) , wastedisposal trolley(ss) , wastedisposaltwinbucketforhypochloritesolution/bleach(big) , watercoolerwithpurifire(120ltr.storagecapacity,80ltr.coolingcapacity,stainlesssteel,twotap , watercoolerwithpurifire(40ltr.storagecapacity,20ltr.coolingcapacity,stainlesssteel,twotap , watercoolerwithpurifire(80ltr.storagecapacity,60ltr.coolingcapacity,stainlesssteel,twotap , waterreceptacle , weighingmachine(adult)digital , weighingmachine(infant)digital , weighingmachineadult(bestquality) , weighingmachinebabyelectronic(5kgcapicitywithfibertray) , weighingscalesforinfantsandchildren , westdisposalcolourcoatedpolybeg(black,red,yellow,bule)(perkg.) , wheelchair , wheelchair(ss)folding , whitewrightingboard , windowscreens , windowscreens , woodenspatula , woodenspatula , workstationsmemodel (singleunit)(specificationshouldbeattachedintechnicalbidturms&condition) , xeroxmachine(minimumcopyingspeed(epm):25/25)(specificationshouldbeattachedintechnicalbidturms&condition) , x rayfilmprocessingtank13.5lit. , x rayfilmprocessingtank9lit. , x rayviewbox , x rayviewbox(doubblefilessbody) , zincphosphatecement...

Rajendra Institute Of Medical Science - Jharkhand

27998214 nit for supply and installation of hand instruments and small hand equipments of different departments at rims , ranchi 2 anthropometric set 3 artery forceps. (straight), ss size 4” 4 artery forceps. (straight) ss size 5 5 artery forceps. (straight) ss size 6 6 artery forceps. (straight) ss size 7” 7 artery forceps. (straight) ss size 8 8 artery forceps. (straight) ss size 9 9 artery forceps (curved) ss size 4” 10 artery forceps (curved) ss size 5 11 artery forceps (curved) ss size 6 12 artery forceps (curved) ss size 7” 13 artery forceps (curved) ss size 8 14 artery forceps (curved) ss size 9 15 anteral burr size size 4” 16 anteral burr size size 5” 17 anteral burr size size 6” 18 antral harpoon 19 auriscope 20 allice’s forceps (tissue forceps), size 4” 21 allice’s forceps (tissue forceps), size 5” 22 allice’s forceps (tissue forceps), size 6” 23 allice’s forceps (tissue forceps), size 7” 24 allice’s forceps (tissue forceps), size 8” 25 allice’s forceps (tissue forceps), size 9” 26 adson bayonette dural forceps scrrated tip 8” long 27 adson bayonette dural forceps 1x2 teeth 8” long 28 artery forceps (mosquito curved), size 3” 29 artery forceps (mosquito curved), size 3.5 30 artery forceps (mosquito curved), size 4” 31 artery forceps (mosquito curved), size 5” 32 artery forceps (mosquito curved), size 6” 33 artery forceps mosquito straight, size 3” 34 artery forceps mosquito straight, size 3.5 35 artery forceps mosquito straight, size 4” 36 artery forceps mosquito straight, size 5” 37 artery forceps mosquito straight, size 6” 38 anal retractor 39 antegrade urethral u boogies 40 aneurism needle 41 allis forceps (medium) (i) 4” 42 allis forceps (medium) (ii) 5” 43 allis forceps (medium) (iii) 6” 44 allis forceps (medium) (iii) 8” 45 autoclave (horizontal) 46 autoclave (vertical) 47 autoclave drum (medium size) 48 auwards viginal speculum (gynae) 49 ayer chanzion clam (eye) – 10mm open upper plate, solid lower with lacking thumb screw 50 abdominal retaining retractor (round self) for gynae 51 abdominal hyterectomy kocher’s clamp curved 52 abdominal hyterectomy kocher’s clamp straight 53 arraya’s bone trephine for dcr (eye) 7 mm 54 arraya’s bone trephine for dcr (eye) 9mm 55 bone cutting forceps 56 bone rounger 57 (i) b.p apparatus / b.p. instrument (mercurial) 58 (ii) b.p. instruments led 59 (iii) b.p. instruments (mercurial) with stand 60 b.p. cuff. (paediatrics) 61 boyels davis mouth gag with tounge depressor 62 bone nibbler (neuro) size – 9” with different tip size 63 boynet shape nasal bone gauze 64 bulls eye lamp 65 bandage cutting scissor 66 b.p. handle 3 no. 67 b.p. handle 4 no. 68 b.p. handle 5 no. 69 b.p. handle 6 no. 70 b.p. handle 7 no. 71 b.p. handle 8 no. 72 b.p. handle long no. 15 (straight & bionet type) 20 cm 73 b.p. handle long no. 15 (straight & bionet type) 25 cm 74 brain canula (neurosurgery) 75 bowl (ss) 76 bone nibbular angled & straight of different sizes. 77 barron vacuum trephine (eye) 7.5mm 78 barron vacuum trephine (eye) 8.0mm 79 barron vacuum punch (eye) 8mm 80 barron vacuum punch (eye) 8.5 mm 81 barron vacuum punch (eye) 9 mm 82 barron vacuum punch (eye) 9.5 mm 83 baron radial vacuum trephine (eye) 8mm 84 barron artificial anterior chamber (metal) 85 bores optic zone maker (eye) size – 9.0mm 86 bores optic zone maker (eye) microjaw with lock 87 bores optic zone maker (eye) short model with delicate jaw 88 bores optic zone maker (eye) straight without lock 89 brain spatulla 90 barraquer needle holder 91 bulldog clamp curved 92 bulldog clamp straight 93 babecook tissue forceps, 5”, 94 babecook tissue forceps, 6”, 95 babecook tissue forceps, 7” 96 babecook tissue forceps, 8” 97 bladder retractor 98 bulldog clamp straight 99 bone cutter medium 100 bone holding forceps medium 101 bladder syringe 102 bowl lifting forceps 103 bowel sterilizer 104 basin ss (bed side bowl), 40 cm 105 bottle lifter 106 bowl sterilizer 107 blue tube (phototherapy type) 108 bone chizel 109 b.p. instrument for small animal like albino rat 110 b.p. instruments (electronics) 111 bi pap equipment 112 having spontaneous & timed mode to trigger on demand or automatically to deliver prescribed therapy. can recognize & compensate leakages, flex pressure relief should be us fda approved. 113 baby tray (for gynae) 114 buttoning & unbuttoning activity 115 beading activity unit 116 bilateral & unilateral inclined sanding board activity unit 117 cpap equipment 118 continuous positive airways pressure machine with cpap, auto, auto check & auto trail mode, a flex, opti – start features, sd card capable, oximeter module. should be able to detect and respond to apnea, hypopneea, snoring. should be us fda approved 119 cough extractor machine (paediatric & adult) 120 non invasive cough assists for enhance or replacing their natural removal of bronchial secretions via mechanical insufflations exsufflationi. should have detachable battery facilities, control level for manual application, automatic mode with track & trigger option. noninvasive & flexible technique can be given via facemask, mouthpiece, endotracheal & tracheotomy tube. should be us fda approved. 121 capillary electrophoresis 122 cx punch biopsy forceps 123 chittle forceps different sizes) 124 cat paw tissue forceps 125 colposcop smart scope 126 colposcop ge scope 127 chalanzion scoop (eye) size 0 128 chalanzion scoop (eye) size 1 129 chalanzion scoop (eye) size 2 130 chalanzion scoop (eye) size 3 131 castroviejo calliper (eye) straight 20mm spread 132 castroviejo calliper (eye) curved 20mm spread 133 councilman blade saw 134 curved scissor 135 citellis bone punch, number 1 136 citellis bone punch, number 2 137 citellis bone punch, number 3 138 chitel’s forceps, small 139 chitel’s forceps, medium 140 chitel’s forceps, large 141 cushin bayonette dural forceps sorrated tip 7 1/2 long 142 craniotomy set with hudson brace and perforatic & with extra rods( hadson brace handle ) 143 craniotomy set with hudson brace and perforatic & with extra rods( perforator ) 144 craniotomy set with hudson brace and perforatic & with extra rods (burr) 145 craniotomy set with hudson brace and perforatic & with extra rods (extension rod) 146 craniotomy set with hudson brace and perforatic & with extra rods (trephine 4.5cm) 147 craniotomy set with hudson brace and perforatic & with extra rods (trephine 5.5cm) 148 cystolithotomy forceps, big 149 cystolithotomy forceps, small 150 czernys retractor, 6” 151 czernys retractor, 8” 152 czernys retractor, 10” 153 cats paw forceps (gyne) 154 cusco’s speculum (insulated) 155 cuscos speculum (small) 156 cuscos speculum (small) 157 cuscos speculum (large) 158 cervical biopsy forceps (gynae) 159 cervical dilator set (gyne) (i) cryo cautery 160 cervical dilator set (gyne) (ii) ctg machine with printing paper (for gynae use) 161 cervical dilator set (gyne) (iii) colposcope (for gynae) 162 cervical dilator set (gyne) (iv) chromatography chamber (for biochemistry pg lab) 163 centrifuge machine, 8 tube/bucket high speed 164 corneal lamellar dissector (eye) (i) straight 165 corneal lamellar dissector (eye) (ii) curved 166 calorimeter (interface filter digital), filter range 405 to 660 167 corneal scissor (eye) curved blunt tip (i) small 168 corneal scissor (eye) curved blunt tip (ii) large 169 cell counter (manual), 12 key 170 conjunctival scissors 171 collibri forceps 172 corneal forceps with plate (titanium) 173 conjunctival spring scissors 174 chemical balance 175 counting & colour sorting beads set 176 c.p.chair with activity tray & inclinable seat & back 177 dura guard (neuro) 178 desmarres lid retractor (eye) (i) 15 mm blade 179 desmarres lid retractor (eye) (ii) 11mm 180 desmarres lid retractor (eye) (iii) 7.5mm 181 desmarres chalanzion clamp (eye) 22 x 13mm, 1.0 large 182 deveker scissor 183 dressing drum, size : 10” x 12”, 184 dressing drum, size : 11” x 9” 185 dressing drum, size : 12” x 15” 186 dressing drum, size : 12” x 18” 187 dressing drum, size : 12” x 24 188 dissection forceps (toothed) (i) size 4” 189 dissection forceps (toothed) (ii) size 5” 190 dissection forceps (toothed) (iii) size 6” 191 dissection forceps (toothed) (iv) size 7” 192 dissection forceps (toothed) (v) size 8” 193 dissecting forceps (plain) 194 deavers retractor 195 diaphragm for microscope, carl zeiss 196 dura elevator (adsons) 197 dura scissors (cutting) neuro 198 disc forceps up, down & straight 199 disjardins forceps, 8 200 dissecting forceps (long toothed) 201 dastoor lacrimal sac dissector (eye) 202 disposable corneal trephine (i) 7.5mm 203 disposable corneal trephine (ii) 8mm 204 disposable corneal trephine (iii) 7mm 205 disposable corneal trephine (iv) 9mm 206 dajens deep retractor 207 doyns retractors (small size) 208 dialeter set 209 deveckers scissors 210 dondy scalp forceps (neuro) 211 dever’s rectractor (i) size 1” 212 dever’s rectractor (ii) size – 1.5” 213 dispensing balance with wt, 1g to 20gm 214 domestic refrigerator – 180 ltrs to 200 ltrs 215 domestic refrigerator – 250 ltrs to 300 ltrs 216 eye piece lens foe microscope, carl zeiss / olympus / t/m india 217 ecg maching for small animal 218 e.c.g. machine, 12 channel 219 eye speculum (i) 15 mm blade screw controlled adjustable 220 eye speculum (ii) 14mm open blade 221 eye speculum (iii) 11 mm child 222 electro convulsiometer 223 electric balance 1 mg to 100 gms 224 electronic balance 225 electric cautery machine 226 foreign body hookds 227 enucleaton scissor (eye) (i) blunt tip 228 enucleaton scissor (eye) (ii) ring handle curved 229 eviscration scoop (eye) 230 endothetical stripper (eye) 231 endothelical guide spatula (brain guide) eye) 232 fluid warmer cabinet (specification attached (paediatric surgery) 233 foleys catheter mounter 234 foggar machine (cardiology) 5ltrs. 235 foggar machine (cardiology) 8ltrs. 236 foggar machine (cardiology) 10ltrs. 237 flussing currette 238 freers suction elevetor 239 finochieto retractor for ribs, infant 240 finochieto retractor small 241 finochieto retractor medium 242 foetal doppler (for gynae use)) 243 foetus scope (for gynae use) 244 fixation forceps size – 2 x 3 teeth straight 245 fine tip forceps (plain) 246 fine tip forceps ( toothed) 247 freers elevator septoplasty set elevetor, seprator, knives etc. 248 folley’s catheter introducer 249 fishtail bone gauge 250 glucometer 251 gastro entrostomy clamp set 252 gally pot (big) eye 253 gally pot ( small) eye 254 globe fixation forceps 255 4.5mm wide jaw with straight fine tooth 256 gooze 257 gigle wire (neuro) 258 gym kit activity 259 gel balls 260 hack saw 261 hammer 262 hand lens 263 hand set sealer 264 hot plates 265 hyfricator (for skin) 266 hook for giggle wire (neuro) 267 hartman’s forceps 268 hemocytometer with silver lining counting chambers 269 hemogobinometer with prismatic computer 270 hudson brace with perforators & burrs of different sizes and extension rod 271 hand drill and drill bits 272 haemorrhodiectomy forceps, 4 273 haemorrhodiectomy forceps, 6 274 haemorrhodiectomy forceps, 7 275 haemorrhodiectomy forceps, 8 276 humbys handle, 4cm 277 humbys handle, 6cm 278 humbys handle, 8cm 279 hook retractor single & double, 4 280 hook retractor single & double, 5 281 hook retractor single & double, 6 282 hook retractor single & double, 8 283 hegars dilator set 284 hernia dissector 285 howkings ambler dilator 286 histamine chamber 287 heating mental, 2l 288 heating mental, 3l 289 height & weighing machine (digital) for paediatric use 290 weighing machine (electronics) 291 handle knife 292 high power lense for microscope, carl zeiss 293 hand exerciser table 294 hand skate roller 295 infantometer 296 intestinal scissor, enterotome 297 iris repositor (eye) 298 iris repositor (eye) double ended 1mm wide x 10mm 299 iris repositor (eye) long angled 1mm wide x 10mm 300 infra red lamp 301 intestinal non crushing clamp straight, 6 302 intestinal non crushing clamp straight,8 303 intestinal non crushing clamp straight,10 304 intestinal non crushing clamp curved,6 305 intestinal non crushing clamp curved,8 306 intestinal non crushing clamp curved,10 307 incubator (baby incubator) 308 intestinal clamp (straight) (at) 309 intestinal clamp (curved) (at) 310 irrigation vectis – 2 size, preferable serrated 311 irrigation chopper, microphaco 312 iris hooks 313 interferential therapy (ift) of pmr 314 irani’s clamp 315 joll’s thyroid retractor 316 jenkins bone gouge.size 2 317 jenkins bone gouge.size 4 318 jenkins bone gouge.size 6 319 jenkins bone gouge.size 8 320 jenkins bone gouge.size 10 321 jenkins bone gouge.size 12 322 jenkins chisels size – 2mm 323 jenkins chisels size 4mm 324 jenkins chisels size – 6mm 325 jenkins chisels size – 8mm 326 jakson forceps with one movable jaw, size 12” 327 jakson forceps with one movable jaw, size 14 328 jakson forceps with one movable jaw, size 18 329 jakson forceps with one movable jaw, size 22 330 jakson forceps with one movable jaw, size 24 331 jakson forceps with both movable jaw, size 12” 332 jakson forceps with both movable jaw, size 14 333 jakson forceps with both movable jaw, size 18 334 jakson forceps with both movable jaw, size 22 335 jakson forceps with both movable jaw, size 24 336 fb holding type, biopsy type 337 jakson horne probe (ent) 338 up, down,right, left punch 339 kelly’s forceps 5 340 kelly’s forceps 6 341 kelly’s forceps 8 342 kolner’s mouth gag (adult) 343 kolner’s mouth gag (small) 344 kidney pedicle clamp 345 kochar’s thyroid retractor 346 kocher’s clamp long curved (size – 6) 347 kocher’s clamp long curved (size – 8) 348 kocher’s clamp long curved (size 10) 349 kilhor nosal speculum (ent) 350 knolle pearce irrigating victies (eye) 351 victies port on quter side, 23 gauge over all length 33.0mm, size 2>5mm wide, 6 mm long tloop 352 kelly’s punch (eye) 353 knapp lacruimal retractor 354 kerrison bone punch dcr (eye) 2mm 355 kerrison bone punch dcr (eye) 3mm 356 kocher’s clamp long straigh (size – 6) 357 kocher’s clamp long straight (size – 8) 358 kocher’s clamp long straight (size 10) 359 kidney tray s.s 8” 360 kidney tray s.s 10” 361 kidney tray s.s 12” 362 karrison bone ronger (upward cutting no. 2) 363 karrison bone ronger (doward cutting no. 2) 364 karrison bone ronger (upward cutting no. 3) 365 karrison bone ronger( doward cutting no. 3) 366 london retrctor 367 leep non conductive surgical instrument (gynae) 368 lester lens, manipulator (eye straight 0.2mm hourglass shape tip 369 lester lens, manipulator (eye) angled 0.2mm hourglass shape tip 370 laryngeal mirror 371 laryngeal mirror number 3 372 laryngeal mirror number 4 373 laryngeal mirror number 5 374 laryngeal mirror number 6 375 luc’s forceps 376 ant commisure child & adult 377 sliding panes – child 378 sliding panes – adult 379 lambort chalanzion clamp – 8mm round 380 low power lense for microscope, carl zeiss 381 loyella brain retractors 382 loyala brain retractor complete set 383 lifter 384 langenbachs retractor 385 lens chopper (eye blunt 1.25mm 386 lens chopper (eye) blunt 1.5mm 387 lens chopper (eye) sharp 1.25mm 388 lens chopper (eye)sharp – 1.5mm 389 laser pointer (with pencil torch battery) 390 laryngoscope set adult size 1 (paediatric deptt.) 391 laryngoscope set adult size 2 (paediatric deptt.) 392 laryngoscope set adult size 3 (paediatric deptt.) 393 laryngoscope set (paediatric deptt.) blade size 0 394 laryngoscope set (paediatric deptt.) blade size 1 395 lens expressor 396 lacirimal probe 397 lenes tissue forceps – 9” (gynae) 398 lead apron (zero lead) 399 lead gloves (zero lead) 400 lead cap (zero lead) 401 lim forceps curved shaped 1 x 2 teath with 5.0 mm longt type plateform (0.2mm) 402 muscle stimulator (for pmr) 403 myo dissecting scissor (gynae) straight 404 myo dissecting scissor (gynaecurved 405 mayos scissor, straight 4 406 mayos scissor, straight 5 407 mayos scissor, straight 6 408 mayos scissor, straight 7 409 mayos scissor, straight 8 410 mayos scissor curved 4” 411 mayos scissor curved 5 412 mayos scissor curved 6 413 mayos scissor curved 7 414 mayos scissor curved 8 415 mucks tonsil holding forceps 416 mastroid cell seeker with scoop 417 mallet, 200 gm 418 microscope 419 micro needle holder (straight) 420 micro needle holder (curved) 421 mouth piece for spirometer, autoclavable 422 mirror for microscope 423 carl zeiss 424 t/m india 425 khm model 426 olympus gb 427 micro dissector 9 long. (1mm tip) 428 micro dissector 9 long (2mm tip) 429 micro dissector 9 long (round shaped tip) 430 mueller lacrimal sac retractor (eye) 431 microneedle holder 432 microscissor yasargil type 7 1/2 long (straight blade) 433 microscissor yasargil type 7 1/2 long (curved blade) 434 microsurgical hand instruments for spinal surgery 435 microsurgical hand instruments for cervical/neuro surgery 436 multipurpose intestinal clamp 437 metzenbaum scissor, 6.5 438 monocular microscope 439 microtome (manual), sipcon design 440 mixter baby forceps, 6” 441 mayo scissor (fine) 442 magill forceps, 16 cm 443 magill forceps, 19 cm 444 modigied uratas forceps, titanium 10mm 445 mc phersons, titanium corneal forceps (eye) titanium – 1 x 2 teeth straight 446 mahatmes chopper (sharp), titanium 447 microscope bulb , pihlun 1200 vt 448 myoma screw (gynae) – 6” 449 magnetic stiring bar 450 magnetic stirrer 451 mega surge gold 452 manipulation board activity unit 453 multi activities work station 454 needle holder, size 8 straight 455 needle holder, size 6 straight 456 needle holder, size 4 straight 457 needle holder, size 8 curved 458 needle holder, size 6 curved 459 needle holder, size 4 curved 460 negus oesophogoscopes different forceps with fibreoptic carrier size 5mm x 30 cm 461 negus oesophogoscopes different forceps with fibreoptic carrier(ii) size 7mm x 35 cm 462 negus oesophogoscopes different forceps with fibreoptic carrieiii) size 9mm x 45 cm 463 negus oesophogoscopes different forceps with fibreoptic carriersize 10mm x 53cm 464 negus bronchoscope with fiberoptic carrier, size 5mm x 27 cm 465 negus bronchoscope with fiberoptic carrier size 6mm x 30 cm 466 negus bronchoscope with fiberoptic carrier size 7mm x 35 cm 467 negus bronchoscope with fiberoptic carrier size 9mm x 45 cm 468 fine needle holder (small ) 469 fine needle holder (long) 470 nebulizer 471 nebulizer ultrasonic type (cardiology) 472 needle cutter and destroyer, electrical & mannual (combined cutter) 473 nasopharyngeal pronge 474 nizal prong 475 needle holder with lock (small size) (cornil), titanium 476 needle holder without lock (small size), titanium 477 nagaharas chopper (blunt), titanium 478 nosal speculum (eye) 479 nosal packing forceps 480 ovum forceps (gynae) 481 otoscopes with rechargeable battery 482 oesophageal bougy 483 oesophageal bougy (size big) 484 oesophageal bougy (size medium) 485 oesophageal bougy (size small) 486 oesophageal speculum with fiber optic carier, child 487 oesophageal speculum with fiber optic carier, adult 488 overhead projector bulb, galaxy 2000 489 osteotome 490 ophthalmoscope, pocket model 491 ophthalmoscope, 492 otoscope 493 olive tipped/ring polisher for caapsule 494 otoscope with rechargeable battery 495 paraffin bath 496 post mortem instrument set, complete set 497 punching machine 498 post rhinoscopy mirror, number 2 499 post rhinoscopy mirror, number 3 500 post rhinoscopy mirror, number 4 501 periosteum elevator mollisoris 502 portex tracheostomy tube, size 0 to 9 503 phototherapy set (paedia / neonate) 504 petallar hammer 505 perimeter bulb 506 periosteum elevator 507 pyelolithopomy forceps (set), 8 508 pulse oximeter (fingure tip) 509 proctoscope adult size 510 proctoscope pediatric size 511 portable light for o.t (hexaganel with led light) 512 photo electric colorimeter 513 phototherapy tube holder 514 p.h. meter (digital) 515 peg board activity unit 516 prehension activity unit 517 post office box unit 518 peg board (different shape & sizes) 519 quinsy forceps, adult 520 doyens mouth retractor 521 cheech retractor (small) 522 cheech retractor (medium) 523 cheech retractor (large) 524 skin hook retractor (single) 525 skin hook retractor (double) 526 anterior pilar retractor with dissector 527 mastroid rectractor (tracheal retractor, blunt sharp) 528 mastroid rectractor ( anterior vaginal wall retractor) 529 rigid oesophogoscopes (jackson)with fibre optic carrier, diff. size infant, child, adult (5mm x 30 cm) 530 rigid oesophogoscopes (jackson)with fibre optic carrier, diff. size infant, child, adult7mm x 35 cm 531 rigid oesophogoscopes (jackson)with fibre optic carrier, diff. size infant, child, adult9mm x 45 cm 532 rigid oesophogoscopes (jackson)with fibre optic carrier, diff. size infant, child, adult10mm x 53cm 533 retangular tray big ss size : 12”x18”, 534 retangular tray big ss size : 12”x15” 535 resenwasser donor lameller inserting shavel (eye) 536 resenwasser donor lamella inserting forceps (eye) 537 radiofrequency machine (for skin) 538 (i) retangular tray small (s.s) 8”x10”, 539 (ii) retangular tray medium (s.s) 10”x12” 540 radiant warmer (for gynae) 541 ring retractor for urethroplasty 542 retractors of different sizes, curved 6” 543 retractors of different sizes, double axis – 9” 544 self retaining retractors for spinals surgery lumber and cervical clowards retractors 545 self retaining hinged arm retractor 546 self retracting abdominal wall retractor 547 rigid sigmoidoscope with biopsy forceps 548 rectum clamp for anterior resection 549 retractors kellis 550 reverseal sinskey hook (eye) 551 rope and pulley activity unit 552 reacher 553 rolls & bolsters 554 right angle artery forceps 555 scissor – fine blunt scissor (neuro) no. 6” 556 scissor – fine blunt scissor (neuro) no. 8” 557 sillicon tube (neuro) – 6 mm dia 558 scissor with one sharp and one blunt blade 559 serrated tip forceps 560 sinus forceps4” 561 sinus forceps5” 562 sinus forceps6” 563 sims speculum small 564 sims speculum medium 565 sims speculum large 566 sims vaginal speculum 567 suction apparatus high end variable pressure control ((neuro) 568 sponge holding forceps (s.s) wild ss size – 8” 569 sponge holding forceps (s.s) wild ss size – 9” 570 sponge holding forceps (s.s) wild ss size – 10” 571 syringe pump (paediatrics) 572 speculum acvards vaginal (gynae) 573 st. clair thomson adenoid curatte with guard, size 1 574 st. clair thomson adenoid curatte with guard, size – 2 575 st. clair thomson adenoid curatte with guard, size 3 576 st. clair thomson adenoid curatte with guard, size 4 577 suspension laryngoscope and chest piece, child 578 suspension laryngoscope and chest piece, adult 579 suction tip (ss) different dia with key hole (neuro) 580 sickle knife, 19 cm. pointed round double cutting karl stortz make 581 suture cutting scissor 582 stethoscope adult 583 stethoscope paediatric (neonatal) 584 stethoscope (cardio vascular) 585 stich cutting scissor (no. 3”) 586 stich cutting scissor (no. 4”) 587 stich cutting scissor (no. 5”) 588 stich cutting scissor (no. 6”) 589 scissor straight dissecting no. 3” 590 scissor straight dissecting no. 4” 591 scissor straight dissecting no. 5” 592 scissor straight dissecting no. 6” 593 scissor straight dissecting no. 7” 594 scissor straight dissecting no. 8” 595 small scissor (straight), 3” 596 scissors fine dissecting (curved) no. 3” 597 scissors fine dissecting (curved) no. 4” 598 scissors fine dissecting (curved) no. 5” 599 scissors fine dissecting (curved) no. 6” 600 scissors fine dissecting (curved) no. 7” 601 scissors fine dissecting (curved) no. 8” 602 scissors pointed no. 6” 603 scissors pointed no. 7” 604 scissors pointed no. 8” 605 sharp dissecting scissor (curved) 606 sharp dissecting scissor (straight) 607 scalp forceps 608 shunt introducer child 609 shunt introducer adult 610 scoop 611 sealput handle bayonette shaft 8”long vertical cutting 612 sealput handle bayonette shaft 8”long horizontal cutting 613 spinal instruments & fixation instruments 614 sterlizer (electrical) 615 silver probe various size, 8 616 suprapubic metal trocar & cannula 617 steel bowl with everted margine 16 inch dia 618 steel dressing tray with cover ss 10” 619 steel dressing tray with cover ss 12” 620 steel dressing tray with cover ss 16” 621 steel dressing tray with cover ss 18 622 syringe container 623 stapler remover 624 stand light flexible 625 stadiometer (portable, light weight with carry case measuring range 20 to 205cm 626 small scissor (cardiology) 627 shepard lense holding forcep (eye) (serrated lower jaw) 628 shepard lense holding forcep (eye) (gently shaft) 629 simcoe irrigating & aspirating canula (i) 23 gauge ruved shaft with 0.3mm (direct & reverse) 630 simcoe irrigating & aspirating canula (ii) top aspirating port with silicon tubing (direct & reverse) 631 straight marks pattern rectum retractor adult 632 skin grafting handle (humbys) 633 skin hook, 6 634 sterilizing bins, seamless s/s, s/s 304 grade steel sleek flat wall body, extra strong bottom and easy locking system 635 spong holding forceps (narrow size), 8 636 spong holding forceps (narrow size), 9 637 spong holding forceps (narrow size), 10 638 sharp and blunt currette (wild size) 639 scissor cuticular, 5” 640 scissor curved – 6” (for paedia surgery) 641 scissor straight – 6” (for paedia surgery) 642 superior rectus forceps 643 sterilier (electric surgical instrument) size – 425 x 200 x 150mm 644 suture tying forceps titanium (curved 1 x 2 teeth) 645 suture tying forceps titanium (straight 1 x 2 teeth) 646 soxhlet apparatus, 2l 647 soxhlet apparatus, 3l 648 suspension frame set (with suspension frame *gear*couch) 649 shoe lacing activity 650 shoulder wheel activity unit 651 tuboplasty set (gynae) 652 tilleys forceps (ent) 653 tonsilar snare and wire eves 654 tracheal dialator 655 tracheal hooks, blunt sharp 656 toothed foceps 4 657 toothed foceps 6 658 toothed foceps 7 659 toothed foceps 8 660 tongue depressor (ent) 661 tonsillar scissor, size 7.5 metzenbam 662 tracheostomy tube silver jackson (size 0 to 9) 663 thumb forcep (plane fine tip – 6”) 664 thumb forcep (tooth fine tope – 6” 665 tatto electrical machine 666 tissue holding (biopsy) forceps with cupped up tip both plain & serrated 667 trephine with guard different sizes. 668 tumour grasping forceps (straight & bayonette) 2mm tip bayonette shaft 669 tumour grasping forceps (straight & bayonette)curved upwards 670 tumour grasping forceps (straight & bayonette) curved downwards 671 tumour grasping forceps (bayonette) 2mm tip bayonette shaft 672 tumour grasping forceps (bayonette) curved upwards 673 tumour grasping forceps (bayonette) curved downwards 674 trephine with guard 675 towel clip cross action, 4 676 towel clip moynihans, 8 677 tailor scissors brass handle size 10” 678 tailor scissors brass handle size 12” 679 towel clip backhans, size 5” 680 towel clip backhans, size 6” 681 tens (transsuctaneous electrical nerve stimulator) 682 toothed conjunctival forceps 683 trial box, balliwala 684 trial frame 685 tenotomy scissor (straight) 686 tenotomy scissor (curved) 687 tenotomy scissor (blunt tip) 688 tenotomy scissor (ring handle) 689 terry micro corneal scissor (eye) left 690 terry micro corneal scissor (eye) right 691 temporary external dual chamber pacemaker (cardiology) 692 therapy balls (set of 05 balls) 693 uv light chamber 694 urethral dilator set (paediatrics) 695 urethrl dilator set (adult) 696 uterine holding forceps 697 universal corneal scissor 698 uterine curette (gynae) 699 utrata capsularehis forceps (eye) (grafting tip, extreme thin 11.0mm long shanks 700 uv cabinet for tlc monitoring 701 viscera cutter 702 volumetric infusion pump 703 vascular dissecting forcepe straight, 6 704 vascular dissecting forcepe straight, 8 705 vulsellum forceps 6 706 vannas scissors angle sharp tip 9mm 707 vannas scissors angle sharp tip 11mm 708 vannas scissors straight 709 vannus scissors fine, titanium 710 vaccume ventouse cups, sillicon – 6mm (gynae) 711 wire vectis (eye) curved lens loop (small ) 712 wire vectis (eye) curved lens loop (large) 713 weigh machine (adult) accuracy of 100 gms, electronic display, zero adjustment 714 weigh machine (child/ infant), manual 715 weigh machine (child/ infant) digital 716 wriglys forceps (outlet) gynae 717 warmer heating element 718 wire eye speculum open blade (adult 14mm) 719 wire eye speculum open blade (child – 11mm) 720 wire eye speculum open blade (infant – 5mm) 721 wernier calliper, able to measure at least 10 inch 722 west lecrimal shaisel (eye) 723 yankurs suction with tip 724 yiliya ipl 725 sterilization drum (size ss 16”) 726 sterilization drum (size – ss – 20”) 727 formalin chamber different size 728 suction canula s/s – different size 729 sterilizer size 730 vertical autoclave – for two drums 731 velcro activity unit 732 trochette (lights) ( lifter) 733 antral burr, small – 4” 734 antral burr, middle 5” 735 antral burr, large 6” 736 antral harpoon 737 bunsen burner 738 small bowl 739 cartilage knife 740 cleft palate repair set 741 cryo cautery 742 denture wire cutting scissor 743 x ray view box (led type), 744 x ray view box (led type), single film 745 x ray view box (led type), double film 746 x ray view box (led type), three films 747 x ray view box (led type), four films 748 dryer 749 gigli saw 750 dura guide 751 gigli wire 752 jakson forceps with both movable jaw (size – 12”) 753 jakson forceps with both movable jaw (size – 14”) 754 jakson forceps with both movable jaw (size – 18”) 755 jakson forceps with both movable jaw (size – 22”) 756 jakson forceps with both movable jaw (size – 24”) 757 kolner’s mouth gag, adult 758 kolner’s mouth gag, small 759 laryngoscope, child 760 laryngoscope adult 761 sliding panes child 762 sliding panes adult 763 laryngoscope set (machintosh) 764 laryngoscope set (wise foregger) 765 lacirimal probe 766 liq. n2 cryotherapy instrument with gas, with all ent probes cylinder 767 magnetic set for removal of foreign body 768 micro needle holder 769 microscissor yasargil type 770 microscissor yasargil type (i) straight blade small 771 microscissor yasargil type (ii) straight blade medium 772 microscissor yasargil type (iii) straight blade large 773 microscissor yasargil type (i) curved blade small 774 microscissor yasargil type (ii) curved blade medium 775 microscissor yasargil type ii) curved blade large 776 needle holder with lock, small size (titanium) 777 punch biopsy forceps endoscopy, different sizes & different shape 778 punch biopsy forceps (cx) (i) small 779 punch biopsy forceps (cx) (ii) large 780 cheek retractor (i) small 781 cheek retractor (ii) meddle 782 cheek retractor (iii) larege 783 anterior pillar retractor with dissector 784 mastoid retractor (i) child 785 mastoid retractor (ii) adult 786 lempert end aural speculum, different sizes 787 st. clair thomson adenoid curatte with guard, (i) size 1 788 st. clair thomson adenoid curatte with guard, (ii) size – 2 789 st. clair thomson adenoid curatte with guard, (iii) size – 3 790 st. clair thomson adenoid curatte with guard, (iv) size 4 791 suspension laryngoscope and chest piece, (i) child 792 suspension laryngoscope and chest piece, (ii) adult 793 tunning forks brass (i) 256hz 794 tunning forks brass (ii) 512hz 795 tunning forks brass (iii) 1024hz, 796 tunning forks brass (iv) 2048hz, 797 tonsillar snare and wire 798 tongue forceps 799 tracheostomy tube silver jackson, size 0 to 9 800 tumour grasping forceps (straight & bayonette), 2mm tip bayonette shaft curved upwards 801 tumour grasping forceps (straight & bayonette), 2mm tip bayonette shaft curved downwards 802 tunning fork with broad base (i) 128hz 803 tunning fork with broad base (ii) 256hz 804 tunning fork with broad base (iii) 512hz 805 tunning fork with broad base (iv) 1024hz 806 tunning fork with broad base (v) 2048hz 807 thudicum nasal speculum, all sizes 808 headlight with transformer 809 head mirror ce & fda approved 810 higginson syringe 811 mucs tonsil holding forceps, cup shaped 812 antrum trocar & channula 813 set of models, (ear, nose ,throat & neck ) 814 obstetrics outlet forceps 815 pph suction cannula (painckers vaccum suction haemostatic device) 816 gb laparoscopy (i) trocar 817 gb laparoscopy (ii) needle driver 818 gb laparoscopy (iii) bowel grasper 819 gb laparoscopy (iv) surgical mesh 820 reducer 821 betoche ysteroscopes with attachments 822 hysteroscopy (scissor) 823 hysteroscopy (grasper sheath) 824 craniotomy set 825 cervical spine set 826 laminectomy set 827 retractor set lumber 828 retractor set cervical 829 aneurysm clip set 830 shunt set 831 microset 832 patient warmer system 833 dvt pump 834 laryngoscope miller blade size 0 835 laryngoscope miller blade size 1 836 laryngoscope miller blade size 2 837 macintosh blade size 1 838 macintosh blade size 2 839 macintosh blade size 3 840 macintosh blade size 4 841 mcoy blade size 3 842 mcoy blade size 4 843 innoculating nichromewise loop 844 autoclable coplin jar 845 tweezer 846 spirit lamp 847 autoclavable petriplates 848 student microscope (specification attached) 849 single chamber pacemaker 850 surgical loup 851 forced air warming units 852 pt / inr machine 853 head light 854 bipap machine 855 portable ecg machine 856 dual chamber pacemaker 857 chest spreader two bladed 858 four bladed chest spreader for octopus 859 four bladed chest spreader for ordianry 860 i.m.a. retractor lima ret. 861 kilners retractor 862 russian forceps 8 863 scissors curved t.c. mayo. 7 864 scissors curved t.c. metz. 7 865 scissors curved t.c. metz 8 ( 2 , 1 ) 866 scissors straight t.c. mayo. 7 867 scissors straight t.c. mayo. 8 868 self retaining retractor big 3 prong 869 self retaining retractor medium 3 prong 870 snugger stillet 871 suction tip frazier 2 872 suction tip frazier 3 873 suction tip frazier 4 874 towel clip 4 875 towel clip 5 22qty 876 towel clip 6 2qty 877 tube clamp with guard 878 tube pulling clamp 879 tube organiser 880 wire cutter 881 wire holder 882 wire twister t.c. gold handle 883 wire twister t.c. gold handle 884 yankerus suction tip with multiperforation tip 885 cardioplegia cannula lf. & rt. 886 langenback retractor 1/2 x 2 887 milker forceps 888 cooleys retractor l.a. & r.a. 889 deavers retractor 890 s.s.instrument tray 13 x 18 perforated 891 dissecting forceps heavy atr. 8 892 diissecting forceps heavy 9 893 dissecting forceps atrogrip fine 6 894 dissecting forceps atraugrip fine 9 895 jameson scissors 896 needle holder ryder t.c. 6 897 needle holder ryder t.c. 7 898 needle holder mayohegar 9 t.c. 899 needle holder mayohegar 8 t,c, 900 needle holder vascular 7 t.c. 901 needle holder vascular 8 t.c. 902 needle holder vascular 5 t.c. 903 lung holding forceps 904 sembs clamp 905 mixter 7 906 mixter 9 907 vascular mixter 6 908 vascular mixter 8 909 vascular mixter 10 910 ring bull dog clamp 911 cooley derra clamp assorted 912 cross clamp 913 satansky clamp 914 nerve hook 7 blunt 915 nerve hook 7 fine 916 toothed forceps 6 917 toothed forceps 8 918 babcock 8 919 six prong ( rake ) retractors 920 langenback retractor small 921 langenback retractor medium 922 b.p.handle 7l 923 dissecting forceps atr. 10 924 allies forceps 10 925 babcock 10 926 scissors calcified tissue t.c. curved 927 needle holder vascular 10 928 valsellum 929 blunt hook 10 930 valve ronguers assorted upward 931 valve ronguers down ward 932 valve ronguers straight 933 ross aortic valve retractors assorted 934 v.s.d. retractor set of 5 935 lucs forceps 936 chest spreader two bladed 937 scapular retractor 938 raspatory rt.& lt. 1 each 939 allison lung retractor 940 bone cutter double action 941 bone nibbler ang.double action 942 c shaped retractor 943 langenback retractor med & small 944 rib approximator 945 dissecting forceps debakey atr. 6 946 dissecting forceps debakey atr. 7 947 artery forceps mosquito cd. 948 artery forceps curved 6 949 artery forceps curved 8 tonsil 950 scissors curved metz. 7 951 scissors curved mayo. 7 952 scissors straight mayo. 7 953 needle holder sternal 7 954 needle holder mayo hegar 7 955 needle holder mayo hegar 8 956 needle holder vascular 7 957 needle holder ryder 8 tc 958 mixter clamp rt. angled 9 fine tip 959 kochers st.8 960 four bladed chest spreader 961 yankeurs suction tip ord & perforated 962 wire cutter t.c. 963 suction tip frazier 1 & 2 964 s.s.bowl 10 c.m. 965 needle holder ( castoviego ) 7/0 titanium 966 needle holder ( castoviego ) 6/0 titanium 967 needle holder ( castoviego ) 5/0 titanium 968 micro bull dog 969 bull dog clamp st. 2 970 bull dog clamp angled 2 971 forward scissor 45 degree 972 backward scissor 125 degree 973 ring forceps 8 titanium 974 fine atragrip forcep 975 cardiac dilators ( probes ) 0.5,1,1.5,2.0.2.5 976 eye lid retractor 977 nerve hook sharp 978 spike bulldog clamp 45 degree 979 spike bull dog clamp 90 degree 980 jemison scissor 7 981 jerald forceps 982 sciss0rs stille t.c. gold handle 7 983 scissor stout mayo st. & cd. 7 t.c. gold handle 984 scissor long stille 8 gold handle t.c. 985 scissor patch cutting 986 potts scissor 987 snugger 988 fine hook nerve 989 vsd probe 990 chest spreader double blade 991 chest spreader single blade 992 heagers dialator set up to 14 993 long fine artery forceps 994 medium artery cd. 995 medium artery st. 996 mixter vascular 6 997 suction tip 998 debakey clamp pda 999 wire holder 1000 wire cutter gold handle t.c. 1001 wire twister gold handle t.c. 1002 hot air oven 1003 portable hemoglobinometer 1004 double pan balance 1005 bench top tube sealer 1006 ph meter 1007 vdrl shaker 1008 binocular microscope 1009 tube striper 1010 portable blood donar chair 1011 donor couch 1012 blood collection monitor 1013 table top centrifuge 1014 infrared vein viewer 1015 needle destroyer 1016 plasma expresser 1017 incubator 1018 specific gravity meter 1019 tube roller mixer 1020 bandaid round shape 1021 single channel micro pipette 20 to 100 u l 1022 single channel micro pipette 100 to 1000 u l 1023 multichannel micro pipette 20 – 200 u l 1024 test tube holding forceps 1025 surgical scissors 1026 external digital temperature display monitor 1027 single pan balance 1028 terumo penpol sterile tubing welder 1029 infantometer 1030 stethoscope (neonatology) 1031 low – flow oxygen flow meter( 0.1 – 1 lit / min ) 1032 pulse oximeter 1033 glucometer 1034 syringe pump 1035 nebulizer 1036 neonatal self – inflating bag with face mask of sizes preterm and term 1037 led examination light with stand 1038 air – oxygen blender for neonates 1039 suction apparatus, portable electrical 1040 high end fumigator system 1041 direct opthalmoscope 1042 galipot 4” 1043 thumb dissecting forceps plain 5” 1044 thumb dissecting forceps toothed 5” 1045 needle holder 15 cm, tungsten plated 1046 iris forceps straight 1047 iris forceps plain 1048 iris forceps fine tip 1049 iris forceps, curved 1050 iris forceps plain 1051 iris forceps fine tip 1052 cheatle forceps 1053 scalpel handle no. 4 1054 dissecting scissor straight 15.5cm 1055 stainless steel bowl 10 1056 doshi blade for laryngoscope 1057 guidels airway (all sizes) 1058 nascopharyngeal airway 1059 fiberoptic laryngoscope (closed suction system) 1060 peripheral nerve stikulator with mapping pen 1061 migill forceps 1062 sequential penumatic compressions device for dvt mechanical prophylaxis 1063 proctoscope with light 1064 thomison retractor 1065 adons forceps tooth 1066 adson forceps plain 1067 sinus forceps 6 1068 kelly dissecting & ligature forceps (medium) 1069 kelly dissecting & ligature forceps (large) 1070 sump suction cannula 1071 right angle forceps 8 1072 right angle forceps 10 1073 lung retractor 1074 lung holding forceps astt. size 1075 scapular retractor 1076 elevator periosterum elevator 1077 rib rasporatory 1078 needle driver for sternal wire 1079 strenal retractor 1080 vein loop 1081 smarh set 1082 satinsky forceps (straight & angle 12 1083 clip applicater for open surgery for clip size 200. 1084 clip applicater for open surgery for clip size 400 1085 bone file 1086 bone curette 1087 tuning forte 1088 knee hummer 1089 suction machine (portable) 1090 mecoy laryngoscope blade (adult & paediatric) 1091 ventilating boyie (adult & paediatrics) 1092 stylet (paediatric & adult) 1093 percussion hammer 1094 coniometer half circle 1095 tuning frok 1096 spirometer only for exercise 1097 combination unit (ift + tens) 1098 shortwave diathermy 1099 multi activities work station 1100 weight cuff set with storage rack 1101 rolls & bolsters 1102 c.p. chair with activity tray & inclinable seat & back 1103 fine point scissor 1104 traction weight 8kg 1105 traction weight 5kg 1106 plaster cutting saw 1107 surgical curve scissor 1108 lifter 10 1109 electric drill machine 1110 washing machine chemical 1111 plasma cassettes 1112 wire cutter 1113 jumbo cutter 1114 piler 1115 bone hook 1116 wire passer 1117 skin grafting handle 1118 t. handle 1119 boiler sterilization 1120 diatheramy patient plate 1121 saw machine with blades 1122 yaccum container for negative 1123 pressure wound therepy system 1124 canister for vaccum assisted suction machine 1125 electric plaster cutter 1126 handle mannual plaster cutter 1127 micro surgical set 1128 fine needle holder, size 7 0 1129 fine needle holder, size 8 0 1130 micro needle holder size 9 0 1131 micro needle holder size 10 0 1132 micro vessel dilator 1133 micro jwellers forceps 1134 micro scissor 1135 bulldog clamp (all sizes) 1136 vascular clamp bb, hd, a.m (all sizes) 1137 satinsky clamp 6 1138 dabacky clamp 1139 vascular sling (arterial venous) 1140 liga clip applicator 1141 (i) lt 100 1142 (ii) lt200 1143 (iii) lt300 1144 (iv) lt400 1145 clip catridge box 1146 periosteum elevator 6 1147 cascular forceps 6 1148 bab cock tissue holding forceps 6 1149 chiesel with hammer 1150 howarths periosteum dissector 1151 skin grafting handle humby knife with ss 1152 case 1153 liposuctin instruments set 1154 (i) infiltrating canula 12 1155 (ii) suction canula single hole 12 1156 (iii) suction canula 3 hole 12 1157 suction canula 5 hole 1158 howarth elevator 1159 cryer elevator right & left in pair 1160 molt elevator 1161 austin tissue retractor regular 1162 coupand elevator 1163 harwick james elevator straight 1164 root tip elevator 1165 lucas currettes d/f 1166 mouth props set of 3 1167 scissor northbent suture cutting 1168 aluminum general box anodized small 1169 superior ramus separater (smith) 1170 rowe orbital floor retractor rigt & left 1171 self retaining mostoid retractor 6 1172 candyle retractor double ended 1173 periosteal elevator fiber handle 2 shapes 1174 warwick james elevator right & left 1175 forked ramus retractor 1176 tmj spreading forceps 1177 reduction bone hlding forceps pointed 6 1178 hayton willam forceps forward traction 1179 rowe maxilla disimpaction forceps right & left 1180 gillies skin hook flat handle 1181 gillies skin hook round handle 1182 kilner skin hook 1183 double hook skin retractor 1184 cottle elevator graduated 1185 farabeuf rugine curved 1186 septum elevator 1187 aufricht nasal retractor solid 1188 kilner alae retractor 1189 senn retractor 1190 davis double ended retractor 1191 fine chisels 2mm, 4mm 1192 nasal septum osteotomes with guard u shape 1193 cottle osteotome (halfmoon) 1194 fine osteotome 4mm 1195 fine osteotome 6mm 1196 nasal chisel with guard 4mm right & left 1197 fine gauge 3mm 1198 najeck septum elevator 1199 bone file double ended 1200 asch nasal septum forceps big 1201 walsham nasal septum forceps right & left 1202 periosteal elevator fiber handle 1203 bone cutting forcfeps double action curved 5.5 1204 bone nibbler double action curved 5.5 1205 tessier osteotome straight 5mm 1206 tessier osteotome straight 10mm 1207 tessier osteotome straight 15mm 1208 tessier osteotome curved 10mm 1209 fine osteotome straight 4mm 1210 fine osteotome straight 6mm 1211 fine osteotome straight 8mm 1212 fine osteotomes curved 6mm 1213 nylon faced hammer medim 1214 clipers castroviejo 1215 bone trephine medium 1216 catrilage crusher rectangular shape 1217 pterigoidous chisel 10mm 1218 zygomatic bone awl 6 1219 mandibular awl set of 5 1220 kelsey fry bone awl fiber handle 1221 poawillo malar hook 1222 stacey zygomatic bone hook 1223 wire twisting forceps 1224 wire cutter regular 1225 kilner skin retractor (catspaw) 1226 crile artery forcpes 6 curved 1227 schanz screws for micromotor 2.35mm x 3 1228 min screws ss 2,, x 8, 10mm 15each 1229 self holding screw driver 2mm 1230 ordinary screw driver 2mm 1231 screw / plate holding forceps 1232 s.s. drill bits for micromotor 1.5mm 1233 piler 1234 intraoral distractor for mandible 20mm right & left 1235 intraoral distractor for vertical 3+3 holes 1236 intraoral ramus distractor 15mm & 20mm 1237 external mandibular distractor uni directional 1238 external mandible districtor bi directional 1239 activator for intraoral distractor (fixed) 1240 activator for intraoral distractor (hinged) 1241 activator for intraoral distractor (box type) 1242 screw driver for external distractor (hexagonal) 1243 wrench for external distractor 1244 container box with screw tray 1245 ttanium bone planttes without bar 1246 tinanium bone plate with bar 1247 titanium mandible angle plate 1248 titanium mandibularreconstructiob plates primry 1249 titanium screws 1250 titanium screws single slotted 1251 titanium emergency screws 1252 titanium emergency screws single slotted 1253 s.s. drill bits for micromotor 1254 s.s. drill bists for micromotor short flute 1255 vascular doppler 1256 loupe 4.5x 1257 nerve stimulator 1258 reciprocating saw 1259 micro motor with handle piece drill bits size 1.5 1260 micro motor with handle piece drill bits size 2 1261 micro motor with handle piece drill bits size 2.5 1262 elite ii rail clamp joints 18 1263 bilateral crossbar hinged 34 11½x8½x11½ 1264 angled arm 18 8x10 1265 angling micro adjustable blade holder 10 1266 angling micro adjustable blade holder 7¾ 1267 angling blade holder 8 1268 container with silicon mat 1269 angling wrench 1270 malleable finger 4 sl 1271 soft malleable blade size 25mm x 102mm 1272 malleable blade size 13mm x 203mm sl 1273 kelly blade size 38mm x 51mm (1½ x 2) sl 1274 richardson blade size 19mm x 51mm (¾ x 2) sl 1275 balfour blade size 76mm x 51mm (3 x 2) sl 1276 balfour blade size 51mm x 51mm (2 x 2) sl 1277 richardson blade size 51mm x 102mm (2 x 4) sl 1278 harrington blade size 38mm x 127mm sl 1279 elite ii rail clamp joints 18 1280 bilateral crossbar hinged 34 11½x8½x11½ 1281 angled arm 24 8x16 1282 angling micro adjustable blade holder 10 1283 angling micro adjustable blade holder 7¾ 1284 angling blade holder 8 1285 container with silicon mat 1286 angling wrench 1287 balfour blade without lips size 70mm x 76mm 1288 balfour blade without lips size 83mm x 76mm 1289 kelly blade size 64mm x 76mm 1290 kelly blade size 76mm x 89mm 1291 malleable blade size 51mm x 203mm 1292 deaver blade size 51mm x 127mm 1293 harrington blade size 64mm x 152mm 1294 malleable finger blade size 6 1295 lower abdominal bar 10 x 8 1296 memory garrett vascular dilator/vessel probe, 1 mm, 5 ½” / 14 cm 1297 memory garrett vascular dilator/vessel probe, 1.5 mm, 5 ½” / 14 cm 1298 memory garrett vascular dilator/vessel probe, 2 mm, 5 ½” / 14 cm 1299 memory garrett vascular dilator/vessel probe, 2.5 mm, 5 ½” / 14 cm 1300 krayenbuhl micro nerve and vessel hook, small, 7 1/4 / 18.5 cm 1301 krayenbuhl micro nerve and vessel hook probe, pointed large, 7 1/4 / 18.5 cm firm sale 1302 jacobson micro needle holder, round handle, extended 10 mm diameter knurling, with ratchet, straight diamond dust™ jaws, regular boxlock, 7 / 18 cm 1303 jacobson micro scissors, spring style, round handle, 45° angled micro fine blades, 6 3/4 / 17 cm 1304 jacobson micro scissors, spring style, round handle, 125° angled micro fine blades, 6 1/2 / 16.5 cm 1305 micro needle holder, round handle, with ratchet, straight diamond dust™ jaws, regular box lock, 8 1/4 / 21 cm 1306 dennis micro forceps, round handle, 1 mm straight diamond dust™ ring tips, 7 1/4 / 18.5 cm 1307 diethrich potts scissors, 45° angled micro fine super cut™ blades, black platinum ring handles, 7 / 18 cm 1308 diethrich potts scissors, 125° angled micro fine super cut™ blades, black platinum ring handles, 7 / 18 cm 1309 debakey dissecting forceps, flat handle, 1 mm straight tips, 7 ¾ / 19.5 cm 1310 metzenbaum scissors, curved super cut™ blades, black platinum ring handles, 7 / 18 cm 1311 stevens tenotomy scissors, curved super cut™ blades, black platinum ring handles, 7 / 18 cm 1312 diethrich potts scissors, 45° angled fine super cut™ blades, black platinum ring handles, 7 / 18 cm 1313 debakey needle pulling tissue forceps, flat handle, 2 mm carbon inlay tips, 7 1/2 / 19 cm 1314 jacobson heavy style needle holder (for large needles), round handle, with ratchet, straight diamond dust™ jaws, 9 / 23 cm 1315 castaneda clamp, 70° angled jaws, 4 3/4 / 12 cm firm sale 1316 castaneda clamp, curved jaws, 6 / 15 cm firm sale 1317 castaneda clamp, slightly curved jaws, 6 / 15 cm firm sale 1318 castaneda clamp, 30° angled jaws, 5 1/4 / 13.5 cm 1319 jacobson micro needle holder, round handle, with ratchet, straight diamond dust™ jaws, streamline box lock, 8 1/4 / 21 cm 1320 jacobson micro needle holder, round handle, with ratchet, straight diamond dust™ jaws, regular box lock, 7 1/4 / 18.5 cm 1321 jacobson micro needle holder, round handle, extended 10 mm diameter knurling, with ratchet, straight diamond dust™ jaws, regular boxlock, 7 / 18 cm 1322 micro forceps, lightweight round handle, straight diamond dust™ platform tips, 8 1/4 / 21 cm 1323 gerald debakey forceps, flat handle, 1 mm debakey tips, 8 / 20 cm 1324 resano forceps, flat handle, multi toothed tips, 9 / 23 cm 1325 debakey forceps, flat handle, 2 mm tips, 7 3/4 / 19.5 cm 1326 metzenbaum scissors, curved super cut™ blades, black platinum ring handles, 9 / 23 cm 1327 lillehei potts scissors, curved super cut™ blades, sharp tips, black platinum ring handles, 7 / 18 cm 1328 jacobson micro needle holder, round handle, with ratchet, straight diamond dust™ jaws, streamline box lock, 8 / 20 cm 1329 dennis multi purpose clamp, 2x3 debakey jaws, 8 1/2 / 21.5 cm 1330 dennis multi purpose clamp, 8 cm atraumatic jaws, 8 / 20 cm 1331 dennis peripheral vascular clamp, 6 cm atraumatic jaws, 8 / 20 cm 1332 baby vascular clamp, 45º angled jaws, 5 3/4 / 14.5 cm 1333 pollock aortic clamp, 8 cm atraumatic jaws, 10 / 25.4 cm 1334 multi purpose clamp, 6 cm 60° angled atraumatic jaws, 9 / 23 cm firm sale 1335 anastomosis clamp, 3.5 cm atraumatic jaws, 8 1/2 / 21.5 cm firm sale 1336 multi purpose clamp, 7.5 cm 60° angled atraumatic jaws, 9 / 23 cm ...

Ministry Of Coal - Jharkhand

27360477 bids are invited for binocular indirect ophthalmoscope (rbsk)years of past experience required 3 year (s)mse exemption for years of experience yesstartup exemption for years of experience yes total quantity : 1...

National Health Mission - Jharkhand

27325515 tender for dental chair advance and vision center air rotor , ultrasonic oil free medical grade , suction fitted in the dental chair , air rotor hand piece contra angle , led light cure unit , diathermy bipolar , dental x ray iop/opg x ray viewer with led light , fully loaded dental chair electrically operated , electronic dental chair with adequate accessories , autoclave , instruments for manual cleaning of teeth , restorative , impression trays , root canal instrument set , mouth mirror , straight probe , curved probe , tweezer , surgical complete kit set , surgical complete kit set , periosteal elevator , surgical elevator complete , morter pestle , dappen dish , monovalent chisel and mallet , x ray developer and fixer chamber , rubber bowl large , glass slab , kidney tray , retainer , pedo extraction forcep complete set , restorative material , zinc oxide eugenol , calcium hydroxide paste , calcium hydroxide paste , gic restorative material , gic lutting material , composite filling material set , amalgam , alginate , dental stone , dental plaster , formocresol , millor strip , suction tip , opd equipment ophthalmoscope , streak retinoscope , colour vision chart , distant vision chart , near vision harts , a scan bio meter , keratometer , auto refractometer , auto refractometer , punctum dilator , punctum dilator , rotating visual acuity dru , applanation tonometer , torch, fundus camera , tonometers , direct ophthalmoscope, illuminated vision testing drum , trial lens set with trail frames, snellen and near vision charts , , battery operated torch , ot eye , operating microscope , a scan biometer , keratometer , silt lamp , auto refractometer , flash autoclave , streak retinoscope , tonometers , direct ophthalmoscope , illuminated vision testing drum , battery operated torch , acyclovir ointment , gentamycin drops , gentamycin injection , providone iodine drop , pilocarpine nitrate , timolol drop , homatropine , caboxyethylcellulose drops , injections , xylocaine , , gentamycin , bethamethasone , ringer locate , surgical accessories gauze , green shades , blades , opposite surgical gauze , double needle suture , visco elastics from reputed firm etc ...

Patliputra Medical College - Jharkhand

26562798 purchase machine equipment eye 1.1 anterior vitrectomy set.specification : cut rate single, 60 to 5040 cuts per minutes * surgical type standard & dual linear control of rate via foot switch *diathermy: surgical instrument bipolar forceps & endo eraser * surgical type: compatible both endo & exo diathermy * irrigation: *gravity fed *motorized & manual iv pole * aspiration type compressor feed 5 600mm of hgcertication european ce/fda(us) 2.0 specular microscope with pachymeter for (cadaver cornea ).specification :• type non contact objective lens.• field of view 450μmx500μm• ccd camera monochrome• illumination halogen lamp, 6v 20w• power 110/220v 60/50 hz• weight 10 lb (4.55 kg)• dimensions 7.25x 9 x17.75certification european ce/fda(us) 3.0 perkin’s tonometer 4.0 a b scan a b scan should be compact in design with colour touch panel. b scan: should produce high quality images for accurate analysis. accurate axial length and corneal thickness measurements in either automatic or manual modes. should have minimum : probe: 10mhz transducer, 10 frames/ second scan angle: 60°, scan depth: normal (35mm. 1550m/s), long (50mm/ 1550m/s), sector line density: 400lines, zoom: x2.5, x5.0. biometry: should use algorithms, axial length measurements and iol power calculation at high speed. measurement accuracy for dense cataract and existing opacities. probe: 10mhz solod probe. internal fixation: led(red), measurement value: axial length, anterior chamber depth, lens thickness, vitreous body length: accuracy 0.1mm, range: 12 to 40 mm, option of upgrade for pachymetry. usb and lan interfaces for easy data storage. internal printer. 5.0 ac maintainer 6.0 cataract knife (sliding) for teaching purpose 7.0 calibri forceps, titanium 8.0 capsule polisher, titanium 9.0 enucleation spoon, titanium 10.0 corneal extension scissors left, titanium 11.0 corneal extension scissors right, titanium 12.0 lens dialer, titanium 13.0 rhexis forceps, titanium 14.0 streak retinoscope 15.0 ophthalmoscope ...

Department Of Health - Jharkhand

26304786 rate contract for machine item 2 1 tray instrument/dressing with cover item1 1 nos 3 2 forceps, backhaus towel, (130 mm (tungsten carbide tip anti rust quality) item2 1 nos 4 3 forceps, sponge holding, (228 mm (tungsten carbide tip anti rust quality) item3 1 nos 5 4 artery forceps (straight 140 rnrn (titanium) item4 1 nos 6 5 artery forceps (straight 180 mm (titanium) item5 1 nos 7 6 artery forceps (curved 140 rnrn (titanium) item6 1 nos 8 7 artery forceps (curved 180 mm (titanium) item7 1 nos 9 8 forceps, hemostatic, halsteads mosquito, straight, (125 mrn ss (tungsten carbide tip anti rust quality) item8 1 nos 10 9 knife handle (surgical for minor & major surgery # 3 (ss anti rust quality) item9 1 nos 11 10 knife handle (surgical for minor & major surgery # 4 (ss anti rust quality) item10 1 nos 12 11 knife blade (surgical, size 11 for minor surgery (ss anti rust quality) item11 1 nos 13 12 knife blade (surgical, size 15 for minor surgery (ss anti rust quality) item12 1 nos 14 13 knife blade (surgical, size 22 for major surgery (ss anti rust quality) item13 1 nos 15 14 needles, suture triangular point, (7.3 cm) item14 1 nos 16 15 cheatles forceps item15 1 nos 17 16 cuscos speculum (medium) item16 1 nos 18 17 cuscos speculum (large) item17 1 nos 19 18 sharp and blunt curette item18 1 nos 20 19 ovum forceps item19 1 nos 21 20 oral airway item20 1 nos 22 21 needles, suture, round bodied, (3/8 circle no. 12) item21 1 nos 23 22 plain forceps ( 8 (tungsten carbide tip anti rust quality) item22 1 nos 24 23 tooth forceps ( 8 (tungsten carbide tip anti rust quality) item23 1 nos 25 24 kidney tray (8) item24 1 nos 26 25 kidney tray (10) item25 1 nos 27 26 cord cutting scissor (ss (titanium) item26 1 nos 28 27 scissors, operating curved mayo blunt pointed (170 mm (tungsten carbide tip anti rust quality) item27 1 nos 29 28 scissor operating straight (230 mm (tungsten carbide tip anti rust quality) item28 1 nos 30 29 scissor, gauze, straight (230 rnrn, ss (titanium) item29 1 nos 31 30 bowl, metal sponge ( 600 rnl, ref. is: 5782) item30 1 nos 32 31 drum, sterilizing cylindrical (275 mm oia x 132 rnrn, ss as per is:) item31 1 nos 33 32 foetoscope item32 1 nos 34 33 kellys pad ( for labour and ot table set) item33 1 nos 35 34 thermometers (para) item34 1 nos 36 35 thermometers (digital) item35 1 nos 37 36 b.p. instruments (portable) item36 1 nos 38 37 measuring tape item37 1 nos 39 38 glucometer item38 1 nos 40 39 ambu bag (baby) (silicon) item39 1 nos 41 40 sahlis haemoglobinometer item40 1 nos 42 41 airway guedel or berman, autoclavable rubber item41 1 nos 43 42 endotracheal catheter (w/cuff, rubber) item42 1 nos 44 43 breathing tubes, hoses, connectors for item 1, (anti static) item43 1 nos 45 44 tcdc count apparatus item44 1 nos 46 45 counting chamber item45 1 nos 47 46 esr stand with tubes item46 1 nos 48 47 test tube stands item47 1 nos 49 48 test tube rack item48 1 nos 50 49 test tube holders item49 1 nos 51 50 spirit lamp item50 1 nos 52 51 forceps obstetric (wrigleys, 280 mm, stainless steel (titanium) item51 1 nos 53 52 speculum vaginal bi valve (cusco medium, (ss anti rust quality) item52 1 nos 54 53 speculum, vaginal, sims double ended # 3 (ss anti rust quality) item53 1 nos 55 54 forceps obstetric, wrigleys ( 280 mrn, stainless steel (tungsten carbide tip) item54 1 nos 56 55 forceps, vulselium, duplay double cured, 280 mm ss ((tungsten carbide tip) item55 1 nos 57 56 sound, uterine, simpson (300 mm with 200 mm graduations (ss anti rust quality) item56 1 nos 58 57 dilator, uterine, double ended hegar (set of 5 (ss anti rust quality) item57 1 nos 59 58 curette, uterine, sims blunts (titanium) item58 1 nos 60 59 anterior vaginal wall retractor stainless ((ss anti rust quality) item59 1 nos 61 60 clamp intestinal, doyen ( curved 225 mrn, ss) item60 1 nos 62 61 clamp intestinal, doyen ( straight 225 rnrn, ss) item61 1 nos 63 62 uterine elevator (ranathlbod) ( ss) item62 1 nos 64 63 bag, reathing, self inflating (anti static rubber, set of 4) item63 1 nos 65 64 b.p. instruments with stand item64 1 nos 66 65 timer stop watch item65 1 nos 67 66 3 fold reclining bed manually item66 1 nos 68 67 weighing machine baby electronic (5 kg capicity with fiber tray) item67 1 nos 69 68 fetal monitor (ctg monitor) (with installation & 1 yrs. warrenty) (specification should be attached in technical bid turms & condition) item68 1 nos 70 69 ecg machine (12 chennel) (with installation & 1 yrs. warrenty) (specification should be attached in technical bid turms & condition) item69 1 nos 71 70 semi auto analiser (with installation) (specification should be attached in technical bid turms & condition) item70 1 nos 72 71 micro scope binoculor (with installation) (specification should be attached in technical bid turms & condition) item71 1 nos 73 72 cardiac monitor with defribillator (with 1 yrs. warrenty) (specification should be attached in technical bid turms & condition) item72 1 nos 74 73 cardiac table item73 1 nos 75 74 oxygen cylender stand with trolly item74 1 nos 76 75 auto clave (elec.) dubble drum 6x12 item75 1 nos 77 76 b.p. instrument digital item76 1 nos 78 77 electronic strailiser 6x8 item77 1 nos 79 78 electronic straliser 8x10 item78 1 nos 80 79 electronic straliser 10x12 item79 1 nos 81 80 auto clave (elec.) dubble drum 4x10 item80 1 nos 82 81 dressing drum small 9x9 item81 1 nos 83 82 dressing drum big 12x15 item82 1 nos 84 83 delivery table (72x24x3) power coated item83 1 nos 85 84 ambu bag silicon adult item84 1 nos 86 85 electric strailiser foot oprated big item85 1 nos 87 86 fetal doppler machine digital item86 1 nos 88 87 fetal doppler machine table model item87 1 nos 89 88 thump forcep with tooth (titanium) item88 1 nos 90 89 thump forcep without tooth (titanium) item89 1 nos 91 90 straight cocker (titanium) item90 1 nos 92 91 curve cocker (titanium) item91 1 nos 93 92 green armittage (titanium) item92 1 nos 94 93 alis forcep 6 (titanium) item93 1 nos 95 94 alis forcep 8 (titanium) item94 1 nos 96 95 outlet forcep (titanium) item95 1 nos 97 96 kocchers forcep (titanium) item96 1 nos 98 97 tissue forcep 6 (titanium) item97 1 nos 99 98 tissue forcep 8 (titanium) item98 1 nos 100 99 stethoscope (best quality) item99 1 nos 101 100 paediatric stethoscope (best quality) item100 1 nos 102 101 baby tray (ss , ce inbuild) item101 1 nos 103 102 x ray film processing tank 9 lit. item102 1 nos 104 103 x ray film processing tank 13.5 lit. item103 1 nos 105 104 oxygen flow meter (best quality) item104 1 nos 106 105 examination table with matress (72x24x3) (iron) item105 1 nos 107 106 pulse oxymeter (multi para) (with installation & 1 yrs. warrenty) (8.5 tft display with ecg) item106 1 nos 108 107 centrifuge machine for blood storeg unit (with installation & 1 yrs. warrenty) item107 1 nos 109 108 besin boul (with stand) item108 1 nos 110 109 foot step (2 step) item109 1 nos 111 110 bed side screen with cloth (1 round pipe with wheel) item110 1 nos 112 111 salin stand with wheel with four hook (ss) item111 1 nos 113 112 nsv kit set (ss) item112 1 nos 114 113 streture trolly (85x22x32 power coated with matress) item113 1 nos 115 114 cotton folding strecher for ambulance (best quality) item114 1 nos 116 115 weighing machine adult (best quality) item115 1 nos 117 116 bed side locker (best quality) item116 1 nos 118 117 hospital bed (best quality) (general) item117 1 nos 119 118 semi fowler bed (best quality) with abs system (72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated) item118 1 nos 120 119 fowler bed (best quality) with abs system (72x36x19, 16 g for head & leg side • finish: pretreated & epoxy powder coated) item119 1 nos 121 120 circle absorber with soda lime (for boyles apparatus ) item120 1 nos 122 121 portable oxygen cylinder (best quality) item121 1 nos 123 122 suction machine for ot item122 1 nos 124 123 trial box , trial frame, lens, metal rim (205x6 cye) (complete set (for ophthalmic) item123 1 nos 125 124 baby weighing machine digital item124 1 nos 126 125 high vaccum suction machine item125 1 nos 127 126 trial frame adult (for ophthalmic) item126 1 nos 128 127 trial frame children (for ophthalmic) item127 1 nos 129 128 self illuminated retinoscope (for ophthalmic) item128 1 nos 130 129 ophthalmoscope (for ophthalmic) item129 1 nos 131 130 conjunctival scisser (for ophthalmic) item130 1 nos 132 131 corneal scisser (for ophthalmic) item131 1 nos 133 132 dilar (for ophthalmic) item132 1 nos 134 133 simko 21 no guage (for ophthalmic) item133 1 nos 135 134 f.b. spnd (for ophthalmic) item134 1 nos 136 135 90 d lens (for ophthalmic) item135 1 nos 137 136 fluorrescein strip (for ophthalmic) item136 1 nos 138 137 iucd kit item137 1 nos 139 138 minilap kit item138 1 nos 140 139 water bath (pathology department) n(• should have double walled chamber made of stainless steel and outer wall made of thick mild steel sheet duly powder coated.n• should have concentric rings are also made of stainless steel.n• should have temperature co item139 1 nos 141 140 hot air sterilizer (oven) digital nconstruction: novens are sturdy, with double walled construction. inner chamber is made of highly polished stainless steel. outer chamber is made of mild steel sheet duly pre treated in seven tanks process for surface item140 1 nos 142 141 pulse oxymeter baby (finger tip) ntype: blood pressure monitornpower supply: batterynsize: 57(l) * 33(w) * 32 (h) mmn item141 1 nos 143 142 pulse oxymeter adult (table top) nbuilt in rechargeable li polymer battery for uninterrupted monitoringncompact and flexible appearance, easy for carrying and be suitable for indoor and outdoor (in ambulance) monitoringnwith user friendly interfacendispl item142 1 nos 144 143 nebuliser nshould be lightweight, portable and compact.n should have a dust filter.n should be able to deliver a flow rate = 7 lpmn should h ave air pressure = 35 psi.n should have a check valve to protect the device against contamination due tonbackward item143 1 nos 145 144 fumigation machine ninput power : 220 vac, 3.5 amp, 50hznconsistant particle size generation : 5 15 microns vmdnreach : 20 30 ft distance & 18 20 ft height.nspace treatment : up to 7000 cuft & even larger.nnozzle assembly : non rotating vortex design ,non item144 1 nos 146 145 otoscope n1. should be a convenient pocket type otoscope.n2. should be provided with a halogen light source.n3. should be able to detach the otoscope head.n4. should provide no reflections and obstructions.n5. should provide detachable accessories of var item145 1 nos 147 146 straight needle item146 1 nos 148 147 o.t. table hydrolic ss (best quality) item147 1 nos 149 148 focus light led (spot light) item148 1 nos 150 149 slippers per pair (rubber) item149 1 nos 151 150 laboratory autoclaves item150 1 nos 152 151 pulse oxymeter , pulse spo2 item151 1 nos 153 152 infusion pump item152 1 nos 154 153 vacuum extractor metal (best quality) item153 1 nos 155 154 head box for oxygen (best quality) item154 1 nos 156 155 tuning fork (best quality) item155 1 nos 157 156 examination instruments set (speculums, tongue dipressors, mirrors, bulls lamp) (best quality) item156 1 nos 158 157 cervical biopsy set (best quality) item157 1 nos 159 158 endometrial biopsy set (best quality) item158 1 nos 160 159 vaginal hysterectomy set (best quality) item159 1 nos 161 160 g.i. operation set (best quality) item160 1 nos 162 161 uretheral dilator set (best quality) item161 1 nos 163 162 stomach wash equipment (best quality) item162 1 nos 164 163 emergency resuscitation kit adult (best quality) item163 1 nos 165 164 air way 0, 1, 2, 3, 4 adult item164 1 nos 166 165 air way peadiartric item165 1 nos 167 166 tongue depressors item166 1 nos 168 167 02 cylinder for boyles item167 1 nos 169 168 n20 cylinder for boyles item168 1 nos 170 169 wheel chair (ss) folding item169 1 nos 171 170 nibulisyer adult with mask item170 1 nos 172 171 nibulisyer child with mask item171 1 nos 173 172 nibulisyer mask for adult item172 1 nos 174 173 nibulisyer mask for child item173 1 nos 175 174 anaesthesia work station (include anaesthesia machine with vaporiser, ventilator, monitor) item174 1 nos 176 175 boyles machine, brain circuit, jr item175 1 nos 177 176 magills forceps item176 1 nos 178 177 blood transfusion set (best quality) item177 1 nos 179 178 back rest item178 1 nos 180 179 medicine trolley (ss) item179 1 nos 181 180 basin assorted (ss) item180 1 nos 182 181 basin stand assorted (ss) (2 basin type) item181 1 nos 183 182 bed pan (ss) item182 1 nos 184 183 urinal female item183 1 nos 185 184 urinal male item184 1 nos 186 185 waste disposal bin/drums item185 1 nos 187 186 waste disposal trolley (ss) item186 1 nos 188 187 diet trolley stainless steel item187 1 nos 189 188 doctors overcoat item188 1 nos 190 189 hospital worker overcoat item189 1 nos 191 190 patients housecoat for female item190 1 nos 192 191 patients paiiarna (for male) shirt item191 1 nos 193 192 mouth mirror item192 1 nos 194 193 waste disposal colour coded polybags (black, red, yellow, blue) item193 1 nos 195 194 waste disposal colour coded buckets swine bing 60 ltr. (black, red, yellow, blue) (neelkamal, cello, suprem, nayasa) item194 1 nos 196 195 waste disposal colour coded buckets swine bing 30 ltr. (black, red, yellow, blue) (neelkamal, cello, suprem, nayasa) item195 1 nos 197 196 rubber/plastic sheet (4 sets of 2.5 m x 2 = 20 meter for each facility) item196 1 nos 198 197 tharmometer item197 1 nos 199 198 nasogastric tube (8, 10, 12 fg) item198 1 nos 200 199 flow meter with humidifier bottle item199 1 nos 201 200 bed side locker (fully ss) (best quality) item200 1 nos 202 201 instrument trolly (best quality) item201 1 nos 203 202 central patient monitoring station item202 1 nos 204 203 bronchoscope item203 1 nos 205 204 adjustable walker item204 1 nos 206 205 dynaplast item205 1 nos 207 206 bipap machine item206 1 nos 208 207 plastic tray bigh heavy item207 1 nos 209 208 plastic box big heavy with led item208 1 nos 210 209 gas roti bhatta big 4 fit item209 1 nos 211 210 potato pealer machine 20 ltr. item210 1 nos 212 211 x rey hanger 12x15 item211 1 nos 213 212 x rey hanger 12x12 item212 1 nos 214 213 x rey hanger 12x10 item213 1 nos 215 214 x rey hanger 8x10 item214 1 nos 216 215 x rey grid (lead) 12x15 item215 1 nos 217 216 x rey grid (lead) 10x12 item216 1 nos 218 217 mva aspirator item217 1 nos 219 218 glass pippette item218 1 nos 220 219 forceps, uterine nelaton solid tip one eye ((tungsten carbide tip) item219 1 nos 221 220 suction tube (225 rnrn, ss) item220 1 nos 222 221 valve inhaler (chrome plated brass, y shape) item221 1 nos 223 222 intravenous (set in box) item222 1 nos 224 223 needle spinal stainless (set of 4) item223 1 nos 225 224 syringe, anesthetic (control 5 ml luer mount glass) item224 1 nos 226 225 head light (ordinary) (boyle davis) item225 1 nos 227 226 beds semi recilining item226 1 nos 228 227 32 lcd telivision item227 1 nos 229 228 led tv 42’’ item228 1 nos 230 229 cd player (home theater with 5 sound box) item229 1 nos 231 230 domestic refrigetor 190 ltr. item230 1 nos 232 231 feeding equipments (tubes, katoris & spoon) item231 1 nos 233 232 channel semi automatic coaglomater with regent item232 1 nos 234 233 all types of dental extraction forceps (each set 3 sets minimum required which includes upper and lower molars and anterior forceps. item233 1 nos 235 234 x ray machine 100 ma with dark room assoseries (with installation & 1 yrs. warrenty) (specification should be attached in technical bid turms & condition) item234 1 nos 236 235 standalone color doppler machine (specification should be attached in technical bid turms & condition) item235 1 nos 237 236 portable ultra sound with pw (with installation & 1 yrs. warrenty) (specification should be attached in technical bid turms & condition) item236 1 nos 238 237 portable cooling unit (vaccine / blood bags) (specification should be attached in technical bid turms & condition) item237 1 nos 239 238 o.t light (dichroic reflector) (with installation & 1 yrs. warrenty) (specification should be attached in technical bid turms & condition) item238 1 nos 240 239 hospital bed (ss head & foot side rod) (specification should be attached in technical bid turms & condition) item239 1 nos 241 240 led light (single) (with installation & 1 yrs. warrenty) (specification should be attached in technical bid turms & condition) item240 1 nos 242 241 ultra high speed laboratary centrifuge (specifications attached) item241 1 nos 243 242 digital incubator (specifications attached) item242 1 nos 244 243 boyles machine (specifications attached) item243 1 nos 245 244 72 led dome (double dome), lux 1,30,000 (+ 10%), central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. item244 1 nos 246 245 48 led dome (single dome) , lux 1,00,000 (+ 10%), central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. item245 1 nos 247 246 coutery machine (400 w) item246 1 nos 248 247 coutery machine (250 w) item247 1 nos 249 248 portable o.t. light (abs doom 19 single reflecter polycarbonate) item248 1 nos 250 249 portable o.t. light led item249 1 nos 251 250 vaccu suck suction tube (titanium) (for suction machine) item250 1 nos 252 251 alis forcep 10 (titanium) item251 1 nos 253 252 tissue forcep 10 (titanium) item252 1 nos 254 253 convex array tranducer c343ua (for ultra sound machine) item253 1 nos 255 254 phototherephy unit single surface (stand model) item254 1 nos 256 255 phototherephy unit single surface led (with led buld) item255 1 nos 257 256 silent genrator 10 kva (with installation) (10 kva, 3 phase, water cooled) item256 1 nos 258 257 silent genrator 15 kva (with installation) (15 kva, 3 phase, water cooled) item257 1 nos 259 258 silent genrator 20 kva (with installation ) (20 kva, 3 phase, water cooled) item258 1 nos 260 259 silent genrator 50 kva (with installation) (50 kva, 3 phase, water cooled) item259 1 nos 261 260 silent genrator 82 kva (with installation ) (82 kva, 3 phase, water cooled) item260 1 nos 262 261 magil circuit with mask (for boyles apparatus ) item261 1 nos 263 262 patho fast test kit (for patho fast machine) item262 1 nos 264 263 blood gas analyser test kit (for blood gas analyser) item263 1 nos 265 264 dossimeter item264 1 nos 266 265 peak expiritory flow meter (best quality) item265 1 nos 267 266 laryngoscope fibreoptic ent (best quality) item266 1 nos 268 267 p.v. tray (best quality) item267 1 nos 269 268 varicose vein set (best quality) item268 1 nos 270 269 connector set of six for en (best quality) item269 1 nos 271 270 tubes connecting for en (best quality) item270 1 nos 272 271 leqqinqs item271 1 nos 273 272 explorar item272 1 nos 274 273 endo explorar item273 1 nos 275 274 amalgam carrier in sliver item274 1 nos 276 275 murcury ball burnisher item275 1 nos 277 276 carver (dimond) item276 1 nos 278 277 compactor item277 1 nos 279 278 element carrier item278 1 nos 280 279 gic (glass ionomer cement) item279 1 nos 281 280 zinc phosphate cement item280 1 nos 282 281 temporary filling material item281 1 nos 283 282 electric ventouse item282 1 nos 284 283 radient baby warmer item283 1 nos 285 284 right angel artry 4 item284 1 nos 286 285 right angel artry 6 item285 1 nos 287 286 automated autoref stand (for ophthalmic) item286 1 nos 288 287 2 mirror cronioscope (for ophthalmic) item287 1 nos 289 288 disposable needle 26 g (for ophthalmic) item288 1 nos 290 289 ppiucd forcep item289 1 nos 291 290 uterus collection (sister u and mama u) item290 1 nos 292 291 water cooler with purifire (120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap item291 1 nos 293 292 water cooler with purifire (80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap item292 1 nos 294 293 water cooler with purifire (40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap item293 1 nos 295 294 hemoglobinometer (1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g/dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd/us fda/ iso approved 6. automatic correction of hb. 7. 20 item294 1 nos 296 295 digital x rey film (konika) 8x10 item295 1 nos 297 296 digital x rey film (konika) 10x12 item296 1 nos 298 297 digital x rey film (konika) 12x12 item297 1 nos 299 298 digital x rey film (konika) 12x15 item298 1 nos 300 299 coin operated water atm machine (ro plant and chiller) nspecificationn· power : 100 270vac · solenoid: 12vdc (internal) · flow sensor: pulse type· level sensing: treated water level floatyn· display: 2.8 tft, monochrome · programming keys: 5 · activation item299 1 nos 301 300 water atm machine • easy to use and lend a lot of conveniencen• plug and play module kiosk can be installed in 3 hoursn• kiosk can produce up to 12000 liters of pure mineralized water per day, the lft units can produce 30,000 liters per day • automatic item300 1 nos 302 301 x ray digitalisation with high end cr system (with installation & 1 yrs. warrenty) nconsole software with multi modality work stationnthe cr system should have advanced workstation provided with 17” high resolution monitor, keyboard & mouse, with the fol item301 1 nos 303 302 x ray 500 ma (with 1 yrs. warrenty)nx ray genera tor: nhigh frequency x ray generator of frequency 40khz should be provided. npower output of generator should be of sokw. nkv range should be: n• radiographic kv: 40 to 12sky. n• fluoroscopic kv: 40 to 120k item302 1 nos 304 303 micro scope binoculor (with 1 yrs. amc) n(? stand: should be robust and sterile aluminum dye cast basen? observation: binocular tube should be inclined at 45deg and rotatable up to 360deg. mechanical tube length of 160mm.n? noise piece: quadruple revolvi item303 1 nos 305 304 electrolyte analyser n(principle: direct measurement with lon selective electrode (ise)nsample: 120 µl for whole blood, serum, plasma 700 µl for diluted (1:5) urinendata storage: 100 patients result qc up to 30 results of normal, low, and high each.noutput: item304 1 nos 306 305 suction machine foot operated n(powder coated m.s. chassis.nnoise level of suction apparatus from is 50 db +/ 03 db.nleakage current of suction units is less than 84 ua.nelectrical requirement – 220 ~ 230v, 50hz, 1 phase.nideal for mtp / medical / surgic item305 1 nos 307 306 suction apparatus (electric) nsuction machine with pump: power supply: 230 240v/50hz vacuum capacity: 18 litres/mim maximum depression: 75kpa ( 563mmhg) vacuum is created by a plastic piston and cylinder system, with four vacuum creating modules ( item306 1 nos 308 307 phototherapy unit n1 led phototherapy with intensity upto 6 50microwatts/nm/cumm/mwatt, adjustablenintensity.n2 .height adjustable and tiltable light unit.n3 digital time totaller of led usage time.n4 stainless steel tray.n5 –provision for double surf item307 1 nos 309 308 opthalmoscope n1. should be rechargeable battery with charger / mains operated.n2. should have halogen / led light sourcen3. should have red free filtersn4. should have small and large spot sizes, fixation targets, slit aperture, hemi spot and cobalt blu item308 1 nos 310 309 wireless indirect ophthalmoscope (led) (compact and light weight, stereo optical system has all pupil features rechargeable battery integrated on headbrilliant white light with uniform and well spread led illumination (focus distance : 300 800 mm, inter pupillary distance 50 74 mm, pupil size optics 1.00 mm, illumination : ledillumination item309 1 nos 311 310 dental chair n1. should be electrically operated with zero program.n2. should have a switch operated operating light with minimum two steps ofnintensity control.n3. should have auto water connection for spittoon and tumbler with auto fillingnsensor.n4. s item310 1 nos 312 311 pa system n(• recessed mount (ceiling), surface mount, column and / or horn speakers, 12 watts with inbuilt transformer ,wooden body ,pressure level 97db, range 200 15000hz, rated voltage 100v,impedence 833 amplifier rated voltage output 100v,150watts,mu item311 1 nos 313 312 token display system n(token dispenser with issue keys , thermal printer, calling unit with keys for calling next token number,token display unit for showing token on cabin outdoor,central led display unit for showing token number with cabin number conne item312 1 nos 314 313 cctv (32 dvr) n(32 dvr :processor high performance embedded microprocessor,operating system embedded linux, user interface gui, video input 32 channel, bnc, video output 1 hdmi, 1 vga, video standard analog:32ch. @1080n(1~15fps) , 24ch. @1080n, 16ch. @10 item313 1 nos 315 314 intercom n(24 extensions, expandable upto 32, micro controller based spc space division multiplexing, extension loop resistance : 600 ohms,noperating temperature : 0 c to 45 c, power consumption : max. 100 watts, operating voltage : 220v 10%)n item314 1 nos 316 315 av retractor n1.stainless steeln2.double ended, serratedn3.rust freen4.sturdy constructionn5.accurate dimensionsn item315 1 nos 317 316 vulcellum nstainless steelnsize: 10 inch ncolour: silver nshape: curvedn item316 1 nos 318 317 ppiucd forcep ss item317 1 nos 319 318 baby forceps ss ( big – straight) item318 1 nos 320 319 baby forceps ss ( big – curve) item319 1 nos 321 320 baby forceps ss ( big – straight) item320 1 nos 322 321 baby forceps ss ( small – curve) item321 1 nos 323 322 baby forceps ss ( small – straight) item322 1 nos 324 323 folis catheter 24 no item323 1 nos 325 324 lab incubator n1. should have 4 inch attractive lcd displayn2. should have intelligent controller to help maintain temperature in case of sensor failuren3. should have battery backup for temperature controllern4. should have auto tuning of controller item324 1 nos 326 325 electricentrifuge, table top (table top electric centrifuge) n1. should have stepless speed regulatorn2. should have safety lid interlock to prevent cover opening duringn centrifugation.n3. dynamic brake for quick decelerationn4. wide choice of swing out item325 1 nos 327 326 cbc machine (5 part blood cell counter machine) n1. should have throughput – 50 samples / hourn2. the sample volume should be < 17 µln3. should have technology – impedance (wbc,rbc,plt), spectrophotometry (hcg), should have optical laser method for 5 item326 1 nos 328 327 incubator for culture sensitivity item327 1 nos 329 328 hpcl machine n. system should be compact bench top hplc system.n2. system should use cation exchange hplc principle for estimation ofnstable a1c.n3. system should have built in computer with the system software andnmust be able to work independent of exte item328 1 nos 330 329 esr stand with tubes item329 1 nos 331 330 elisa reader cum washer item330 1 nos 332 331 glycosylated haemoglobinometer item331 1 nos 333 332 blood collection monitor item332 1 nos 334 333 intensifying screen x ray item333 1 nos 335 334 dossimeter item334 1 nos 336 335 peak expiritory flow meter (best quality) item335 1 nos 337 336 baby incubators (best quality) item336 1 nos 338 337 craniotomy (best quality) item337 1 nos 339 338 static vaccum extractor (best quality) item338 1 nos 340 339 head light (ordinary) (boyle davis) (best quality) item339 1 nos 341 340 ent operation set including headlight, tonsils item340 1 nos 342 341 ent nasal set (smr, septoplasty, nasal endoscopic set (00 & 300) polypetcomy, dns, rhinoplasty) (best quality) item341 1 nos 343 342 laryngoscope led (best quality) adult item342 1 nos 344 343 laryngoscope led (best quality) pediatric item343 1 nos 345 344 tracheostomy set (best quality) item344 1 nos 346 345 proctoscopy set adult (best quality) item345 1 nos 347 346 proctoscopy set peadiartric (best quality) item346 1 nos 348 347 p.v. tray (best quality) item347 1 nos 349 348 abdominal hysterectomy set (best quality) item348 1 nos 350 349 laparotomy set (best quality) item349 1 nos 351 350 varicose vein set (best quality) item350 1 nos 352 351 thomas splint (best quality) item351 1 nos 353 352 laproscopy set for cholecystectomy item352 1 nos 354 353 amputation set (best quality) item353 1 nos 355 354 colposcope (best quality) item354 1 nos 356 355 mouth prop item355 1 nos 357 356 regional anaesthesia devices, epidural set item356 1 nos 358 357 vascular clamp set (best quality) item357 1 nos 359 358 steel cup board item358 1 nos 360 359 case sheet holders with clip (ss) item359 1 nos 361 360 draw sheet item360 1 nos 362 361 pereneal sheets for ot item361 1 nos 363 362 explorar item362 1 nos 364 363 spoon excavator item363 1 nos 365 364 twizer item364 1 nos 366 365 endo explorar item365 1 nos 367 366 amalgam carrier in silver item366 1 nos 368 367 murcury ball burnisher item367 1 nos 369 368 carver (dimond) item368 1 nos 370 369 diathermy machine item369 1 nos 371 370 doyess (medium) item370 1 nos 372 371 gernes retractor item371 1 nos 373 372 metal catheter item372 1 nos 374 373 mayo scissor curved item373 1 nos 375 374 lma (adult) item374 1 nos 376 375 steel galipot small item375 1 nos 377 376 dressing drum size 9x11 item376 1 nos 378 377 sims vaginal speculam item377 1 nos 379 378 epsiotomy scissor item378 1 nos 380 379 ovum forcep item379 1 nos 381 380 tailor scissor item380 1 nos 382 381 doctor & nurse dress with designation (paijama & kurta) item381 1 nos 383 382 doynes retroctor 1.5” (german steel) each item382 1 nos 384 383 doynes retroctor 2” (german steel) each item383 1 nos 385 384 doynes retroctor 2.5” (german steel) each item384 1 nos 386 385 doynes retroctor 3” (german steel) each item385 1 nos 387 386 doynes retroctor 3.5” (german steel) each item386 1 nos 388 387 czernys retractor (german steel) each item387 1 nos 389 388 formalin chamber (20x8x8x5 mm) item388 1 nos 390 389 formalin chamber (26x8x8x5 mm) item389 1 nos 391 390 lifter with jar item390 1 nos 392 391 strraight scissor 5” (german steel) each item391 1 nos 393 392 strraight scissor 6” (german steel) each item392 1 nos 394 393 strraight scissor 7” (german steel) each item393 1 nos 395 394 strraight scissor 8” (german steel) each item394 1 nos 396 395 s.s. bowl 30 cm (super fine quality) each item395 1 nos 397 396 s.s. bowl 36 cm (super fine quality) each item396 1 nos 398 397 babcock clamp 6” (german steel) each item397 1 nos 399 398 babcock clamp 8” (german steel) each item398 1 nos 400 399 ambu bag adult (silicorised) (super fine quality) item399 1 nos 401 400 ambu bag child (silicorised) (super fine quality) item400 1 nos 402 401 artery forceps 6” curved (german steel) item401 1 nos 403 402 artery forceps 6” straight (german steel) item402 1 nos 404 403 mayo scissor long curved 6.5” each (german steel) item403 1 nos 405 404 mayo scissor long curved 7.5” each (german steel) item404 1 nos 406 405 tooth forceps 6” each (german steel) item405 1 nos 407 406 non tooth forceps 6” each (german steel) item406 1 nos 408 407 tenaculum long each (german steel) item407 1 nos 409 408 myome screw each (german steel) item408 1 nos 410 409 morrisen retractor each (german steel) item409 1 nos 411 410 sim speculum medium each (german steel) item410 1 nos 412 411 sim speculum long each (german steel) item411 1 nos 413 412 waste disposal colour coded buckets swine bing 80 ltr. (black, red, yellow, blue) (neelkamal, cello, suprem, nayasa) item412 1 nos 414 413 waste disposal colour coded buckets (black, red, yellow, blue) (neelkamal, cello, suprem) item413 1 nos 415 414 dust bin (ss) small (best quality) item414 1 nos 416 415 dust bin (ss) big (best quality) item415 1 nos 417 416 sauce pan with lid item416 1 nos 418 417 chest stand for x rey unit item417 1 nos 419 418 oropharyngeal airway (000 4 guydel size) item418 1 nos 420 419 oxygen cylinder 10 ltr. mo2 with valve item419 1 nos 421 420 bipap machine item420 1 nos 422 421 shoe cover – per pair item421 1 nos 423 422 elvo gloves – per pair item422 1 nos 424 423 lyarigoscope set adult with led – each item423 1 nos 425 424 lyarigoscope set child with led – each item424 1 nos 426 425 hemoglobino meter digital – each item425 1 nos 427 426 disposable syringe 20 ml – each item426 1 nos 428 427 massiring mug – each item427 1 nos 429 428 hair tremer branded – each item428 1 nos 430 429 hot air oven item429 1 nos 431 430 urino meter item430 1 nos 432 431 adk drain item431 1 nos 433 432 concigated drain (plastic) item432 1 nos 434 433 diatharmy plate for vally lab item433 1 nos 435 434 laryngoscope adult set item434 1 nos 436 435 laryngoscope ped. set item435 1 nos 437 436 coutry pencil item436 1 nos 438 437 crash card with steel drower item437 1 nos 439 438 spoon (stenless steel) item438 1 nos 440 439 digital spirometer item439 1 nos 441 440 carbonmonoxide monitor item440 1 nos 442 441 ecg machine computarized for ccu (specifications attached) item441 1 nos 443 442 ecg machine ordinary (specifications attached) item442 1 nos 444 443 cardiac monitor for ccu (specifications attached) item443 1 nos 445 444 cardiac monitor for ccu (specifications attached) item444 1 nos 446 445 cardiac monitor for ccu (specifications attached) item445 1 nos 447 446 defebrillator for ccu (specifications attached) item446 1 nos 448 447 ventillator ( adult ) for ccu (specifications attached) item447 1 nos 449 448 ventillator ( paediatric) for ccu (specifications attached) item448 1 nos 450 449 pulse oximeter for ccu (specifications attached) item449 1 nos 451 450 pulse oximter with nib for ccu (specifications attached) item450 1 nos 452 451 carm for ccu (specifications attached) item451 1 nos 453 452 laryngoscope for ccu (specifications attached) item452 1 nos 454 453 nibulisor adult with mask item453 1 nos 455 454 nibulisor child with mask item454 1 nos 456 455 nibulisor mask for adult item455 1 nos 457 456 nibulisor mask for child item456 1 nos 458 457 infant weighing scale item457 1 nos 459 458 lc dcp and dcp basic instrument set item458 1 nos 460 459 small fragment lc dcp & dcp® instrument set, st. steel item459 1 nos 461 460 select lcp upgrade instrument set large & small fragment item460 1 nos 462 461 dhs / dcs instrument set item461 1 nos 463 462 css 4.5mm instrument set in vario case item462 1 nos 464 463 css 6.5mm instrument set in vario case item463 1 nos 465 464 synream item464 1 nos 466 465 distractor set large item465 1 nos 467 466 distractor set medium item466 1 nos 468 467 bone forceps range item467 1 nos 469 468 general instrument set item468 1 nos 470 469 instruments for damaged screw removal item469 1 nos 471 470 chisel and impactor set item470 1 nos 472 471 tomofix instrument set in syncase item471 1 nos 473 472 instrument set for minimally invasive plate insertion osteosynthesis (mipo) in vario case item472 1 nos 474 473 collinear reduction clamp in vario case item473 1 nos 475 474 reduction handles, toothed and rounded, small & large in modular tray item474 1 nos 476 475 mipo cerclage passer item475 1 nos 477 476 hohmann retractor item476 1 nos 478 477 soft tissue spreader set item477 1 nos 479 478 periarticular reduction forceps item478 1 nos 480 479 pelvic basic instruments item479 1 nos 481 480 pelvic reduction & retraction item480 1 nos 482 481 pelvic c clamp item481 1 nos 483 482 wire instrumnents set item482 1 nos 484 483 shoulder instruments item483 1 nos 485 484 gili pot ss item484 1 nos 486 485 weight machine hanging (for bmw) item485 1 nos 487 486 sterlizer indicator item486 1 nos 488 487 bio west trolly single bin item487 1 nos 489 488 bio west trolly doubble bin item488 1 nos 490 489 bio west trolly triple bin item489 1 nos 491 490 scissor gauze cutting item490 1 nos 492 491 2.4mm lps distal radial plate, volar item491 1 nos 493 492 2.4mm lps distal radial plate, volar item492 1 nos 494 493 2.4mm lps distal radial plate, volar item493 1 nos 495 494 2.4mm lps distal radial plate, volar item494 1 nos 496 495 2.4mm lps distal radial plate, volar buttress item495 1 nos 497 496 2.4mm lps distal radial plate, volar buttress item496 1 nos 498 497 2.4mm lps distal radial plate, extra articular item497 1 nos 499 498 2.4mm lps distal radial plate, extra articular item498 1 nos 500 499 2.4mm lps distal radial plate, extra articular item499 1 nos 501 500 2.4mm lps distal radial plate, extra articular item500 1 nos 502 501 2.4mm lps distal radial plate, extra articular item501 1 nos 503 502 2.4mm lps distal radial plate, extra articular item502 1 nos 504 503 2.4mm lps distal radial plate, extra articular item503 1 nos 505 504 2.4mm lps distal radial plate, extra articular item504 1 nos 506 505 2.4mm lps t distal radial plate item505 1 nos 507 506 2.4mm lps t distal radial plate item506 1 nos 508 507 2.4mm lps distal radial plate, straight item507 1 nos 509 508 2.4mm lps distal radial plate, straight item508 1 nos 510 509 2.4mm lps l distal radial plate, right angled item509 1 nos 511 510 2.4mm lps l distal radial plate, right angled item510 1 nos 512 511 2.4mm lps l distal radial plate, right angled item511 1 nos 513 512 2.4mm lps l distal radial plate, right angled item512 1 nos 514 513 2.4mm lps l distal radial plate, right angled item513 1 nos 515 514 2.4mm lps l distal radial plate, right angled item514 1 nos 516 515 2.4mm lps l distal radial plate, right angled item515 1 nos 517 516 2.4mm lps l distal radial plate, right angled item516 1 nos 518 517 2.4mm lps l distal radial plate, oblique angled item517 1 nos 519 518 2.4mm lps l distal radial plate, oblique angled item518 1 nos 520 519 2.4mm lps l distal radial plate, oblique angled item519 1 nos 521 520 2.4mm lps l distal radial plate, oblique angled item520 1 nos 522 521 2.4mm lps distal radial plate, long item521 1 nos 523 522 2.4mm lps distal radial plate, long item522 1 nos 524 523 2.4mm lps distal radial plate, long item523 1 nos 525 524 2.4mm lps volar rim distal radial plate item524 1 nos 526 525 2.4mm lps volar rim distal radial plate item525 1 nos 527 526 2.4mm lps volar rim distal radial plate item526 1 nos 528 527 2.4mm lps volar rim distal radial plate item527 1 nos 529 528 2.4mm lps double column distal radial plate, volar 19.5 mm item528 1 nos 530 529 2.4mm lps double column distal radial plate, volar 19.5 mm item529 1 nos 531 530 2.4mm lps double column distal radial plate, volar 19.5 mm item530 1 nos 532 531 2.4mm lps double column distal radial plate, volar 19.5 mm item531 1 nos 533 532 2.4mm lps double column distal radial plate, volar 19.5 mm item532 1 nos 534 533 2.4mm lps double column distal radial plate, volar 19.5 mm item533 1 nos 535 534 2.4mm lps double column distal radial plate, volar 19.5 mm item534 1 nos 536 535 2.4mm lps double column distal radial plate, volar 19.5 mm item535 1 nos 537 536 2.4mm lps double column distal radial plate, volar 22.5 mm item536 1 nos 538 537 2.4mm lps double column distal radial plate, volar 22.5 mm item537 1 nos 539 538 2.4mm lps double column distal radial plate, volar 22.5 mm item538 1 nos 540 539 2.4mm lps double column distal radial plate, volar 22.5 mm item539 1 nos 541 540 2.4mm lps double column distal radial plate, volar 22.5 mm item540 1 nos 542 541 2.4mm lps double column distal radial plate, volar 22.5 mm item541 1 nos 543 542 2.4mm lps double column distal radial plate, volar 22.5 mm item542 1 nos 544 543 2.4mm lps double column distal radial plate, volar 22.5 mm item543 1 nos 545 544 2.4mm lps double column distal radial plate, volar 25.5 mm item544 1 nos 546 545 2.4mm lps double column distal radial plate, volar 25.5 mm item545 1 nos 547 546 2.4mm lps double column distal radial plate, volar 25.5 mm item546 1 nos 548 547 2.4mm lps double column distal radial plate, volar 25.5 mm item547 1 nos 549 548 2.4mm lps double column distal radial plate, volar 25.5 mm item548 1 nos 550 549 2.4mm lps double column distal radial plate, volar 25.5 mm item549 1 nos 551 550 2.4mm lps double column distal radial plate, volar 25.5 mm item550 1 nos 552 551 2.4mm lps double column distal radial plate, volar 25.5 mm item551 1 nos 553 552 ø 2.4mm locking screw t8, self tapping item552 1 nos 554 553 ø 2.4mm locking screw t8, self tapping item553 1 nos 555 554 ø 2.4mm locking screw t8, self tapping item554 1 nos 556 555 ø 2.4mm locking screw t8, self tapping item555 1 nos 557 556 ø 2.4mm locking screw t8, self tapping item556 1 nos 558 557 ø 2.4mm locking screw t8, self tapping item557 1 nos 559 558 ø 2.4mm locking screw t8, self tapping item558 1 nos 560 559 ø 2.4mm locking screw t8, self tapping item559 1 nos 561 560 ø 2.4mm locking screw t8, self tapping item560 1 nos 562 561 ø 2.4mm locking screw t8, self tapping item561 1 nos 563 562 ø 2.4mm locking screw t8, self tapping item562 1 nos 564 563 ø 2.4mm locking screw t8, self tapping item563 1 nos 565 564 ø 2.4mm cortex screw t8, self tapping item564 1 nos 566 565 ø 2.4mm cortex screw t8, self tapping item565 1 nos 567 566 ø 2.4mm cortex screw t8, self tapping item566 1 nos 568 567 ø 2.4mm cortex screw t8, self tapping item567 1 nos 569 568 ø 2.4mm cortex screw t8, self tapping item568 1 nos 570 569 ø 2.4mm cortex screw t8, self tapping item569 1 nos 571 570 ø 2.4mm cortex screw t8, self tapping item570 1 nos 572 571 ø 2.4mm cortex screw t8, self tapping item571 1 nos 573 572 ø 2.4mm cortex screw t8, self tapping item572 1 nos 574 573 ø 2.4mm cortex screw t8, self tapping item573 1 nos 575 574 ø 2.4mm cortex screw t8, self tapping item574 1 nos 576 575 ø 2.4mm cortex screw t8, self tapping item575 1 nos 577 576 ø 2.4mm cortex screw t8, self tapping item576 1 nos 578 577 ø 2.4mm cortex screw t8, self tapping item577 1 nos 579 578 ø 2.4mm cortex screw t8, self tapping item578 1 nos 580 579 ø 2.4mm cortex screw t8, self tapping item579 1 nos 581 580 ø 2.4mm cortex screw t8, self tapping item580 1 nos 582 581 ø 2.7mm cortex screw t8, self tapping item581 1 nos 583 582 ø 2.7mm cortex screw t8, self tapping item582 1 nos 584 583 ø 2.7mm cortex screw t8, self tapping item583 1 nos 585 584 ø 2.7mm cortex screw t8, self tapping item584 1 nos 586 585 ø 2.7mm cortex screw t8, self tapping item585 1 nos 587 586 ø 2.7mm cortex screw t8, self tapping item586 1 nos 588 587 ø 2.7mm cortex screw t8, self tapping item587 1 nos 589 588 ø 2.7mm cortex screw t8, self tapping item588 1 nos 590 589 ø 2.7mm cortex screw t8, self tapping item589 1 nos 591 590 ø 2.7mm cortex screw t8, self tapping item590 1 nos 592 591 ø 2.7mm cortex screw t8, self tapping item591 1 nos 593 592 ø 2.7mm cortex screw t8, self tapping item592 1 nos 594 593 ø 2.7mm cortex screw t8, self tapping item593 1 nos 595 594 ø 2.7mm cortex screw t8, self tapping item594 1 nos 596 595 ø 2.7mm cortex screw t8, self tapping item595 1 nos 597 596 ø 2.7mm cortex screw t8, self tapping item596 1 nos 598 597 ø 2.7mm cortex screw t8, self tapping item597 1 nos 599 598 ø 2.7mm cortex screw t8, self tapping item598 1 nos 600 599 ø 2.7mm cortex screw t8, self tapping item599 1 nos 601 600 ø 2.7mm cortex screw t8, self tapping item600 1 nos 602 601 ø 2.7mm cortex screw t8, self tapping item601 1 nos 603 602 ø 2.4mm headless compression screw short thread item602 1 nos 604 603 ø 2.4mm headless compression screw short thread item603 1 nos 605 604 ø 2.4mm headless compression screw short thread item604 1 nos 606 605 ø 2.4mm headless compression screw short thread item605 1 nos 607 606 ø 2.4mm headless compression screw short thread item606 1 nos 608 607 ø 2.4mm headless compression screw short thread item607 1 nos 609 608 ø 2.4mm headless compression screw short thread item608 1 nos 610 609 ø 2.4mm headless compression screw short thread item609 1 nos 611 610 ø 2.4mm headless compression screw short thread item610 1 nos 612 611 ø 2.4mm headless compression screw short thread item611 1 nos 613 612 ø 2.4mm headless compression screw short thread item612 1 nos 614 613 ø 2.4mm headless compression screw short thread item613 1 nos 615 614 ø 2.4mm headless compression screw short thread item614 1 nos 616 615 ø 2.4mm headless compression screw short thread item615 1 nos 617 616 ø 2.4mm headless compression screw short thread item616 1 nos 618 617 ø 2.4mm headless compression screw short thread item617 1 nos 619 618 ø 2.4mm headless compression screw short thread item618 1 nos 620 619 ø 2.4mm headless compression screw long thread item619 1 nos 621 620 ø 2.4mm headless compression screw long thread item620 1 nos 622 621 ø 2.4mm headless compression screw long thread item621 1 nos 623 622 ø 2.4mm headless compression screw long thread item622 1 nos 624 623 ø 2.4mm headless compression screw long thread item623 1 nos 625 624 ø 2.4mm headless compression screw long thread item624 1 nos 626 625 ø 2.4mm headless compression screw long thread item625 1 nos 627 626 ø 2.4mm headless compression screw long thread item626 1 nos 628 627 3.5mm lps small compression plate item627 1 nos 629 628 3.5mm lps small compression plate item628 1 nos 630 629 3.5mm lps small compression plate item629 1 nos 631 630 3.5mm lps small compression plate item630 1 nos 632 631 3.5mm lps small compression plate item631 1 nos 633 632 3.5mm lps small compression plate item632 1 nos 634 633 3.5mm lps small compression plate item633 1 nos 635 634 3.5mm lps small compression plate item634 1 nos 636 635 3.5mm lps small compression plate item635 1 nos 637 636 3.5mm lps small compression plate item636 1 nos 638 637 3.5mm lps small compression plate item637 1 nos 639 638 3.5mm lps small compression plate item638 1 nos 640 639 3.5mm lps small compression plate item639 1 nos 641 640 3.5mm lps small compression plate item640 1 nos 642 641 3.5mm lps small compression plate item641 1 nos 643 642 3.5mm lps small compression plate item642 1 nos 644 643 3.5mm lps small metaphyseal plate item643 1 nos 645 644 3.5mm lps small metaphyseal plate item644 1 nos 646 645 3.5mm lps small metaphyseal plate item645 1 nos 647 646 3.5mm lps small metaphyseal plate item646 1 nos 648 647 3.5mm lps small metaphyseal plate item647 1 nos 649 648 3.5mm lps small metaphyseal plate item648 1 nos 650 649 3.5mm lps small metaphyseal plate item649 1 nos 651 650 3.5mm lps small metaphyseal plate item650 1 nos 652 651 3.5mm lps small metaphyseal plate item651 1 nos 653 652 3.5mm lps small metaphyseal plate item652 1 nos 654 653 3.5mm lps reconstruction round hole plate item653 1 nos 655 654 3.5mm lps reconstruction round hole plate item654 1 nos 656 655 3.5mm lps reconstruction round hole plate item655 1 nos 657 656 3.5mm lps reconstruction round hole plate item656 1 nos 658 657 3.5mm lps reconstruction round hole plate item657 1 nos 659 658 3.5mm lps reconstruction round hole plate item658 1 nos 660 659 3.5mm lps reconstruction round hole plate item659 1 nos 661 660 3.5mm lps reconstruction round hole plate item660 1 nos 662 661 3.5mm lps reconstruction combined hole plate item661 1 nos 663 662 3.5mm lps reconstruction combined hole plate item662 1 nos 664 663 3.5mm lps reconstruction combined hole plate item663 1 nos 665 664 3.5mm lps reconstruction combined hole plate item664 1 nos 666 665 3.5mm lps reconstruction combined hole plate item665 1 nos 667 666 3.5mm lps reconstruction combined hole plate item666 1 nos 668 667 3.5mm lps reconstruction combined hole plate item667 1 nos 669 668 3.5mm lps reconstruction combined hole plate item668 1 nos 670 669 3.5mm lps reconstruction combined hole plate item669 1 nos 671 670 3.5mm lps reconstruction combined hole plate item670 1 nos 672 671 3.5mm lps reconstruction combined hole plate item671 1 nos 673 672 3.5mm lps reconstruction combined hole plate item672 1 nos 674 673 3.5mm lps reconstruction combined hole plate item673 1 nos 675 674 3.5mm lps reconstruction combined hole plate item674 1 nos 676 675 3.5mm lps t plate right angled item675 1 nos 677 676 3.5mm lps t plate right angled item676 1 nos 678 677 3.5mm lps t plate right angled item677 1 nos 679 678 3.5mm lps t plate right angled item678 1 nos 680 679 3.5mm lps t plate right angled item679 1 nos 681 680 3.5mm lps cloverleaf plate item680 1 nos 682 681 3.5mm lps cloverleaf plate item681 1 nos 683 682 3.5mm lps cloverleaf plate item682 1 nos 684 683 3.5mm lps cloverleaf plate item683 1 nos 685 684 3.5mm lps t plate oblique angled item684 1 nos 686 685 3.5mm lps t plate oblique angled item685 1 nos 687 686 3.5mm lps t plate oblique angled item686 1 nos 688 687 3.5mm lps t plate oblique angled item687 1 nos 689 688 3.5mm lps t plate oblique angled item688 1 nos 690 689 3.5mm lps t plate oblique angled item689 1 nos 691 690 3.5mm lps t plate oblique angled item690 1 nos 692 691 3.5mm lps t plate oblique angled item691 1 nos 693 692 3.5mm lps t plate oblique angled item692 1 nos 694 693 3.5mm lps t plate oblique angled item693 1 nos 695 694 3.5mm lps t plate oblique angled item694 1 nos 696 695 3.5mm lps t plate oblique angled item695 1 nos 697 696 3.5mm lps proximal humerus plate short item696 1 nos 698 697 3.5mm lps proximal humerus plate short item697 1 nos 699 698 3.5mm lps proximal humerus plate long item698 1 nos 700 699 3.5mm lps proximal humerus plate long item699 1 nos 701 700 3.5mm lps proximal humerus plate long item700 1 nos 702 701 3.5mm lps proximal humerus plate long item701 1 nos 703 702 3.5mm lps proximal humerus plate long item702 1 nos 704 703 3.5mm lps proximal tibia plate item703 1 nos 705 704 3.5mm lps proximal tibia plate item704 1 nos 706 705 3.5mm lps proximal tibia plate item705 1 nos 707 706 3.5mm lps proximal tibia plate item706 1 nos 708 707 3.5mm lps proximal tibia plate item707 1 nos 709 708 3.5mm lps proximal tibia plate item708 1 nos 710 709 3.5mm lps proximal tibia plate item709 1 nos 711 710 3.5mm lps proximal tibia plate item710 1 nos 712 711 3.5mm lps proximal tibia plate item711 1 nos 713 712 3.5mm lps proximal tibia plate item712 1 nos 714 713 3.5mm lps proximal tibia plate item713 1 nos 715 714 3.5mm lps proximal tibia plate item714 1 nos 716 715 3.5mm lps proximal tibia plate item715 1 nos 717 716 3.5mm lps proximal tibia plate item716 1 nos 718 717 3.5mm lps medial proximal tibial plate item717 1 nos 719 718 3.5mm lps medial proximal tibial plate item718 1 nos 720 719 3.5mm lps medial proximal tibial plate item719 1 nos 721 720 3.5mm lps medial proximal tibial plate item720 1 nos 722 721 3.5mm lps medial proximal tibial plate item721 1 nos 723 722 3.5mm lps medial proximal tibial plate item722 1 nos 724 723 3.5mm lps medial proximal tibial plate item723 1 nos 725 724 3.5mm lps medial proximal tibial plate item724 1 nos 726 725 3.5mm lps medial proximal tibial plate item725 1 nos 727 726 3.5mm lps medial proximal tibial plate item726 1 nos 728 727 3.5mm lps medial proximal tibial plate item727 1 nos 729 728 3.5mm lps medial proximal tibial plate item728 1 nos 730 729 3.5mm lps medial proximal tibial plate item729 1 nos 731 730 3.5mm lps medial proximal tibial plate item730 1 nos 732 731 3.5mm lps medial proximal tibial plate item731 1 nos 733 732 3.5mm lps medial proximal tibial plate item732 1 nos 734 733 3.5mm lps medial proximal tibial plate item733 1 nos 735 734 3.5mm lps medial proximal tibial plate item734 1 nos 736 735 3.5mm lps medial distal tibia low bend plate item735 1 nos 737 736 3.5mm lps medial distal tibia low bend plate item736 1 nos 738 737 3.5mm lps medial distal tibia low bend plate item737 1 nos 739 738 3.5mm lps medial distal tibia low bend plate item738 1 nos 740 739 3.5mm lps medial distal tibia low bend plate item739 1 nos 741 740 3.5mm lps medial distal tibia low bend plate item740 1 nos 742 741 3.5mm lps medial distal tibia low bend plate item741 1 nos 743 742 3.5mm lps medial distal tibia low bend plate item742 1 nos 744 743 3.5mm lps medial distal tibia low bend plate item743 1 nos 745 744 3.5mm lps medial distal tibia low bend plate item744 1 nos 746 745 3.5mm lps medial distal tibia low bend plate item745 1 nos 747 746 3.5mm lps medial distal tibia low bend plate item746 1 nos 748 747 3.5mm lps one third tubular plate item747 1 nos 749 748 3.5mm lps one third tubular plate item748 1 nos 750 749 3.5mm lps one third tubular plate item749 1 nos 751 750 3.5mm lps one third tubular plate item750 1 nos 752 751 3.5mm lps one third tubular plate item751 1 nos 753 752 3.5mm lps one third tubular plate item752 1 nos 754 753 3.5mm lps one third tubular plate item753 1 nos 755 754 3.5mm lps one third tubular plate item754 1 nos 756 755 3.5mm lps one third tubular plate item755 1 nos 757 756 3.5mm lps one third tubular plate item756 1 nos 758 757 3.5mm lps proximal humerus locking plate item757 1 nos 759 758 3.5mm lps proximal humerus locking plate item758 1 nos 760 759 3.5mm lps anterior lateral distal tibial plate item759 1 nos 761 760 3.5mm lps anterior lateral distal tibial plate item760 1 nos 762 761 3.5mm lps anterior lateral distal tibial plate item761 1 nos 763 762 3.5mm lps anterior lateral distal tibial plate item762 1 nos 764 763 3.5mm lps anterior lateral distal tibial plate item763 1 nos 765 764 3.5mm lps anterior lateral distal tibial plate item764 1 nos 766 765 3.5mm lps anterior lateral distal tibial plate item765 1 nos 767 766 3.5mm lps anterior lateral distal tibial plate item766 1 nos 768 767 3.5mm lps anterior lateral distal tibial plate item767 1 nos 769 768 3.5mm lps anterior lateral distal tibial plate item768 1 nos 770 769 3.5mm lps anterior lateral distal tibial plate item769 1 nos 771 770 3.5mm lps anterior lateral distal tibial plate item770 1 nos 772 771 3.5mm lps anterior lateral distal tibial plate item771 1 nos 773 772 3.5mm lps anterior lateral distal tibial plate item772 1 nos 774 773 3.5mm lps anterior lateral distal tibial plate item773 1 nos 775 774 3.5mm lps anterior lateral distal tibial plate item774 1 nos 776 775 3.5mm lps anterior lateral distal tibial plate item775 1 nos 777 776 3.5mm lps anterior lateral distal tibial plate item776 1 nos 778 777 3.5mm lps calcaneal plate item777 1 nos 779 778 3.5mm lps calcaneal plate item778 1 nos 780 779 3.5mm lps calcaneal plate item779 1 nos 781 780 3.5mm lps calcaneal plate item780 1 nos 782 781 3.5mm lps calcaneal plate item781 1 nos 783 782 3.5mm lps calcaneal plate item782 1 nos 784 783 3.5mm lps periarticular proximal lateral tibia plate item783 1 nos 785 784 3.5mm lps periarticular proximal lateral tibia plate item784 1 nos 786 785 3.5mm lps periarticular proximal lateral tibia plate item785 1 nos 787 786 3.5mm lps periarticular proximal lateral tibia plate item786 1 nos 788 787 3.5mm lps periarticular proximal lateral tibia plate item787 1 nos 789 788 3.5mm lps periarticular proximal lateral tibia plate item788 1 nos 790 789 3.5mm lps periarticular proximal lateral tibia plate item789 1 nos 791 790 3.5mm lps periarticular proximal lateral tibia plate item790 1 nos 792 791 3.5mm lps periarticular proximal lateral tibia plate item791 1 nos 793 792 3.5mm lps periarticular proximal lateral tibia plate item792 1 nos 794 793 3.5mm lps periarticular proximal lateral tibia plate item793 1 nos 795 794 3.5mm lps periarticular proximal lateral tibia plate item794 1 nos 796 795 3.5mm lps periarticular proximal lateral humeral plate item795 1 nos 797 796 3.5mm lps periarticular proximal lateral humeral plate item796 1 nos 798 797 3.5mm lps periarticular proximal lateral humeral plate item797 1 nos 799 798 3.5mm lps periarticular proximal lateral humeral plate item798 1 nos 800 799 3.5mm lps periarticular proximal lateral humeral plate item799 1 nos 801 800 3.5mm lps periarticular proximal lateral humeral plate item800 1 nos 802 801 3.5mm lps periarticular proximal lateral humeral plate item801 1 nos 803 802 3.5mm lps periarticular proximal lateral humeral plate item802 1 nos 804 803 3.5mm lps periarticular proximal lateral humeral plate item803 1 nos 805 804 3.5mm lps periarticular proximal lateral humeral plate item804 1 nos 806 805 3.5mm lps proximal tibia plate, posteromedial item805 1 nos 807 806 3.5mm lps proximal tibia plate, posteromedial item806 1 nos 808 807 3.5mm lps proximal tibia plate, posteromedial item807 1 nos 809 808 3.5mm lps proximal tibia plate, posteromedial item808 1 nos 810 809 3.5mm lps proximal tibia plate, posteromedial item809 1 nos 811 810 3.5mm lps proximal tibia plate, posteromedial item810 1 nos 812 811 2.7mm/3.5mm lps lateral distal fibula plate item811 1 nos 813 812 2.7mm/3.5mm lps lateral distal fibula plate item812 1 nos 814 813 2.7mm/3.5mm lps lateral distal fibula plate item813 1 nos 815 814 2.7mm/3.5mm lps lateral distal fibula plate item814 1 nos 816 815 2.7mm/3.5mm lps lateral distal fibula plate item815 1 nos 817 816 2.7mm/3.5mm lps lateral distal fibula plate item816 1 nos 818 817 2.7mm/3.5mm lps lateral distal fibula plate item817 1 nos 819 818 2.7mm/3.5mm lps lateral distal fibula plate item818 1 nos 820 819 ø 3.5mm locking screw, self tapping item819 1 nos 821 820 ø 3.5mm locking screw, self tapping item820 1 nos 822 821 ø 3.5mm locking screw, self tapping item821 1 nos 823 822 ø 3.5mm locking screw, self tapping item822 1 nos 824 823 ø 3.5mm locking screw, self tapping item823 1 nos 825 824 ø 3.5mm locking screw, self tapping item824 1 nos 826 825 ø 3.5mm locking screw, self tapping item825 1 nos 827 826 ø 3.5mm locking screw, self tapping item826 1 nos 828 827 ø 3.5mm locking screw, self tapping item827 1 nos 829 828 ø 3.5mm locking screw, self tapping item828 1 nos 830 829 ø 3.5mm locking screw, self tapping item829 1 nos 831 830 ø 3.5mm locking screw, self tapping item830 1 nos 832 831 ø 3.5mm locking screw, self tapping item831 1 nos 833 832 ø 3.5mm locking screw, self tapping item832 1 nos 834 833 ø 3.5mm locking screw, self tapping item833 1 nos 835 834 ø 3.5mm locking screw, self tapping item834 1 nos 836 835 ø 3.5mm locking screw, self tapping item835 1 nos 837 836 ø 3.5mm locking screw, self tapping item836 1 nos 838 837 ø 3.5mm locking screw, self tapping item837 1 nos 839 838 ø 3.5mm locking screw, self tapping item838 1 nos 840 839 ø 3.5mm locking screw, self tapping item839 1 nos 841 840 ø 3.5mm locking screw, self tapping item840 1 nos 842 841 ø 3.5mm locking screw, self tapping item841 1 nos 843 842 ø 3.5mm locking screw, self tapping item842 1 nos 844 843 ø 3.5mm locking screw, self tapping item843 1 nos 845 844 ø 3.5mm locking screw, self tapping item844 1 nos 846 845 ø 3.5mm locking screw, self tapping item845 1 nos 847 846 ø 3.5mm locking screw, self tapping item846 1 nos 848 847 ø 3.5mm locking screw, self tapping item847 1 nos 849 848 ø 3.5mm locking screw, self tapping item848 1 nos 850 849 ø 3.5mm locking screw, self tapping item849 1 nos 851 850 ø 3.5mm locking screw, self tapping item850 1 nos 852 851 ø 3.5mm locking screw, self tapping item851 1 nos 853 852 ø 3.5mm locking screw, self tapping item852 1 nos 854 853 ø 3.5mm cortex screw, self tapping item853 1 nos 855 854 ø 3.5mm cortex screw, self tapping item854 1 nos 856 855 ø 3.5mm cortex screw, self tapping item855 1 nos 857 856 ø 3.5mm cortex screw, self tapping item856 1 nos 858 857 ø 3.5mm cortex screw, self tapping item857 1 nos 859 858 ø 3.5mm cortex screw, self tapping item858 1 nos 860 859 ø 3.5mm cortex screw, self tapping item859 1 nos 861 860 ø 3.5mm cortex screw, self tapping item860 1 nos 862 861 ø 3.5mm cortex screw, self tapping item861 1 nos 863 862 ø 3.5mm cortex screw, self tapping item862 1 nos 864 863 ø 3.5mm cortex screw, self tapping item863 1 nos 865 864 ø 3.5mm cortex screw, self tapping item864 1 nos 866 865 ø 3.5mm cortex screw, self tapping item865 1 nos 867 866 ø 3.5mm cortex screw, self tapping item866 1 nos 868 867 ø 3.5mm cortex screw, self tapping item867 1 nos 869 868 ø 3.5mm cortex screw, self tapping item868 1 nos 870 869 ø 3.5mm cortex screw, self tapping item869 1 nos 871 870 ø 3.5mm cortex screw, self tapping item870 1 nos 872 871 ø 3.5mm cortex screw, self tapping item871 1 nos 873 872 ø 3.5mm cortex screw, self tapping item872 1 nos 874 873 ø 3.5mm cortex screw, self tapping item873 1 nos 875 874 ø 3.5mm cortex screw, self tapping item874 1 nos 876 875 ø 3.5mm cortex screw, self tapping item875 1 nos 877 876 ø 3.5mm cortex screw, self tapping item876 1 nos 878 877 ø 3.5mm cortex screw, self tapping item877 1 nos 879 878 ø 3.5mm cortex screw, self tapping item878 1 nos 880 879 ø 3.5mm cortex screw, self tapping item879 1 nos 881 880 ø 3.5mm cortex screw, self tapping item880 1 nos 882 881 ø 3.5mm cortex screw, self tapping item881 1 nos 883 882 ø 4.0mm cancellous screw, short thread item882 1 nos 884 883 ø 4.0mm cancellous screw, short thread item883 1 nos 885 884 ø 4.0mm cancellous screw, short thread item884 1 nos 886 885 ø 4.0mm cancellous screw, short thread item885 1 nos 887 886 ø 4.0mm cancellous screw, short thread item886 1 nos 888 887 ø 4.0mm cancellous screw, short thread item887 1 nos 889 888 ø 4.0mm cancellous screw, short thread item888 1 nos 890 889 ø 4.0mm cancellous screw, short thread item889 1 nos 891 890 ø 4.0mm cancellous screw, short thread item890 1 nos 892 891 ø 4.0mm cancellous screw, short thread item891 1 nos 893 892 ø 4.0mm cancellous screw, short thread item892 1 nos 894 893 ø 4.0mm cancellous screw, short thread item893 1 nos 895 894 ø 4.0mm cancellous screw, short thread item894 1 nos 896 895 ø 4.0mm cancellous screw, short thread item895 1 nos 897 896 ø 4.0mm cancellous screw, short thread item896 1 nos 898 897 ø 4.0mm cancellous screw, short thread item897 1 nos 899 898 ø 4.0mm cancellous screw, short thread item898 1 nos 900 899 ø 4.0mm cancellous screw, short thread item899 1 nos 901 900 ø 4.0mm cancellous screw, short thread item900 1 nos 902 901 ø 4.0mm cancellous screw, short thread item901 1 nos 903 902 ø 4.0mm cancellous screw, short thread item902 1 nos 904 903 ø 4.0mm cancellous screw,full thread screw item903 1 nos 905 904 ø 4.0mm cancellous screw,full thread screw item904 1 nos 906 905 ø 4.0mm cancellous screw,full thread screw item905 1 nos 907 906 ø 4.0mm cancellous screw,full thread screw item906 1 nos 908 907 ø 4.0mm cancellous screw,full thread screw item907 1 nos 909 908 ø 4.0mm cancellous screw,full thread screw item908 1 nos 910 909 ø 4.0mm cancellous screw,full thread screw item909 1 nos 911 910 ø 4.0mm cancellous screw,full thread screw item910 1 nos 912 911 ø 4.0mm cancellous screw,full thread screw item911 1 nos 913 912 ø 4.0mm cancellous screw,full thread screw item912 1 nos 914 913 ø 4.0mm cancellous screw,full thread screw item913 1 nos 915 914 ø 4.0mm cancellous screw,full thread screw item914 1 nos 916 915 ø 4.0mm cancellous screw,full thread screw item915 1 nos 917 916 ø 4.0mm cancellous screw,full thread screw item916 1 nos 918 917 ø 4.0mm cancellous screw,full thread screw item917 1 nos 919 918 ø 4.0mm cancellous screw,full thread screw item918 1 nos 920 919 ø 4.0mm cancellous screw,full thread screw item919 1 nos 921 920 ø 4.0mm cancellous screw,full thread screw item920 1 nos 922 921 ø 4.0mm cancellous screw,full thread screw item921 1 nos 923 922 ø 4.0mm cancellous screw,full thread screw item922 1 nos 924 923 ø 4.0mm cancellous screw,full thread screw item923 1 nos 925 924 ø 3.5mm locking cancellous screw, self tapping item924 1 nos 926 925 ø 3.5mm locking cancellous screw, self tapping item925 1 nos 927 926 ø 3.5mm locking cancellous screw, self tapping item926 1 nos 928 927 ø 3.5mm locking cancellous screw, self tapping item927 1 nos 929 928 ø 3.5mm locking cancellous screw, self tapping item928 1 nos 930 929 ø 3.5mm locking cancellous screw, self tapping item929 1 nos 931 930 ø 3.5mm locking cancellous screw, self tapping item930 1 nos 932 931 ø 3.5mm locking cancellous screw, self tapping item931 1 nos 933 932 ø 3.5mm locking cancellous screw, self tapping item932 1 nos 934 933 ø 3.5mm locking cancellous screw, self tapping item933 1 nos 935 934 ø 3.5mm locking cancellous screw, self tapping item934 1 nos 936 935 ø 3.5mm locking cancellous screw, self tapping item935 1 nos 937 936 ø 3.5mm locking cancellous screw, self tapping item936 1 nos 938 937 2.7mm/3.5mm superior anterior clavicle plate item937 1 nos 939 938 2.7mm/3.5mm superior anterior clavicle plate item938 1 nos 940 939 2.7mm/3.5mm superior anterior clavicle plate item939 1 nos 941 940 2.7mm/3.5mm superior anterior clavicle plate item940 1 nos 942 941 2.7mm/3.5mm superior anterior clavicle plate item941 1 nos 943 942 2.7mm/3.5mm superior anterior clavicle plate item942 1 nos 944 943 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item943 1 nos 945 944 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item944 1 nos 946 945 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item945 1 nos 947 946 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item946 1 nos 948 947 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item947 1 nos 949 948 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item948 1 nos 950 949 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item949 1 nos 951 950 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item950 1 nos 952 951 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item951 1 nos 953 952 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item952 1 nos 954 953 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item953 1 nos 955 954 2.7mm/3.5mm superior anterior clavicle plate, with lateral extension item954 1 nos 956 955 2.7mm/3.5mm posterolateral distal humerus plate item955 1 nos 957 956 2.7mm/3.5mm posterolateral distal humerus plate item956 1 nos 958 957 2.7mm/3.5mm posterolateral distal humerus plate item957 1 nos 959 958 2.7mm/3.5mm posterolateral distal humerus plate item958 1 nos 960 959 2.7mm/3.5mm posterolateral distal humerus plate item959 1 nos 961 960 2.7mm/3.5mm posterolateral distal humerus plate item960 1 nos 962 961 2.7mm/3.5mm posterolateral distal humerus plate item961 1 nos 963 962 2.7mm/3.5mm posterolateral distal humerus plate item962 1 nos 964 963 2.7mm/3.5mm posterolateral distal humerus plate item963 1 nos 965 964 2.7mm/3.5mm posterolateral distal humerus plate item964 1 nos 966 965 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item965 1 nos 967 966 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item966 1 nos 968 967 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item967 1 nos 969 968 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item968 1 nos 970 969 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item969 1 nos 971 970 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item970 1 nos 972 971 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item971 1 nos 973 972 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item972 1 nos 974 973 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item973 1 nos 975 974 2.7mm/3.5mm posterolateral distal humerus plate, with lateral support item974 1 nos 976 975 2.7mm/3.5mm medial distal humerus plate item975 1 nos 977 976 2.7mm/3.5mm medial distal humerus plate item976 1 nos 978 977 2.7mm/3.5mm medial distal humerus plate item977 1 nos 979 978 2.7mm/3.5mm medial distal humerus plate item978 1 nos 980 979 2.7mm/3.5mm medial distal humerus plate item979 1 nos 981 980 2.7mm/3.5mm medial distal humerus plate item980 1 nos 982 981 2.7mm/3.5mm medial distal humerus plate item981 1 nos 983 982 2.7mm/3.5mm medial distal humerus plate item982 1 nos 984 983 2.7mm/3.5mm lps medial distal humerus metaphyseal plate item983 1 nos 985 984 2.7mm/3.5mm lps medial distal humerus metaphyseal plate item984 1 nos 986 985 2.7mm/3.5mm lps medial distal humerus metaphyseal plate item985 1 nos 987 986 2.7mm/3.5mm lps medial distal humerus metaphyseal plate item986 1 nos 988 987 2.7mm/3.5mm lps medial distal humerus metaphyseal plate item987 1 nos 989 988 3.5mm lps distal humerus extra articular plate item988 1 nos 990 989 3.5mm lps distal humerus extra articular plate item989 1 nos 991 990 3.5mm lps distal humerus extra articular plate item990 1 nos 992 991 3.5mm lps distal humerus extra articular plate item991 1 nos 993 992 3.5mm lps distal humerus extra articular plate item992 1 nos 994 993 3.5mm lps distal humerus extra articular plate item993 1 nos 995 994 3.5mm lps distal humerus extra articular plate item994 1 nos 996 995 3.5mm lps distal humerus extra articular plate item995 1 nos 997 996 3.5mm lps distal humerus extra articular plate item996 1 nos 998 997 3.5mm lps distal humerus extra articular plate item997 1 nos 999 998 3.5mm lps distal humerus extra articular plate item998 1 nos 1000 999 3.5mm lps distal humerus extra articular plate item999 1 nos 1001 1000 3.5mm lps olecranon plate item1000 1 nos 1002 1001 3.5mm lps olecranon plate item1001 1 nos 1003 1002 3.5mm lps olecranon plate item1002 1 nos 1004 1003 3.5mm lps olecranon plate item1003 1 nos 1005 1004 3.5mm lps olecranon plate item1004 1 nos 1006 1005 3.5mm lps olecranon plate item1005 1 nos 1007 1006 3.5mm lps olecranon plate item1006 1 nos 1008 1007 3.5mm lps olecranon plate item1007 1 nos 1009 1008 3.5mm lps olecranon plate item1008 1 nos 1010 1009 3.5mm lps olecranon plate item1009 1 nos 1011 1010 3.5mm lps olecranon plate item1010 1 nos 1012 1011 3.5mm lps olecranon plate item1011 1 nos 1013 1012 3.5mm lps clavicle hook plate item1012 1 nos 1014 1013 3.5mm lps clavicle hook plate item1013 1 nos 1015 1014 3.5mm lps clavicle hook plate item1014 1 nos 1016 1015 3.5mm lps clavicle hook plate item1015 1 nos 1017 1016 3.5mm lps clavicle hook plate item1016 1 nos 1018 1017 3.5mm lps clavicle hook plate item1017 1 nos 1019 1018 3.5mm lps clavicle hook plate item1018 1 nos 1020 1019 3.5mm lps clavicle hook plate item1019 1 nos 1021 1020 3.5mm lps clavicle hook plate item1020 1 nos 1022 1021 3.5mm lps clavicle hook plate item1021 1 nos 1023 1022 3.5mm lps clavicle hook plate item1022 1 nos 1024 1023 3.5mm lps clavicle hook plate item1023 1 nos 1025 1024 3.5mm lps clavicle hook plate item1024 1 nos 1026 1025 3.5mm lps clavicle hook plate item1025 1 nos 1027 1026 3.5mm lps clavicle hook plate item1026 1 nos 1028 1027 3.5mm lps clavicle hook plate item1027 1 nos 1029 1028 3.5mm lps clavicle hook plate item1028 1 nos 1030 1029 3.5mm lps clavicle hook plate item1029 1 nos 1031 1030 3.5mm lps clavicle hook plate item1030 1 nos 1032 1031 3.5mm lps clavicle hook plate item1031 1 nos 1033 1032 3.5mm lps clavicle hook plate item1032 1 nos 1034 1033 3.5mm lps clavicle hook plate item1033 1 nos 1035 1034 3.5mm lps clavicle hook plate item1034 1 nos 1036 1035 3.5mm lps clavicle hook plate item1035 1 nos 1037 1036 ø 3.5mm locking screw, self tapping item1036 1 nos 1038 1037 ø 3.5mm locking screw, self tapping item1037 1 nos 1039 1038 ø 3.5mm locking screw, self tapping item1038 1 nos 1040 1039 ø 3.5mm locking screw, self tapping item1039 1 nos 1041 1040 ø 3.5mm locking screw, self tapping item1040 1 nos 1042 1041 ø 3.5mm locking screw, self tapping item1041 1 nos 1043 1042 ø 3.5mm locking screw, self tapping item1042 1 nos 1044 1043 ø 3.5mm locking screw, self tapping item1043 1 nos 1045 1044 ø 3.5mm locking screw, self tapping item1044 1 nos 1046 1045 ø 3.5mm locking screw, self tapping item1045 1 nos 1047 1046 ø 3.5mm locking screw, self tapping item1046 1 nos 1048 1047 ø 3.5mm locking screw, self tapping item1047 1 nos 1049 1048 ø 3.5mm locking screw, self tapping item1048 1 nos 1050 1049 ø 3.5mm locking screw, self tapping item1049 1 nos 1051 1050 ø 3.5mm locking screw, self tapping item1050 1 nos 1052 1051 ø 3.5mm locking screw, self tapping item1051 1 nos 1053 1052 ø 3.5mm locking screw, self tapping item1052 1 nos 1054 1053 ø 3.5mm locking screw, self tapping item1053 1 nos 1055 1054 ø 3.5mm locking screw, self tapping item1054 1 nos 1056 1055 ø 3.5mm locking screw, self tapping item1055 1 nos 1057 1056 ø 3.5mm locking screw, self tapping item1056 1 nos 1058 1057 ø 3.5mm locking screw, self tapping item1057 1 nos 1059 1058 ø 3.5mm locking screw, self tapping item1058 1 nos 1060 1059 ø 3.5mm locking screw, self tapping item1059 1 nos 1061 1060 ø 3.5mm locking screw, self tapping item1060 1 nos 1062 1061 ø 3.5mm locking screw, self tapping item1061 1 nos 1063 1062 ø 3.5mm locking screw, self tapping item1062 1 nos 1064 1063 ø 3.5mm locking screw, self tapping item1063 1 nos 1065 1064 ø 3.5mm locking screw, self tapping item1064 1 nos 1066 1065 ø 3.5mm locking screw, self tapping item1065 1 nos 1067 1066 ø 3.5mm locking screw, self tapping item1066 1 nos 1068 1067 ø 3.5mm locking screw, self tapping item1067 1 nos 1069 1068 ø 3.5mm locking screw, self tapping item1068 1 nos 1070 1069 ø 3.5mm cortex screw, self tapping item1069 1 nos 1071 1070 ø 3.5mm cortex screw, self tapping item1070 1 nos 1072 1071 ø 3.5mm cortex screw, self tapping item1071 1 nos 1073 1072 ø 3.5mm cortex screw, self tapping item1072 1 nos 1074 1073 ø 3.5mm cortex screw, self tapping item1073 1 nos 1075 1074 ø 3.5mm cortex screw, self tapping item1074 1 nos 1076 1075 ø 3.5mm cortex screw, self tapping item1075 1 nos 1077 1076 ø 3.5mm cortex screw, self tapping item1076 1 nos 1078 1077 ø 3.5mm cortex screw, self tapping item1077 1 nos 1079 1078 ø 3.5mm cortex screw, self tapping item1078 1 nos 1080 1079 ø 3.5mm cortex screw, self tapping item1079 1 nos 1081 1080 ø 3.5mm cortex screw, self tapping item1080 1 nos 1082 1081 ø 3.5mm cortex screw, self tapping item1081 1 nos 1083 1082 ø 3.5mm cortex screw, self tapping item1082 1 nos 1084 1083 ø 3.5mm cortex screw, self tapping item1083 1 nos 1085 1084 ø 3.5mm cortex screw, self tapping item1084 1 nos 1086 1085 ø 3.5mm cortex screw, self tapping item1085 1 nos 1087 1086 ø 3.5mm cortex screw, self tapping item1086 1 nos 1088 1087 ø 3.5mm cortex screw, self tapping item1087 1 nos 1089 1088 ø 3.5mm cortex screw, self tapping item1088 1 nos 1090 1089 ø 3.5mm cortex screw, self tapping item1089 1 nos 1091 1090 ø 3.5mm cortex screw, self tapping item1090 1 nos 1092 1091 ø 3.5mm cortex screw, self tapping item1091 1 nos 1093 1092 ø 3.5mm cortex screw, self tapping item1092 1 nos 1094 1093 ø 3.5mm cortex screw, self tapping item1093 1 nos 1095 1094 ø 3.5mm cortex screw, self tapping item1094 1 nos 1096 1095 ø 3.5mm cortex screw, self tapping item1095 1 nos 1097 1096 ø 3.5mm cortex screw, self tapping item1096 1 nos 1098 1097 ø 3.5mm cortex screw, self tapping item1097 1 nos 1099 1098 ø 4.0mm cancellous screw, full thread item1098 1 nos 1100 1099 ø 4.0mm cancellous screw, full thread item1099 1 nos 1101 1100 ø 4.0mm cancellous screw, full thread item1100 1 nos 1102 1101 ø 4.0mm cancellous screw, full thread item1101 1 nos 1103 1102 ø 4.0mm cancellous screw, full thread item1102 1 nos 1104 1103 ø 4.0mm cancellous screw, full thread item1103 1 nos 1105 1104 ø 4.0mm cancellous screw, full thread item1104 1 nos 1106 1105 ø 4.0mm cancellous screw, full thread item1105 1 nos 1107 1106 ø 4.0mm cancellous screw, full thread item1106 1 nos 1108 1107 ø 4.0mm cancellous screw, full thread item1107 1 nos 1109 1108 ø 4.0mm cancellous screw, full thread item1108 1 nos 1110 1109 ø 4.0mm cancellous screw, full thread item1109 1 nos 1111 1110 ø 4.0mm cancellous screw, full thread item1110 1 nos 1112 1111 ø 4.0mm cancellous screw, full thread item1111 1 nos 1113 1112 ø 4.0mm cancellous screw, full thread item1112 1 nos 1114 1113 ø 4.0mm cancellous screw, full thread item1113 1 nos 1115 1114 ø 4.0mm cancellous screw, full thread item1114 1 nos 1116 1115 ø 4.0mm cancellous screw, full thread item1115 1 nos 1117 1116 ø 4.0mm cancellous screw, full thread item1116 1 nos 1118 1117 ø 4.0mm cancellous screw, full thread item1117 1 nos 1119 1118 ø 4.0mm cancellous screw, full thread item1118 1 nos 1120 1119 ø 4.0mm cancellous screw, short thread item1119 1 nos 1121 1120 ø 4.0mm cancellous screw, short thread item1120 1 nos 1122 1121 ø 4.0mm cancellous screw, short thread item1121 1 nos 1123 1122 ø 4.0mm cancellous screw, short thread item1122 1 nos 1124 1123 ø 4.0mm cancellous screw, short thread item1123 1 nos 1125 1124 ø 4.0mm cancellous screw, short thread item1124 1 nos 1126 1125 ø 4.0mm cancellous screw, short thread item1125 1 nos 1127 1126 ø 4.0mm cancellous screw, short thread item1126 1 nos 1128 1127 ø 4.0mm cancellous screw, short thread item1127 1 nos 1129 1128 ø 4.0mm cancellous screw, short thread item1128 1 nos 1130 1129 ø 4.0mm cancellous screw, short thread item1129 1 nos 1131 1130 ø 4.0mm cancellous screw, short thread item1130 1 nos 1132 1131 ø 4.0mm cancellous screw, short thread item1131 1 nos 1133 1132 ø 4.0mm cancellous screw, short thread item1132 1 nos 1134 1133 ø 4.0mm cancellous screw, short thread item1133 1 nos 1135 1134 ø 4.0mm cancellous screw, short thread item1134 1 nos 1136 1135 ø 4.0mm cancellous screw, short thread item1135 1 nos 1137 1136 ø 4.0mm cancellous screw, short thread item1136 1 nos 1138 1137 ø 4.0mm cancellous screw, short thread item1137 1 nos 1139 1138 ø 4.0mm cancellous screw, short thread item1138 1 nos 1140 1139 ø 4.0mm cancellous screw, short thread item1139 1 nos 1141 1140 ø 2.7mm locking screw, t8 self tapping item1140 1 nos 1142 1141 ø 2.7mm locking screw, t8 self tapping item1141 1 nos 1143 1142 ø 2.7mm locking screw, t8 self tapping item1142 1 nos 1144 1143 ø 2.7mm locking screw, t8 self tapping item1143 1 nos 1145 1144 ø 2.7mm locking screw, t8 self tapping item1144 1 nos 1146 1145 ø 2.7mm locking screw, t8 self tapping item1145 1 nos 1147 1146 ø 2.7mm locking screw, t8 self tapping item1146 1 nos 1148 1147 ø 2.7mm locking screw, t8 self tapping item1147 1 nos 1149 1148 ø 2.7mm locking screw, t8 self tapping item1148 1 nos 1150 1149 ø 2.7mm locking screw, t8 self tapping item1149 1 nos 1151 1150 ø 2.7mm locking screw, t8 self tapping item1150 1 nos 1152 1151 ø 2.7mm locking screw, t8 self tapping item1151 1 nos 1153 1152 ø 2.7mm locking screw, t8 self tapping item1152 1 nos 1154 1153 ø 2.7mm locking screw, t8 self tapping item1153 1 nos 1155 1154 ø 2.7mm locking screw, t8 self tapping item1154 1 nos 1156 1155 ø 2.7mm locking screw, t8 self tapping item1155 1 nos 1157 1156 ø 2.7mm locking screw, t8 self tapping item1156 1 nos 1158 1157 ø 2.7mm locking screw, t8 self tapping item1157 1 nos 1159 1158 ø 2.7mm locking screw, t8 self tapping item1158 1 nos 1160 1159 ø 2.7mm locking screw, t8 self tapping item1159 1 nos 1161 1160 ø 2.7mm locking screw, t8 self tapping item1160 1 nos 1162 1161 ø 2.7mm locking screw, t8 self tapping item1161 1 nos 1163 1162 4.5mm lps compression plate narrow item1162 1 nos 1164 1163 4.5mm lps compression plate narrow item1163 1 nos 1165 1164 4.5mm lps compression plate narrow item1164 1 nos 1166 1165 4.5mm lps compression plate narrow item1165 1 nos 1167 1166 4.5mm lps compression plate narrow item1166 1 nos 1168 1167 4.5mm lps compression plate narrow item1167 1 nos 1169 1168 4.5mm lps compression plate narrow item1168 1 nos 1170 1169 4.5mm lps compression plate narrow item1169 1 nos 1171 1170 4.5mm lps compression plate narrow item1170 1 nos 1172 1171 4.5mm lps compression plate narrow item1171 1 nos 1173 1172 4.5mm lps compression plate narrow item1172 1 nos 1174 1173 4.5mm lps compression plate narrow item1173 1 nos 1175 1174 4.5mm lps compression plate narrow item1174 1 nos 1176 1175 4.5mm lps compression plate broad item1175 1 nos 1177 1176 4.5mm lps compression plate broad item1176 1 nos 1178 1177 4.5mm lps compression plate broad item1177 1 nos 1179 1178 4.5mm lps compression plate broad item1178 1 nos 1180 1179 4.5mm lps compression plate broad item1179 1 nos 1181 1180 4.5mm lps compression plate broad item1180 1 nos 1182 1181 4.5mm lps compression plate broad item1181 1 nos 1183 1182 4.5mm lps compression plate broad item1182 1 nos 1184 1183 4.5mm lps compression plate broad item1183 1 nos 1185 1184 4.5mm lps compression plate broad item1184 1 nos 1186 1185 4.5mm lps compression plate broad item1185 1 nos 1187 1186 4.5mm lps compression plate broad item1186 1 nos 1188 1187 4.5mm lps compression plate broad item1187 1 nos 1189 1188 4.5mm lps distal femur plate item1188 1 nos 1190 1189 4.5mm lps distal femur plate item1189 1 nos 1191 1190 4.5mm lps distal femur plate item1190 1 nos 1192 1191 4.5mm lps distal femur plate item1191 1 nos 1193 1192 4.5mm lps distal femur plate item1192 1 nos 1194 1193 4.5mm lps distal femur plate item1193 1 nos 1195 1194 4.5mm lps distal femur plate item1194 1 nos 1196 1195 4.5mm lps distal femur plate item1195 1 nos 1197 1196 4.5mm lps distal femur plate item1196 1 nos 1198 1197 4.5mm lps distal femur plate item1197 1 nos 1199 1198 4.5mm lps proximal lateral tibia plate item1198 1 nos 1200 1199 4.5mm lps proximal lateral tibia plate item1199 1 nos 1201 1200 4.5mm lps proximal lateral tibia plate item1200 1 nos 1202 1201 4.5mm lps proximal lateral tibia plate item1201 1 nos 1203 1202 4.5mm lps proximal lateral tibia plate item1202 1 nos 1204 1203 4.5mm lps proximal lateral tibia plate item1203 1 nos 1205 1204 4.5mm lps proximal lateral tibia plate item1204 1 nos 1206 1205 4.5mm lps proximal lateral tibia plate item1205 1 nos 1207 1206 4.5mm lps proximal lateral tibia plate item1206 1 nos 1208 1207 4.5mm lps proximal lateral tibia plate item1207 1 nos 1209 1208 4.5mm lps t plate item1208 1 nos 1210 1209 4.5mm lps t plate item1209 1 nos 1211 1210 4.5mm lps t plate item1210 1 nos 1212 1211 4.5mm lps t plate item1211 1 nos 1213 1212 4.5mm lps t plate item1212 1 nos 1214 1213 4.5mm lps t plate item1213 1 nos 1215 1214 4.5mm lps t plate item1214 1 nos 1216 1215 4.5mm lps t plate item1215 1 nos 1217 1216 4.5mm lps t buttress plate item1216 1 nos 1218 1217 4.5mm lps t buttress plate item1217 1 nos 1219 1218 4.5mm lps t buttress plate item1218 1 nos 1220 1219 4.5mm lps l buttress plate item1219 1 nos 1221 1220 4.5mm lps l buttress plate item1220 1 nos 1222 1221 4.5mm lps l buttress plate item1221 1 nos 1223 1222 4.5mm lps l buttress plate item1222 1 nos 1224 1223 4.5mm lps l buttress plate item1223 1 nos 1225 1224 4.5mm lps l buttress plate item1224 1 nos 1226 1225 4.5mm lps l buttress plate item1225 1 nos 1227 1226 4.5mm lps l buttress plate item1226 1 nos 1228 1227 4.5mm lps large metaphyseal plate item1227 1 nos 1229 1228 4.5mm lps large metaphyseal plate item1228 1 nos 1230 1229 4.5mm lps large metaphyseal plate item1229 1 nos 1231 1230 4.5mm lps large metaphyseal plate item1230 1 nos 1232 1231 4.5mm lps large metaphyseal plate item1231 1 nos 1233 1232 4.5mm lps large metaphyseal plate item1232 1 nos 1234 1233 4.5mm lps large metaphyseal plate item1233 1 nos 1235 1234 4.5mm lps large metaphyseal plate item1234 1 nos 1236 1235 4.5mm lps large metaphyseal plate item1235 1 nos 1237 1236 4.5mm lps large metaphyseal plate item1236 1 nos 1238 1237 ø 5.0mm locking screw, self tapping item1237 1 nos 1239 1238 ø 5.0mm locking screw, self tapping item1238 1 nos 1240 1239 ø 5.0mm locking screw, self tapping item1239 1 nos 1241 1240 ø 5.0mm locking screw, self tapping item1240 1 nos 1242 1241 ø 5.0mm locking screw, self tapping item1241 1 nos 1243 1242 ø 5.0mm locking screw, self tapping item1242 1 nos 1244 1243 ø 5.0mm locking screw, self tapping item1243 1 nos 1245 1244 ø 5.0mm locking screw, self tapping item1244 1 nos 1246 1245 ø 5.0mm locking screw, self tapping item1245 1 nos 1247 1246 ø 5.0mm locking screw, self tapping item1246 1 nos 1248 1247 ø 5.0mm locking screw, self tapping item1247 1 nos 1249 1248 ø 5.0mm locking screw, self tapping item1248 1 nos 1250 1249 ø 5.0mm locking screw, self tapping item1249 1 nos 1251 1250 ø 5.0mm locking screw, self tapping item1250 1 nos 1252 1251 ø 5.0mm locking screw, self tapping item1251 1 nos 1253 1252 ø 5.0mm locking screw, self tapping item1252 1 nos 1254 1253 ø 5.0mm locking screw, self tapping item1253 1 nos 1255 1254 ø 5.0mm locking screw, self tapping item1254 1 nos 1256 1255 ø 5.0mm locking screw, self tapping item1255 1 nos 1257 1256 ø 5.0mm locking screw, self tapping item1256 1 nos 1258 1257 ø 5.0mm locking screw, self tapping item1257 1 nos 1259 1258 ø 5.0mm locking screw, self tapping item1258 1 nos 1260 1259 ø 5.0mm locking screw, self tapping item1259 1 nos 1261 1260 ø 5.0mm locking screw, self tapping item1260 1 nos 1262 1261 ø 5.0mm locking screw, self tapping item1261 1 nos 1263 1262 ø 5.0mm locking screw, self tapping item1262 1 nos 1264 1263 ø 5.0mm locking screw, self tapping item1263 1 nos 1265 1264 ø 4.5mm cortex screw, self tapping item1264 1 nos 1266 1265 ø 4.5mm cortex screw, self tapping item1265 1 nos 1267 1266 ø 4.5mm cortex screw, self tapping item1266 1 nos 1268 1267 ø 4.5mm cortex screw, self tapping item1267 1 nos 1269 1268 ø 4.5mm cortex screw, self tapping item1268 1 nos 1270 1269 ø 4.5mm cortex screw, self tapping item1269 1 nos 1271 1270 ø 4.5mm cortex screw, self tapping item1270 1 nos 1272 1271 ø 4.5mm cortex screw, self tapping item1271 1 nos 1273 1272 ø 4.5mm cortex screw, self tapping item1272 1 nos 1274 1273 ø 4.5mm cortex screw, self tapping item1273 1 nos 1275 1274 ø 4.5mm cortex screw, self tapping item1274 1 nos 1276 1275 ø 4.5mm cortex screw, self tapping item1275 1 nos 1277 1276 ø 4.5mm cortex screw, self tapping item1276 1 nos 1278 1277 ø 4.5mm cortex screw, self tapping item1277 1 nos 1279 1278 ø 4.5mm cortex screw, self tapping item1278 1 nos 1280 1279 ø 4.5mm cortex screw, self tapping item1279 1 nos 1281 1280 ø 4.5mm cortex screw, self tapping item1280 1 nos 1282 1281 ø 4.5mm cortex screw, self tapping item1281 1 nos 1283 1282 ø 4.5mm cortex screw, self tapping item1282 1 nos 1284 1283 ø 4.5mm cortex screw, self tapping item1283 1 nos 1285 1284 ø 4.5mm cortex screw, self tapping item1284 1 nos 1286 1285 ø 4.5mm cortex screw, self tapping item1285 1 nos 1287 1286 ø 4.5mm cortex screw, self tapping item1286 1 nos 1288 1287 ø 4.5mm cortex screw, self tapping item1287 1 nos 1289 1288 ø 4.5mm cortex screw, self tapping item1288 1 nos 1290 1289 ø 4.5mm cortex screw, self tapping item1289 1 nos 1291 1290 ø 4.5mm cortex screw, self tapping item1290 1 nos 1292 1291 ø 4.5mm cortex screw, self tapping item1291 1 nos 1293 1292 ø 4.5mm cortex screw, self tapping item1292 1 nos 1294 1293 ø 4.5mm cortex screw, self tapping item1293 1 nos 1295 1294 ø 4.5mm cortex screw, self tapping item1294 1 nos 1296 1295 ø 4.5mm cortex screw, self tapping item1295 1 nos 1297 1296 ø 4.5mm cortex screw, self tapping item1296 1 nos 1298 1297 ø 4.5mm cortex screw, self tapping item1297 1 nos 1299 1298 ø 4.5mm cortex screw, self tapping item1298 1 nos 1300 1299 ø 4.5mm cortex screw, self tapping item1299 1 nos 1301 1300 ø 4.5mm cortex screw, self tapping item1300 1 nos 1302 1301 ø 4.5mm cortex screw, self tapping item1301 1 nos 1303 1302 ø 6.5mm cancellous screw, full thread length item1302 1 nos 1304 1303 ø 6.5mm cancellous screw, full thread length item1303 1 nos 1305 1304 ø 6.5mm cancellous screw, full thread length item1304 1 nos 1306 1305 ø 6.5mm cancellous screw, full thread length item1305 1 nos 1307 1306 ø 6.5mm cancellous screw, full thread length item1306 1 nos 1308 1307 ø 6.5mm cancellous screw, full thread length item1307 1 nos 1309 1308 ø 6.5mm cancellous screw, full thread length item1308 1 nos 1310 1309 ø 6.5mm cancellous screw, full thread length item1309 1 nos 1311 1310 ø 6.5mm cancellous screw, full thread length item1310 1 nos 1312 1311 ø 6.5mm cancellous screw, full thread length item1311 1 nos 1313 1312 ø 6.5mm cancellous screw, full thread length item1312 1 nos 1314 1313 ø 6.5mm cancellous screw, full thread length item1313 1 nos 1315 1314 ø 6.5mm cancellous screw, full thread length item1314 1 nos 1316 1315 ø 6.5mm cancellous screw, full thread length item1315 1 nos 1317 1316 ø 6.5mm cancellous screw, full thread length item1316 1 nos 1318 1317 ø 6.5mm cancellous screw, full thread length item1317 1 nos 1319 1318 ø 6.5mm cancellous screw, full thread length item1318 1 nos 1320 1319 ø 6.5mm cancellous screw, full thread length item1319 1 nos 1321 1320 ø 6.5mm cancellous screw, full thread length item1320 1 nos 1322 1321 ø 6.5mm cancellous screw, 16mm thread length item1321 1 nos 1323 1322 ø 6.5mm cancellous screw, 16mm thread length item1322 1 nos 1324 1323 ø 6.5mm cancellous screw, 16mm thread length item1323 1 nos 1325 1324 ø 6.5mm cancellous screw, 16mm thread length item1324 1 nos 1326 1325 ø 6.5mm cancellous screw, 16mm thread length item1325 1 nos 1327 1326 ø 6.5mm cancellous screw, 16mm thread length item1326 1 nos 1328 1327 ø 6.5mm cancellous screw, 16mm thread length item1327 1 nos 1329 1328 ø 6.5mm cancellous screw, 16mm thread length item1328 1 nos 1330 1329 ø 6.5mm cancellous screw, 16mm thread length item1329 1 nos 1331 1330 ø 6.5mm cancellous screw, 16mm thread length item1330 1 nos 1332 1331 ø 6.5mm cancellous screw, 16mm thread length item1331 1 nos 1333 1332 ø 6.5mm cancellous screw, 16mm thread length item1332 1 nos 1334 1333 ø 6.5mm cancellous screw, 16mm thread length item1333 1 nos 1335 1334 ø 6.5mm cancellous screw, 16mm thread length item1334 1 nos 1336 1335 ø 6.5mm cancellous screw, 16mm thread length item1335 1 nos 1337 1336 ø 6.5mm cancellous screw, 16mm thread length item1336 1 nos 1338 1337 ø 6.5mm cancellous screw, 16mm thread length item1337 1 nos 1339 1338 ø 6.5mm cancellous screw, 16mm thread length item1338 1 nos 1340 1339 ø 6.5mm cancellous screw, 16mm thread length item1339 1 nos 1341 1340 ø 6.5mm cancellous screw, 32mm thread length item1340 1 nos 1342 1341 ø 6.5mm cancellous screw, 32mm thread length item1341 1 nos 1343 1342 ø 6.5mm cancellous screw, 32mm thread length item1342 1 nos 1344 1343 ø 6.5mm cancellous screw, 32mm thread length item1343 1 nos 1345 1344 ø 6.5mm cancellous screw, 32mm thread length item1344 1 nos 1346 1345 ø 6.5mm cancellous screw, 32mm thread length item1345 1 nos 1347 1346 ø 6.5mm cancellous screw, 32mm thread length item1346 1 nos 1348 1347 ø 6.5mm cancellous screw, 32mm thread length item1347 1 nos 1349 1348 ø 6.5mm cancellous screw, 32mm thread length item1348 1 nos 1350 1349 ø 6.5mm cancellous screw, 32mm thread length item1349 1 nos 1351 1350 ø 6.5mm cancellous screw, 32mm thread length item1350 1 nos 1352 1351 ø 6.5mm cancellous screw, 32mm thread length item1351 1 nos 1353 1352 ø 6.5mm cancellous screw, 32mm thread length item1352 1 nos 1354 1353 ø 6.5mm cancellous screw, 32mm thread length item1353 1 nos 1355 1354 ø 6.5mm cancellous screw, 32mm thread length item1354 1 nos 1356 1355 ø 6.5mm cancellous screw, 32mm thread length item1355 1 nos 1357 1356 ø 6.5mm cancellous screw, 32mm thread length item1356 1 nos 1358 1357 ø 6.5mm cancellous screw, 32mm thread length item1357 1 nos 1359 1358 ø 6.5mm cancellous screw, 32mm thread length item1358 1 nos 1360 1359 ø 6.5mm cancellous screw, 32mm thread length item1359 1 nos 1361 1360 ø 6.5mm cancellous screw, 32mm thread length item1360 1 nos 1362 1361 ø 6.5mm cancellous screw, 32mm thread length item1361 1 nos 1363 1362 ø 5.0mm locking cancellous screw, self tapping item1362 1 nos 1364 1363 ø 5.0mm locking cancellous screw, self tapping item1363 1 nos 1365 1364 ø 5.0mm locking cancellous screw, self tapping item1364 1 nos 1366 1365 ø 5.0mm locking cancellous screw, self tapping item1365 1 nos 1367 1366 ø 5.0mm locking cancellous screw, self tapping item1366 1 nos 1368 1367 ø 5.0mm locking cancellous screw, self tapping item1367 1 nos 1369 1368 ø 5.0mm locking cancellous screw, self tapping item1368 1 nos 1370 1369 ø 5.0mm locking cancellous screw, self tapping item1369 1 nos 1371 1370 ø 5.0mm locking cancellous screw, self tapping item1370 1 nos 1372 1371 ø 4.5mm cannulated screw, self drilling, short thread item1371 1 nos 1373 1372 ø 4.5mm cannulated screw, self drilling, short thread item1372 1 nos 1374 1373 ø 4.5mm cannulated screw, self drilling, short thread item1373 1 nos 1375 1374 ø 4.5mm cannulated screw, self drilling, short thread item1374 1 nos 1376 1375 ø 4.5mm cannulated screw, self drilling, short thread item1375 1 nos 1377 1376 ø 4.5mm cannulated screw, self drilling, short thread item1376 1 nos 1378 1377 ø 4.5mm cannulated screw, self drilling, short thread item1377 1 nos 1379 1378 ø 4.5mm cannulated screw, self drilling, short thread item1378 1 nos 1380 1379 ø 4.5mm cannulated screw, self drilling, short thread item1379 1 nos 1381 1380 ø 4.5mm cannulated screw, self drilling, short thread item1380 1 nos 1382 1381 ø 4.5mm cannulated screw, self drilling, short thread item1381 1 nos 1383 1382 ø 4.5mm cannulated screw, self drilling, short thread item1382 1 nos 1384 1383 ø 4.5mm cannulated screw, self drilling, short thread item1383 1 nos 1385 1384 ø 4.5mm cannulated screw, self drilling, short thread item1384 1 nos 1386 1385 ø 4.5mm cannulated screw, self drilling, short thread item1385 1 nos 1387 1386 ø 4.5mm cannulated screw, self drilling, short thread item1386 1 nos 1388 1387 ø 4.5mm cannulated screw, self drilling, short thread item1387 1 nos 1389 1388 ø 4.5mm cannulated screw, self drilling, short thread item1388 1 nos 1390 1389 ø 4.5mm cannulated screw, self drilling, short thread item1389 1 nos 1391 1390 ø 4.5mm cannulated screw, self drilling, short thread item1390 1 nos 1392 1391 ø 4.5mm cannulated screw, self drilling, short thread item1391 1 nos 1393 1392 ø 4.5mm cannulated screw, self drilling, short thread item1392 1 nos 1394 1393 ø 4.5mm cannulated screw, self drilling, short thread item1393 1 nos 1395 1394 ø 4.5mm cannulated screw, self drilling, short thread item1394 1 nos 1396 1395 ø 4.5mm cannulated screw, self drilling, short thread item1395 1 nos 1397 1396 ø 10.0mm washer item1396 1 nos 1398 1397 6.5mm cannulated screw, self drilling, 16mm thread length item1397 1 nos 1399 1398 6.5mm cannulated screw, self drilling, 16mm thread length item1398 1 nos 1400 1399 6.5mm cannulated screw, self drilling, 16mm thread length item1399 1 nos 1401 1400 6.5mm cannulated screw, self drilling, 16mm thread length item1400 1 nos 1402 1401 6.5mm cannulated screw, self drilling, 16mm thread length item1401 1 nos 1403 1402 6.5mm cannulated screw, self drilling, 16mm thread length item1402 1 nos 1404 1403 6.5mm cannulated screw, self drilling, 16mm thread length item1403 1 nos 1405 1404 6.5mm cannulated screw, self drilling, 16mm thread length item1404 1 nos 1406 1405 6.5mm cannulated screw, self drilling, 16mm thread length item1405 1 nos 1407 1406 6.5mm cannulated screw, self drilling, 16mm thread length item1406 1 nos 1408 1407 6.5mm cannulated screw, self drilling, 16mm thread length item1407 1 nos 1409 1408 6.5mm cannulated screw, self drilling, 16mm thread length item1408 1 nos 1410 1409 6.5mm cannulated screw, self drilling, 16mm thread length item1409 1 nos 1411 1410 6.5mm cannulated screw, self drilling, 16mm thread length item1410 1 nos 1412 1411 6.5mm cannulated screw, self drilling, 16mm thread length item1411 1 nos 1413 1412 6.5mm cannulated screw, self drilling, 16mm thread length item1412 1 nos 1414 1413 6.5mm cannulated screw, self drilling, 16mm thread length item1413 1 nos 1415 1414 6.5mm cannulated screw, self drilling, 16mm thread length item1414 1 nos 1416 1415 6.5mm cannulated screw, self drilling, 16mm thread length item1415 1 nos 1417 1416 6.5mm cannulated screw, self drilling, 16mm thread length item1416 1 nos 1418 1417 6.5mm cannulated screw, self drilling, 16mm thread length item1417 1 nos 1419 1418 6.5mm cannulated screw, self drilling, 16mm thread length item1418 1 nos 1420 1419 6.5mm cannulated screw, self drilling, 16mm thread length item1419 1 nos 1421 1420 6.5mm cannulated screw, self drilling, 16mm thread length item1420 1 nos 1422 1421 6.5mm cannulated screw, self drilling, 16mm thread length item1421 1 nos 1423 1422 6.5mm cannulated screw, self drilling, 16mm thread length item1422 1 nos 1424 1423 6.5mm cannulated screw, self drilling, 16mm thread length item1423 1 nos 1425 1424 6.5mm cannulated screw, self drilling, 16mm thread length item1424 1 nos 1426 1425 6.5mm cannulated screw, self drilling, 16mm thread length item1425 1 nos 1427 1426 6.5mm cannulated screw, self drilling, 16mm thread length item1426 1 nos 1428 1427 6.5mm cannulated screw, self drilling, 16mm thread length item1427 1 nos 1429 1428 ø 13.0mm washer item1428 1 nos 1430 1429 chemiluminiscence instrument (specifiction attached) item1429 1 nos 1431 1430 heamatology analyzer (specifiction attached) item1430 1 nos 1432 1431 gel centrifuge (specifiction attached) item1431 1 nos 1433 1432 gel card reader (specifiction attached) item1432 1 nos 1434 1433 variable pipette (ce certified) item1433 1 nos 1435 1434 variable pipette (ce certified) item1434 1 nos 1436 1435 spirometer item1435 1 nos 1437 1436 operating microscope item1436 1 nos 1438 1437 phaco machine item1437 1 nos 1439 1438 nasal endoscope (full set) item1438 1 nos 1440 1439 laparoscopy set item1439 1 nos 1441 1440 hplc/high performance lequied chromatography item1440 1 nos 1442 1441 carbon monoxide breath monitor item1441 1 nos 1443 1442 portable 3 channel ecg recorder item1442 1 nos 1444 1443 300ma fixed x ray unit with multi position table item1443 1 nos 1445 1444 100 ma,100 pps line frequency mobile x ray item1444 1 nos 1446 1445 biphasic defebrillator with aed item1445 1 nos 1447 1446 ctg nst machine item1446 1 nos 1448 1447 digital radiography system high frequency ( digital x ray) item1447 1 nos 1449 1448 high end premium ultrasound system item1448 1 nos 1450 1449 syringe pump item1449 1 nos ...

Rajendra Institute Of Medical Science - Jharkhand

24450238 supply and installation of medical minor equipment for neonatology department rims , ranchi , infantometer , stethoscope ( neonatal ) , low flow oxygen flowmeter ( 0 . 1 1l / min ) , glucometer , nebulizer , neonatal self inflating bag with face mask of sizes preterm and term , examination light with stand , laryngoscope with blade , air oxygen blender for neonates , suction apparatus portable electrical , fumigator system , x ray view box , direct ophthalmoscope , hand instruments instument tray ss ractangular with lid 12x10 inch , instrument tray ss ractangular with lid 12x15 inch , kidney tray ss 6 inch , kidney tray ss 8 inch , kidney tray ss 10 inch , galipot 4 inch , artery foreceps adson 6 inch , halsted mosquito haemostatic foreceps curved 12cm , halsted mosquito haemostatic foreceps curved 12 . 5cm , allis tissue grasping forceps 15 . 5 cm , towel clip ( cross action ) , thumb dissecting foreceps plain 5 inch , thumb dissecting foreceps toothed 5 inch , needle holder 15cm , tungston plated , sponge holding foreceps , straight 24cm , iris forceps straight , plain fine tip , iris forceps curved , plain fine tip , cheatle forceps , scalpel handle no 4 , metzenbaum disecting scissor straight 15 . 5cm , ss drum 11x9 inch , ss drum 15x12 inch , bowl ss 10inch...

Health Department - Jharkhand

24139835 rate contract for equipment and general item 2 functional refrigerator. 190ltr 3 boiler or autoclave ( 4 drom ) 4 dressing drum with lid 5 mattress 6 kellys pads 7 torch / torch box type pre focused ( 4 cell ) 8 examination lamp 9 wall clock with second hand 10 iv stand 11 sunction machine electric / foot operated suction apparatus 12 oxygen cylinder with troly 13 oxygen set ( mask with tubing ) 14 bp apparatus 15 adult stethoscope 16 fetoscope / doppler 17 basin 825 ml ss 18 hub cutter 19 needle destroyer electrical 20 digital thermometer 21 gauze cutting scissor stratight 22 weighing machine ( infant ) 23 weighing machine ( adult ) 24 thermometer rectal 25 dental probe 26 nebulizer 27 measuring tape 28 tallquist hb scale 29 snellen vision chart 30 near vision chart 31 stadiometer ( height measurement ) 32 tongue depressor 33 mouth gag 34 mouth mirror 35 cheatle forceps 36 dressing tray with lid 37 suturing tray with lid ss small 38 suring needle curved 39 suturing thread 40 round slit ( hole ) towel 41 radiant warmer / table with side rails 42 ambu bag 43 mask neonatal size ( 0 ) 44 mask neonatal size ( 1 ) 45 baby weighing scale 46 new born thermometer 47 oxygen hood ( neonatal ) 48 designated new born tray ss with lid 49 ss tray with cover 50 scissors 51 artery forceps 52 sims speculum 53 cord cutting scissor / surgical blade for cutting cord 54 bowl for antiseptic solution 55 kidney tray ( small ) 56 kidney tray ( big ) 57 episiotomy scissor 58 allis forceps 59 toothed forceps 60 thumb non toothed forceps 61 needle holder 62 cuscoss / graves speculum vaginal ( large ) 63 cuscoss / graves speculum vaginal ( medium ) 64 cuscoss / graves speculum vaginal ( small ) 65 sponge holding forceps 66 ppiucd insertion forceps 67 uterine sound ( for iucd ) 68 airway 69 labour table 70 rack / table for keeping trays, fluids 71 delivery troly 72 foot step 73 stool 74 screen seperator with stand 75 almira 76 rack for keeping sleepers / shoe covers outside labour room 77 cot 78 pillow 79 pillow cover 80 side locker 81 bed sheets 82 blankets 83 office table 84 chair 85 examination table 86 mattress for examination table 87 bucket big 88 bucket small 89 mugs 90 chairs for waiting area ( three in one set ) 91 led tv for iec 92 white wrighting board 93 disposable masks 94 gown / apron plastic 95 shoe cover 96 caps disposiable 97 heavy duty gloves 98 dry cell / battery aa 99 partograph in case sheets 100 5 l plastic tub for keeping chlorine solution 101 bucket for keeping 1% chlorine solution ( for spillage ) 102 colour coded bins yellow 60ltr 103 colour coded bins red 60ltr 104 colour coded bins black 60ltr 105 colour coded plastic bags ( yellow, red and black ) 80 ltr 106 iucd ( 375, 380a ) 107 sheets for drying and wrapping baby 108 cleaning material and detergents 109 insectiside treated net 110 window screens 111 200 watt bulb 112 online ups 1 kva with 60 minute backup 113 hand towels 114 soap 115 towel 116 ice pack box 117 vaccine carrier 118 floor mopping stick 119 dari with room size. 120 mats for yoga 121 curtains 122 part ii .national programme for health care of the elderly ( nphce ) 123 nebulizer 124 glucometer 125 ecg machine 126 defibrillator 127 non invasive ventilator 128 ambu bag 129 short wave diathermy 130 ultrasound therapy 131 cervical traction ( intermittent ) set 132 pelvic traction ( intermittent ) set 133 normal bed for traction 134 biomedical collection setup ( 4 bin system ) 135 tran electric nerve stimulator ( tens ) 136 wheel chair 137 electrical suction apparatus 138 stretcher trolley 139 adjustable walker 140 crash cart 141 torch 142 others as per requirement 143 bedside screens 144 fowler bed with double side stand 145 chairs 146 bed side table 147 alpha bed / air bed 148 cupboard for filing and storing 149 table 150 part iii. national oral health programme ( nohp ) 151 electronic dental chair 152 dental compressor 153 root elevators set of 9 154 periosteal elevators 155 extraction kit pedo ( set of 12 pcs. ) 156 extraction kit adult ( set of 12 pcs. ) 157 bone ronguer 158 mouth mirror tops magnified 159 cheek retractors 160 dental precision instrument n ( probe + mouth mirror & handle + tweezer ) 161 spatula 162 composite spatula lm arte 163 non stick composite antorior / posterior placement instruments 164 gic mixing pad 165 gc gold label 1 luting & lining 166 gc gold label 2 glass inomer 167 plastic filling instrument kit set of 6 regular 168 fine grain silver alloy 169 mercury 170 scaler tips 171 vivadent tentric n collection system kit / n bond 172 confident 70 kva x ray machine 173 indian film developing clip 174 mouth probe 175 twiser 176 ball burnisher ( bb 22 / 23 ) # 1 177 gic spatula 178 composit spatula 179 composite filling set 180 gic filling set 181 plastic spatula 182 amalgan + silver alloy 183 motor pistal 184 gic restorative material 185 gic luting material 186 composit ( ivoclar ) 187 ultrasonic scaler uds p 188 endo box with 72 holes 189 amalgan prepration bur 24 spk 190 scissor heath fior suture cutting 191 needle syringe destory 100% copper trausformer 100 watt 192 # 3 0 black braided suture 193 niddle holder mayo hegar 194 contrangle handpices fx 23 195 imprint alginate powder 196 alginate mixing bowl 197 set up tray 198 conservative kit economy instrument set of 19 in pauch 199 orafil g 40 mg temprory filling material 200 zinc oxide engeol quick cement set 201 scalple handle no. 4 202 bard parker blader # 12 / #15 203 finger spreaders 21 mm 204 finger spreaders 25 mm 205 plugger 21 mm 206 plugger 25 mm 207 dental intraoral e speed film 208 dental x ray film holder 209 dental x ray film developer 210 dental x ray film fixer 211 light cure 212 k file set 06 / 08 / 10 / 15 / 20 / 25 / 30 / 35 / 40 / 45 / 50 / 55 / 60 / 65 / 70 / 75 / 80 number 213 sprader 214 dental round bur 215 dental stright bur 216 dental taper fissure bur 217 dental taper bur 218 fissure bur 219 pear bur dimoned 220 pear bur ( 330 ) 221 taper flat & bur 222 flade fissure bur 223 suture needle size 6 / 7 / 8 224 suture scissor 225 x ray developing box 226 tray 227 dental stone 228 aerotar 229 micromotor complete set 230 imprassion tray dentulous perforated kit set of 8 231 part iv. national programme for control of blindness ( npcb ) 232 operating microscope 233 a scan 234 b scan 235 streak ratinoscope 236 o.t. table 237 operating chair 238 medicine trolly 239 sterlization set 240 surgical minor instrument 241 trial box+trial frame 242 rotating drum wall + near vision 243 retinoscope 244 opthalmoscope ( direct ) 245 kerotometer ( manual ) 246 torch o ( 3 cell ) 247 corneal loupe 248 slit lamp + autorofretometer + opthalmic chair 249 goniscopy 250 applanation tonometer 251 friedman visual field anaylosr 252 fundus photography machine 253 color vision chart 254 lencometer 255 retinal camera 256 tonometer 257 foreign body remover machine 258 ac 259 trial lens set illuminated with 232 lens and trial frame 260 distant vision illuminated drum with snellens chart 261 jaeger eye chart 262 direct ophthalmoscope 263 indirect ophthalmoscope 264 retinoscope 265 20 d lens 266 90 d lens 267 78 d lens 268 4 mirror gonio lens 269 slit lamp ( aia 11 5s / 5l ) with applanation tonometer and motorised stand 270 autorefractokeratometer and motorised stand 271 non contact tonometer 272 part v revised national tuberculosis control programme ( rntcp ) 273 ethanol 274 methylated spirit 275 distilled water ( d ionised water ) 276 basic fuschin 277 carbolic acid / phenol crystal 278 sulphuric acid 279 liquid parraffin ( heavy grade ) 280 glass slide 281 plastic disposable container with label 282 absorbent cotton 283 slide box 284 measuring cylender 285 pipet 286 pipet 287 amber bottle 288 falcon tube 289 diamond marker 290 staining rod 291 phunal 292 tissue paper 293 lens paper 294 filter paper 295 gloves 296 auramine ‘o’ 297 absolute alcohol 298 potassium permagnet 299 hydrochloride acid 300 oxalic acid 301 conical flask 302 methanol 303 mask 304 mask n 95 or higher 305 bp machine 306 gluco meter ( with 1 box strips ) 307 glucometer strip 308 part vi consumables for sadar hospital 309 gloves 6.5 no. 310 gloves 7 no. 311 adhesive tape 2 312 adhesive tape 4 313 cotton roll 500mg 314 cotton thread 315 gauze than 316 spirit 400ml 317 i.v set 318 s.v set 319 mucus extractor 320 bp machine 321 stretcher 322 stethoscope 323 oxygen flowmeter 324 weight machine adult 325 weight machine child 326 scissors 6 327 scissors 8 328 scissors 10 329 artery forcep 6, 8, 10 330 oxygen concentrator machine 331 wheel chairs 332 patient trolley 333 oxygen key 334 electric blender 335 water purifier 336 a.c 337 cooler 338 xerox machine ( black & white ) 339 chair with arms 340 chair without arms 341 table t8 342 table t14 343 plastic chairs 344 mosquito net 345 bedsheet white 346 pillow 347 pillow cover 348 towel white 349 red blanket 350 e.s.r stand 351 part vii. other programmes 352 dg gen set 353 dg gen set 354 a.c 355 cardiac monitor 356 computer 357 printer 358 cctv camera with full setup 359 fire extingusher 360 hydrolic labour table 361 cholorimeter 362 three seater waitting chair 363 corbon monoxide breath monitor 364 spirometer 365 portable audio system with cordless mike 366 television samsung 32 367 dvd player 368 projector 369 nsv kit 370 iucd kit 371 minilap kit 372 ppiucd forcep 373 grass cutter machine 374 high back chair 375 office table big size 5*3 feet 376 cardiac monitor 377 digital x ray machine 378 glucometer 379 glucometer strip 380 digital haemoglobinometer 381 haemoglobinometer strip 382 weighing machine for adult 383 weighing machine for child 384 laptop / 385 inverter 386 battery 150a 387 colour coded bin 60 ltr 388 colour coded bin 30 ltr 389 pulse oxymetre 390 portable x ray machine 391 defibrillator 392 ventilators ( adult ) 393 ventilators ( paediatrics ) 394 portable ultra sound machine 395 phenyl 5litre 396 wiper 397 handwash 398 broom 399 bleaching powder 400 bucket 10 litre 401 dettol soap 402 aquagaurd water purifier ( ro +uv ) 403 aquagaurd water purifier big size 404 ceiling fan 405 wall fan 406 exhaust fan 407 curtain for windows 408 curtain for doors 409 four folded bedside screen curtain 410 led bulb 411 plastic mug 412 plastic chair with arms 413 plastic chair without arms 414 red / black zipper bags 415 colour coded bio disposable bags 416 official almirah big size 417 official almirah with shelf...

Health Department - Jharkhand

24062364 rate contract for equipment and general item 2 functional refrigerator. 190ltr 3 boiler or autoclave ( 4 drom ) 4 dressing drum with lid 5 mattress 6 kellys pads 7 torch / torch box type pre focused ( 4 cell ) 8 examination lamp 9 wall clock with second hand 10 iv stand 11 sunction machine electric / foot operated suction apparatus 12 oxygen cylinder with troly 13 oxygen set ( mask with tubing ) 14 bp apparatus 15 adult stethoscope 16 fetoscope / doppler 17 basin 825 ml ss 18 hub cutter 19 needle destroyer electrical 20 digital thermometer 21 gauze cutting scissor stratight 22 weighing machine ( infant ) 23 weighing machine ( adult ) 24 thermometer rectal 25 dental probe 26 nebulizer 27 measuring tape 28 tallquist hb scale 29 snellen vision chart 30 near vision chart 31 stadiometer ( height measurement ) 32 tongue depressor 33 mouth gag 34 mouth mirror 35 cheatle forceps 36 dressing tray with lid 37 suturing tray with lid ss small 38 suring needle curved 39 suturing thread 40 round slit ( hole ) towel 41 radiant warmer / table with side rails 42 ambu bag 43 mask neonatal size ( 0 ) 44 mask neonatal size ( 1 ) 45 baby weighing scale 46 new born thermometer 47 oxygen hood ( neonatal ) 48 designated new born tray ss with lid 49 ss tray with cover 50 scissors 51 artery forceps 52 sims speculum 53 cord cutting scissor / surgical blade for cutting cord 54 bowl for antiseptic solution 55 kidney tray ( small ) 56 kidney tray ( big ) 57 episiotomy scissor 58 allis forceps 59 toothed forceps 60 thumb non toothed forceps 61 needle holder 62 cuscoss / graves speculum vaginal ( large ) 63 cuscoss / graves speculum vaginal ( medium ) 64 cuscoss / graves speculum vaginal ( small ) 65 sponge holding forceps 66 ppiucd insertion forceps 67 uterine sound ( for iucd ) 68 airway 69 labour table 70 rack / table for keeping trays, fluids 71 delivery troly 72 foot step 73 stool 74 screen seperator with stand 75 almira 76 rack for keeping sleepers / shoe covers outside labour room 77 cot 78 pillow 79 pillow cover 80 side locker 81 bed sheets 82 blankets 83 office table 84 chair 85 examination table 86 mattress for examination table 87 bucket big 88 bucket small 89 mugs 90 chairs for waiting area ( three in one set ) 91 led tv for iec 92 white wrighting board 93 disposable masks 94 gown / apron plastic 95 shoe cover 96 caps disposiable 97 heavy duty gloves 98 dry cell / battery aa 99 partograph in case sheets 100 5 l plastic tub for keeping chlorine solution 101 bucket for keeping 1% chlorine solution ( for spillage ) 102 colour coded bins yellow 60ltr 103 colour coded bins red 60ltr 104 colour coded bins black 60ltr 105 colour coded plastic bags ( yellow, red and black ) 80 ltr 106 iucd ( 375, 380a ) 107 sheets for drying and wrapping baby 108 cleaning material and detergents 109 insectiside treated net 110 window screens 111 200 watt bulb 112 online ups 1 kva with 60 minute backup 113 hand towels 114 soap 115 towel 116 ice pack box 117 vaccine carrier 118 floor mopping stick 119 dari with room size. 120 mats for yoga 121 curtains 122 part ii .national programme for health care of the elderly ( nphce ) 123 nebulizer 124 glucometer 125 ecg machine 126 defibrillator 127 non invasive ventilator 128 ambu bag 129 short wave diathermy 130 ultrasound therapy 131 cervical traction ( intermittent ) set 132 pelvic traction ( intermittent ) set 133 normal bed for traction 134 biomedical collection setup ( 4 bin system ) 135 tran electric nerve stimulator ( tens ) 136 wheel chair 137 electrical suction apparatus 138 stretcher trolley 139 adjustable walker 140 crash cart 141 torch 142 others as per requirement 143 bedside screens 144 fowler bed with double side stand 145 chairs 146 bed side table 147 alpha bed / air bed 148 cupboard for filing and storing 149 table 150 part iii. national oral health programme ( nohp ) 151 electronic dental chair 152 dental compressor 153 root elevators set of 9 154 periosteal elevators 155 extraction kit pedo ( set of 12 pcs. ) 156 extraction kit adult ( set of 12 pcs. ) 157 bone ronguer 158 mouth mirror tops magnified 159 cheek retractors 160 dental precision instrument n ( probe + mouth mirror & handle + tweezer ) 161 spatula 162 composite spatula lm arte 163 non stick composite antorior / posterior placement instruments 164 gic mixing pad 165 gc gold label 1 luting & lining 166 gc gold label 2 glass inomer 167 plastic filling instrument kit set of 6 regular 168 fine grain silver alloy 169 mercury 170 scaler tips 171 vivadent tentric n collection system kit / n bond 172 confident 70 kva x ray machine 173 indian film developing clip 174 mouth probe 175 twiser 176 ball burnisher ( bb 22 / 23 ) # 1 177 gic spatula 178 composit spatula 179 composite filling set 180 gic filling set 181 plastic spatula 182 amalgan + silver alloy 183 motor pistal 184 gic restorative material 185 gic luting material 186 composit ( ivoclar ) 187 ultrasonic scaler uds p 188 endo box with 72 holes 189 amalgan prepration bur 24 spk 190 scissor heath fior suture cutting 191 needle syringe destory 100% copper trausformer 100 watt 192 # 3 0 black braided suture 193 niddle holder mayo hegar 194 contrangle handpices fx 23 195 imprint alginate powder 196 alginate mixing bowl 197 set up tray 198 conservative kit economy instrument set of 19 in pauch 199 orafil g 40 mg temprory filling material 200 zinc oxide engeol quick cement set 201 scalple handle no. 4 202 bard parker blader # 12 / #15 203 finger spreaders 21 mm 204 finger spreaders 25 mm 205 plugger 21 mm 206 plugger 25 mm 207 dental intraoral e speed film 208 dental x ray film holder 209 dental x ray film developer 210 dental x ray film fixer 211 light cure 212 k file set 06 / 08 / 10 / 15 / 20 / 25 / 30 / 35 / 40 / 45 / 50 / 55 / 60 / 65 / 70 / 75 / 80 number 213 sprader 214 dental round bur 215 dental stright bur 216 dental taper fissure bur 217 dental taper bur 218 fissure bur 219 pear bur dimoned 220 pear bur ( 330 ) 221 taper flat & bur 222 flade fissure bur 223 suture needle size 6 / 7 / 8 224 suture scissor 225 x ray developing box 226 tray 227 dental stone 228 aerotar 229 micromotor complete set 230 imprassion tray dentulous perforated kit set of 8 231 part iv. national programme for control of blindness ( npcb ) 232 operating microscope 233 a scan 234 b scan 235 streak ratinoscope 236 o.t. table 237 operating chair 238 medicine trolly 239 sterlization set 240 surgical minor instrument 241 trial box+trial frame 242 rotating drum wall + near vision 243 retinoscope 244 opthalmoscope ( direct ) 245 kerotometer ( manual ) 246 torch o ( 3 cell ) 247 corneal loupe 248 slit lamp + autorofretometer + opthalmic chair 249 goniscopy 250 applanation tonometer 251 friedman visual field anaylosr 252 fundus photography machine 253 color vision chart 254 lencometer 255 retinal camera 256 tonometer 257 foreign body remover machine 258 ac 259 trial lens set illuminated with 232 lens and trial frame 260 distant vision illuminated drum with snellens chart 261 jaeger eye chart 262 direct ophthalmoscope 263 indirect ophthalmoscope 264 retinoscope 265 20 d lens 266 90 d lens 267 78 d lens 268 4 mirror gonio lens 269 slit lamp ( aia 11 5s / 5l ) with applanation tonometer and motorised stand 270 autorefractokeratometer and motorised stand 271 non contact tonometer 272 part v revised national tuberculosis control programme ( rntcp ) 273 ethanol 274 methylated spirit 275 distilled water ( d ionised water ) 276 basic fuschin 277 carbolic acid / phenol crystal 278 sulphuric acid 279 liquid parraffin ( heavy grade ) 280 glass slide 281 plastic disposable container with label 282 absorbent cotton 283 slide box 284 measuring cylender 285 pipet 286 pipet 287 amber bottle 288 falcon tube 289 diamond marker 290 staining rod 291 phunal 292 tissue paper 293 lens paper 294 filter paper 295 gloves 296 auramine ‘o’ 297 absolute alcohol 298 potassium permagnet 299 hydrochloride acid 300 oxalic acid 301 conical flask 302 methanol 303 mask 304 mask n 95 or higher 305 bp machine 306 gluco meter ( with 1 box strips ) 307 glucometer strip 308 part vi consumables for sadar hospital 309 gloves 6.5 no. 310 gloves 7 no. 311 adhesive tape 2 312 adhesive tape 4 313 cotton roll 500mg 314 cotton thread 315 gauze than 316 spirit 400ml 317 i.v set 318 s.v set 319 mucus extractor 320 bp machine 321 stretcher 322 stethoscope 323 oxygen flowmeter 324 weight machine adult 325 weight machine child 326 scissors 6 327 scissors 8 328 scissors 10 329 artery forcep 6, 8, 10 330 oxygen concentrator machine 331 wheel chairs 332 patient trolley 333 oxygen key 334 electric blender 335 water purifier 336 a.c 337 cooler 338 xerox machine ( black & white ) 339 chair with arms 340 chair without arms 341 table t8 342 table t14 343 plastic chairs 344 mosquito net 345 bedsheet white 346 pillow 347 pillow cover 348 towel white 349 red blanket 350 e.s.r stand 351 part vii. other programmes 352 dg gen set 353 dg gen set 354 a.c 355 cardiac monitor 356 computer 357 printer 358 cctv camera with full setup 359 fire extingusher 360 hydrolic labour table 361 cholorimeter 362 three seater waitting chair 363 corbon monoxide breath monitor 364 spirometer 365 portable audio system with cordless mike 366 television samsung 32 367 dvd player 368 projector 369 nsv kit 370 iucd kit 371 minilap kit 372 ppiucd forcep 373 grass cutter machine 374 high back chair 375 office table big size 5*3 feet 376 cardiac monitor 377 digital x ray machine 378 glucometer 379 glucometer strip 380 digital haemoglobinometer 381 haemoglobinometer strip 382 weighing machine for adult 383 weighing machine for child 384 laptop / 385 inverter 386 battery 150a 387 colour coded bin 60 ltr 388 colour coded bin 30 ltr 389 pulse oxymetre 390 portable x ray machine 391 defibrillator 392 ventilators ( adult ) 393 ventilators ( paediatrics ) 394 portable ultra sound machine 395 phenyl 5litre 396 wiper 397 handwash 398 broom 399 bleaching powder 400 bucket 10 litre 401 dettol soap 402 aquagaurd water purifier ( ro +uv ) 403 aquagaurd water purifier big size 404 ceiling fan 405 wall fan 406 exhaust fan 407 curtain for windows 408 curtain for doors 409 four folded bedside screen curtain 410 led bulb 411 plastic mug 412 plastic chair with arms 413 plastic chair without arms 414 red / black zipper bags 415 colour coded bio disposable bags 416 official almirah big size 417 official almirah with shelf...

Health Department - Jharkhand

23472492 rate contract of equipments at ranchi sadar 1 list of machine 2 mva aspirator 3 glass pippette 4 forceps, uterine nelaton solid tip one eye ( ( tungsten carbide tip ) 5 suction tube ( 225 rnrn, ss ) 6 valve inhaler ( chrome plated brass, y shape ) 7 intravenous ( set in box ) 8 needle spinal stainless ( set of 4 ) 9 syringe, anesthetic ( control 5 ml luer mount glass ) 10 head light ( ordinary ) ( boyle davis ) 11 beds semi recilining 12 32 lcd telivision 13 led tv 42’’ 14 cd player ( home theater with 5 sound box ) 15 domestic refrigetor 190 ltr. 16 feeding equipments ( tubes, katoris & spoon ) 17 channel semi automatic coaglomater with regent 18 all types of dental extraction forceps ( each set 3 sets minimum required which includes upper and lower molars and anterior forceps. 19 x ray machine 100 ma with dark room assoseries ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) 20 standalone color doppler machine ( specification should be attached in technical bid turms & condition ) 21 portable ultra sound with pw ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) 22 portable cooling unit ( vaccine / blood bags ) ( specification should be attached in technical bid turms & condition ) 23 o.t light ( dichroic reflector ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) 24 hospital bed ( ss head & foot side rod ) ( specification should be attached in technical bid turms & condition ) 25 led light ( single ) ( with installation & 1 yrs. warrenty ) ( specification should be attached in technical bid turms & condition ) 26 ultra high speed laboratary centrifuge ( specifications attached ) 27 digital incubator ( specifications attached ) 28 boyles machine ( specifications attached ) 29 72 led dome ( double dome ) , lux 1, 30, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. 30 48 led dome ( single dome ) , lux 1, 00, 000 ( + 10% ) , central focusing, focus point 15 cm, penentration depth 8 10 inche, intensity controller. 31 coutery machine ( 400 w ) 32 coutery machine ( 250 w ) 33 portable o.t. light ( abs doom 19 single reflecter polycarbonate ) 34 portable o.t. light led 35 vaccu suck suction tube ( titanium ) ( for suction machine ) 36 alis forcep 10 ( titanium ) 37 tissue forcep 10 ( titanium ) 38 convex array tranducer c343ua ( for ultra sound machine ) 39 phototherephy unit single surface ( stand model ) 40 phototherephy unit single surface led ( with led buld ) 41 silent genrator 10 kva ( with installation ) ( 10 kva, 3 phase, water cooled ) 42 silent genrator 15 kva ( with installation ) ( 15 kva, 3 phase, water cooled ) 43 silent genrator 20 kva ( with installation ) ( 20 kva, 3 phase, water cooled ) 44 silent genrator 50 kva ( with installation ) ( 50 kva, 3 phase, water cooled ) 45 silent genrator 82 kva ( with installation ) ( 82 kva, 3 phase, water cooled ) 46 magil circuit with mask ( for boyles apparatus ) 47 patho fast test kit ( for patho fast machine ) 48 blood gas analyser test kit ( for blood gas analyser ) 49 dossimeter 50 peak expiritory flow meter ( best quality ) 51 laryngoscope fibreoptic ent ( best quality ) 52 p.v. tray ( best quality ) 53 varicose vein set ( best quality ) 54 connector set of six for en ( best quality ) 55 tubes connecting for en ( best quality ) 56 leqqinqs 57 explorar 58 endo explorar 59 amalgam carrier in sliver 60 murcury ball burnisher 61 carver ( dimond ) 62 compactor 63 element carrier 64 gic ( glass ionomer cement ) 65 zinc phosphate cement 66 temporary filling material 67 electric ventouse 68 radient baby warmer 69 right angel artry 4 70 right angel artry 6 71 automated autoref stand ( for ophthalmic ) 72 2 mirror cronioscope ( for ophthalmic ) 73 disposable needle 26 g ( for ophthalmic ) 74 ppiucd forcep 75 uterus collection ( sister u and mama u ) 76 water cooler with purifire ( 120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap 77 water cooler with purifire ( 80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap 78 water cooler with purifire ( 40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap 79 hemoglobinometer ( 1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g / dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd / us fda / iso approved 6. automatic correction of hb. 7. 20 80 digital x rey film ( konika ) 8x10 81 digital x rey film ( konika ) 10x12 82 digital x rey film ( konika ) 12x12 83 digital x rey film ( konika ) 12x15 84 coin operated water atm machine ( ro plant and chiller ) nspecification n• power : 100 270vac • solenoid: 12vdc ( internal ) • flow sensor: pulse type• level sensing: treated water level floaty n• display: 2.8 tft, monochrome • programming keys: 5 • activation 85 water atm machine • easy to use and lend a lot of convenience n• plug and play module kiosk can be installed in 3 hours n• kiosk can produce up to 12000 liters of pure mineralized water per day, the lft units can produce 30, 000 liters per day • automatic 86 x ray digitalisation with high end cr system ( with installation & 1 yrs. warrenty ) nconsole software with multi modality work station nthe cr system should have advanced workstation provided with 17” high resolution monitor, keyboard & mouse, with the fol 87 x ray 500 ma ( with 1 yrs. warrenty ) nx ray genera tor: nhigh frequency x ray generator of frequency 40khz should be provided. npower output of generator should be of sokw. nkv range should be: n• radiographic kv: 40 to 12sky. n• fluoroscopic kv: 40 to 120k 88 micro scope binoculor ( with 1 yrs. amc ) n ( ? stand: should be robust and sterile aluminum dye cast base n? observation: binocular tube should be inclined at 45deg and rotatable up to 360deg. mechanical tube length of 160mm. n? noise piece: quadruple revolvi 89 electrolyte analyser n ( principle: direct measurement with lon selective electrode ( ise ) nsample: 120 μl for whole blood, serum, plasma 700 μl for diluted ( 1:5 ) urine ndata storage: 100 patients result qc up to 30 results of normal, low, and high each. noutput: 90 suction machine foot operated n ( powder coated m.s. chassis. nnoise level of suction apparatus from is 50 db + / 03 db. nleakage current of suction units is less than 84 ua. nelectrical requirement – 220 ~ 230v, 50hz, 1 phase. nideal for mtp / medical / surgic 91 suction apparatus ( electric ) nsuction machine with pump: power supply: 230 240v / 50hz vacuum capacity: 18 litres / mim maximum depression: 75kpa ( 563mmhg ) vacuum is created by a plastic piston and cylinder system, with four vacuum creating modules ( 92 phototherapy unit n1 led phototherapy with intensity upto 6 50microwatts / nm / cumm / mwatt, adjustable nintensity. n2 .height adjustable and tiltable light unit. n3 digital time totaller of led usage time. n4 stainless steel tray. n5 –provision for double surf 93 opthalmoscope n1. should be rechargeable battery with charger / mains operated. n2. should have halogen / led light source n3. should have red free filters n4. should have small and large spot sizes, fixation targets, slit aperture, hemi spot and cobalt blu 94 wireless indirect ophthalmoscope ( led ) ( compact and light weight, stereo optical system has all pupil features rechargeable battery integrated on headbrilliant white light with uniform and well spread led illumination ( focus distance : 300 800 mm, inter pupillary distance 50 74 mm, pupil size optics 1.00 mm, illumination : ledillumination 95 dental chair n1. should be electrically operated with zero program. n2. should have a switch operated operating light with minimum two steps of nintensity control. n3. should have auto water connection for spittoon and tumbler with auto filling nsensor. n4. s 96 pa system n ( • recessed mount ( ceiling ) , surface mount, column and / or horn speakers, 12 watts with inbuilt transformer , wooden body , pressure level 97db, range 200 15000hz, rated voltage 100v, impedence 833 amplifier rated voltage output 100v, 150watts, mu 97 token display system n ( token dispenser with issue keys , thermal printer, calling unit with keys for calling next token number, token display unit for showing token on cabin outdoor, central led display unit for showing token number with cabin number conne 98 cctv ( 32 dvr ) n ( 32 dvr :processor high performance embedded microprocessor, operating system embedded linux, user interface gui, video input 32 channel, bnc, video output 1 hdmi, 1 vga, video standard analog:32ch. @1080n ( 1~15fps ) , 24ch. @1080n, 16ch. @10 99 intercom n ( 24 extensions, expandable upto 32, micro controller based spc space division multiplexing, extension loop resistance : 600 ohms, noperating temperature : 0 c to 45 c, power consumption : max. 100 watts, operating voltage : 220v 10% ) n 100 av retractor n1.stainless steel n2.double ended, serrated n3.rust free n4.sturdy construction n5.accurate dimensions n 101 vulcellum nstainless steel nsize: 10 inch ncolour: silver nshape: curved n 102 ppiucd forcep ss 103 baby forceps ss ( big – straight ) 104 baby forceps ss ( big – curve ) 105 baby forceps ss ( big – straight ) 106 baby forceps ss ( small – curve ) 107 baby forceps ss ( small – straight ) 108 folis catheter 24 no 109 lab incubator n1. should have 4 inch attractive lcd display n2. should have intelligent controller to help maintain temperature in case of sensor failure n3. should have battery backup for temperature controller n4. should have auto tuning of controller 110 electricentrifuge, table top ( table top electric centrifuge ) n1. should have stepless speed regulator n2. should have safety lid interlock to prevent cover opening during n centrifugation. n3. dynamic brake for quick deceleration n4. wide choice of swing out 111 cbc machine ( 5 part blood cell counter machine ) n1. should have throughput – 50 samples / hour n2. the sample volume should be < 17 μl n3. should have technology – impedance ( wbc, rbc, plt ) , spectrophotometry ( hcg ) , should have optical laser method for 5 112 incubator for culture sensitivity 113 hpcl machine n. system should be compact bench top hplc system. n2. system should use cation exchange hplc principle for estimation of nstable a1c. n3. system should have built in computer with the system software and nmust be able to work independent of exte 114 esr stand with tubes 115 elisa reader cum washer 116 glycosylated haemoglobinometer 117 blood collection monitor 118 intensifying screen x ray 119 dossimeter 120 peak expiritory flow meter ( best quality ) 121 baby incubators ( best quality ) 122 craniotomy ( best quality ) 123 static vaccum extractor ( best quality ) 124 head light ( ordinary ) ( boyle davis ) ( best quality ) 125 ent operation set including headlight, tonsils 126 ent nasal set ( smr, septoplasty, nasal endoscopic set ( 00 & 300 ) polypetcomy, dns, rhinoplasty ) ( best quality ) 127 laryngoscope fibreoptic ent ( best quality ) 128 tracheostomy set ( best quality ) 129 proctoscopy set adult ( best quality ) 130 proctoscopy set peadiartric ( best quality ) 131 p.v. tray ( best quality ) 132 abdominal hysterectomy set ( best quality ) 133 laparotomy set ( best quality ) 134 varicose vein set ( best quality ) 135 thomas splint ( best quality ) 136 laproscopy set for cholecystectomy 137 amputation set ( best quality ) 138 colposcope ( best quality ) 139 mouth prop 140 regional anaesthesia devices, epidural set 141 vascular clamp set ( best quality ) 142 steel cup board 143 case sheet holders with clip ( ss ) 144 draw sheet 145 pereneal sheets for ot 146 explorar 147 spoon excavator 148 twizer 149 endo explorar 150 amalgam carrier in silver 151 murcury ball burnisher 152 carver ( dimond ) 153 steel chittle forcep container 154 diathermy machine 155 doyess ( medium ) 156 gernes retractor 157 metal catheter 158 mayo scissor curved 159 lma ( adult ) 160 steel galipot small 161 dressing drum size 9x11 162 sims vaginal speculam 163 epsiotomy scissor 164 ovum forcep 165 tailor scissor 166 doctor & nurse dress with designation ( paijama & kurta ) 167 doynes retroctor 1.5” ( german steel ) each 168 doynes retroctor 2” ( german steel ) each 169 doynes retroctor 2.5” ( german steel ) each 170 doynes retroctor 3” ( german steel ) each 171 doynes retroctor 3.5” ( german steel ) each 172 czernys retractor ( german steel ) each 173 formalin chamber ( 20x8x8x5 mm ) 174 formalin chamber ( 26x8x8x5 mm ) 175 lifter with jar 176 strraight scissor 5” ( german steel ) each 177 strraight scissor 6” ( german steel ) each 178 strraight scissor 7” ( german steel ) each 179 strraight scissor 8” ( german steel ) each 180 s.s. bowl 30 cm ( super fine quality ) each 181 s.s. bowl 36 cm ( super fine quality ) each 182 babcock clamp 6” ( german steel ) each 183 babcock clamp 8” ( german steel ) each 184 ambu bag adult ( silicorised ) ( super fine quality ) 185 ambu bag child ( silicorised ) ( super fine quality ) 186 artery forceps 6” curved ( german steel ) 187 artery forceps 6” straight ( german steel ) 188 mayo scissor long curved 6.5” each ( german steel ) 189 mayo scissor long curved 7.5” each ( german steel ) 190 allies forcep 6” each ( german steel ) 191 allies forcep 8” each ( german steel ) 192 tooth forceps 6” each ( german steel ) 193 non tooth forceps 6” each ( german steel ) 194 tenaculum long each ( german steel ) 195 myome screw each ( german steel ) 196 morrisen retractor each ( german steel ) 197 sim speculum medium each ( german steel ) 198 sim speculum long each ( german steel ) 199 waste disposal colour coded buckets swine bing 80 ltr. ( black, red, yellow, blue ) ( neelkamal, cello, suprem, nayasa ) 200 waste disposal colour coded buckets ( black, red, yellow, blue ) ( neelkamal, cello, suprem ) 201 dust bin ( ss ) small ( best quality ) 202 dust bin ( ss ) big ( best quality ) 203 sauce pan with lid 204 chest stand for x rey unit 205 oropharyngeal airway ( 000 4 guydel size ) 206 oxygen cylinder 10 ltr. mo2 with valve 207 bipap machine 208 shoe cover – per pair 209 elvo gloves – per pair 210 lyarigoscope set adult with led – each 211 lyarigoscope set child with led – each 212 hemoglobino meter digital – each 213 disposable syringe 20 ml – each 214 massiring mug – each 215 hair tremer branded – each 216 hot air oven 217 urino meter 218 adk drain 219 concigated drain ( plastic ) 220 diatharmy plate for vally lab 221 laryngoscope adult set 222 laryngoscope ped. set 223 coutry pencil 224 crash card with steel drower 225 spoon ( stenless steel ) 226 digital spirometer 227 digital glucometer 228 digital glucometer strip ( 25 test ) 229 carbonmonoxide monitor 230 ecg machine computarized for ccu ( specifications attached ) 231 ecg machine ordinary ( specifications attached ) 232 cardiac monitor for ccu ( specifications attached ) 233 cardiac monitor for ccu ( specifications attached ) 234 cardiac monitor for ccu ( specifications attached ) 235 defebrillator for ccu ( specifications attached ) 236 ventillator ( adult ) for ccu ( specifications attached ) 237 ventillator ( paediatric ) for ccu ( specifications attached ) 238 pulse oximeter for ccu ( specifications attached ) 239 pulse oximter with nib for ccu ( specifications attached ) 240 carm for ccu ( specifications attached ) 241 laryngoscope for ccu ( specifications attached ) 242 nibulisor adult with mask 243 nibulisor child with mask 244 nibulisor mask for adult 245 nibulisor mask for child 246 infant weighing scale 247 lc dcp and dcp basic instrument set 248 small fragment lc dcp & dcp® instrument set, st. steel 249 select lcp upgrade instrument set large & small fragment 250 dhs / dcs instrument set 251 css 4.5mm instrument set in vario case 252 css 6.5mm instrument set in vario case 253 synream 254 distractor set large 255 distractor set medium 256 bone forceps range 257 general instrument set 258 instruments for damaged screw removal 259 chisel and impactor set 260 tomofix instrument set in syncase 261 instrument set for minimally invasive plate insertion osteosynthesis ( mipo ) in vario case 262 collinear reduction clamp in vario case 263 reduction handles, toothed and rounded, small & large in modular tray 264 mipo cerclage passer 265 hohmann retractor 266 soft tissue spreader set 267 periarticular reduction forceps 268 pelvic basic instruments 269 pelvic reduction & retraction 270 pelvic c clamp 271 wire instrumnents set 272 shoulder instruments 273 lcp dhs 274 2.4mm lps distal radial plate, volar 275 2.4mm lps distal radial plate, volar 276 2.4mm lps distal radial plate, volar 277 2.4mm lps distal radial plate, volar 278 2.4mm lps distal radial plate, volar buttress 279 2.4mm lps distal radial plate, volar buttress 280 2.4mm lps distal radial plate, extra articular 281 2.4mm lps distal radial plate, extra articular 282 2.4mm lps distal radial plate, extra articular 283 2.4mm lps distal radial plate, extra articular 284 2.4mm lps distal radial plate, extra articular 285 2.4mm lps distal radial plate, extra articular 286 2.4mm lps distal radial plate, extra articular 287 2.4mm lps distal radial plate, extra articular 288 2.4mm lps t distal radial plate 289 2.4mm lps t distal radial plate 290 2.4mm lps distal radial plate, straight 291 2.4mm lps distal radial plate, straight 292 2.4mm lps l distal radial plate, right angled 293 2.4mm lps l distal radial plate, right angled 294 2.4mm lps l distal radial plate, right angled 295 2.4mm lps l distal radial plate, right angled 296 2.4mm lps l distal radial plate, right angled 297 2.4mm lps l distal radial plate, right angled 298 2.4mm lps l distal radial plate, right angled 299 2.4mm lps l distal radial plate, right angled 300 2.4mm lps l distal radial plate, oblique angled 301 2.4mm lps l distal radial plate, oblique angled 302 2.4mm lps l distal radial plate, oblique angled 303 2.4mm lps l distal radial plate, oblique angled 304 2.4mm lps distal radial plate, long 305 2.4mm lps distal radial plate, long 306 2.4mm lps distal radial plate, long 307 2.4mm lps volar rim distal radial plate 308 2.4mm lps volar rim distal radial plate 309 2.4mm lps volar rim distal radial plate 310 2.4mm lps volar rim distal radial plate 311 2.4mm lps double column distal radial plate, volar 19.5 mm 312 2.4mm lps double column distal radial plate, volar 19.5 mm 313 2.4mm lps double column distal radial plate, volar 19.5 mm 314 2.4mm lps double column distal radial plate, volar 19.5 mm 315 2.4mm lps double column distal radial plate, volar 19.5 mm 316 2.4mm lps double column distal radial plate, volar 19.5 mm 317 2.4mm lps double column distal radial plate, volar 19.5 mm 318 2.4mm lps double column distal radial plate, volar 19.5 mm 319 2.4mm lps double column distal radial plate, volar 22.5 mm 320 2.4mm lps double column distal radial plate, volar 22.5 mm 321 2.4mm lps double column distal radial plate, volar 22.5 mm 322 2.4mm lps double column distal radial plate, volar 22.5 mm 323 2.4mm lps double column distal radial plate, volar 22.5 mm 324 2.4mm lps double column distal radial plate, volar 22.5 mm 325 2.4mm lps double column distal radial plate, volar 22.5 mm 326 2.4mm lps double column distal radial plate, volar 22.5 mm 327 2.4mm lps double column distal radial plate, volar 25.5 mm 328 2.4mm lps double column distal radial plate, volar 25.5 mm 329 2.4mm lps double column distal radial plate, volar 25.5 mm 330 2.4mm lps double column distal radial plate, volar 25.5 mm 331 2.4mm lps double column distal radial plate, volar 25.5 mm 332 2.4mm lps double column distal radial plate, volar 25.5 mm 333 2.4mm lps double column distal radial plate, volar 25.5 mm 334 2.4mm lps double column distal radial plate, volar 25.5 mm 335 ø 2.4mm locking screw t8, self tapping 336 ø 2.4mm locking screw t8, self tapping 337 ø 2.4mm locking screw t8, self tapping 338 ø 2.4mm locking screw t8, self tapping 339 ø 2.4mm locking screw t8, self tapping 340 ø 2.4mm locking screw t8, self tapping 341 ø 2.4mm locking screw t8, self tapping 342 ø 2.4mm locking screw t8, self tapping 343 ø 2.4mm locking screw t8, self tapping 344 ø 2.4mm locking screw t8, self tapping 345 ø 2.4mm locking screw t8, self tapping 346 ø 2.4mm locking screw t8, self tapping 347 ø 2.4mm cortex screw t8, self tapping 348 ø 2.4mm cortex screw t8, self tapping 349 ø 2.4mm cortex screw t8, self tapping 350 ø 2.4mm cortex screw t8, self tapping 351 ø 2.4mm cortex screw t8, self tapping 352 ø 2.4mm cortex screw t8, self tapping 353 ø 2.4mm cortex screw t8, self tapping 354 ø 2.4mm cortex screw t8, self tapping 355 ø 2.4mm cortex screw t8, self tapping 356 ø 2.4mm cortex screw t8, self tapping 357 ø 2.4mm cortex screw t8, self tapping 358 ø 2.4mm cortex screw t8, self tapping 359 ø 2.4mm cortex screw t8, self tapping 360 ø 2.4mm cortex screw t8, self tapping 361 ø 2.4mm cortex screw t8, self tapping 362 ø 2.4mm cortex screw t8, self tapping 363 ø 2.4mm cortex screw t8, self tapping 364 ø 2.7mm cortex screw t8, self tapping 365 ø 2.7mm cortex screw t8, self tapping 366 ø 2.7mm cortex screw t8, self tapping 367 ø 2.7mm cortex screw t8, self tapping 368 ø 2.7mm cortex screw t8, self tapping 369 ø 2.7mm cortex screw t8, self tapping 370 ø 2.7mm cortex screw t8, self tapping 371 ø 2.7mm cortex screw t8, self tapping 372 ø 2.7mm cortex screw t8, self tapping 373 ø 2.7mm cortex screw t8, self tapping 374 ø 2.7mm cortex screw t8, self tapping 375 ø 2.7mm cortex screw t8, self tapping 376 ø 2.7mm cortex screw t8, self tapping 377 ø 2.7mm cortex screw t8, self tapping 378 ø 2.7mm cortex screw t8, self tapping 379 ø 2.7mm cortex screw t8, self tapping 380 ø 2.7mm cortex screw t8, self tapping 381 ø 2.7mm cortex screw t8, self tapping 382 ø 2.7mm cortex screw t8, self tapping 383 ø 2.7mm cortex screw t8, self tapping 384 ø 2.7mm cortex screw t8, self tapping 385 ø 2.4mm headless compression screw short thread 386 ø 2.4mm headless compression screw short thread 387 ø 2.4mm headless compression screw short thread 388 ø 2.4mm headless compression screw short thread 389 ø 2.4mm headless compression screw short thread 390 ø 2.4mm headless compression screw short thread 391 ø 2.4mm headless compression screw short thread 392 ø 2.4mm headless compression screw short thread 393 ø 2.4mm headless compression screw short thread 394 ø 2.4mm headless compression screw short thread 395 ø 2.4mm headless compression screw short thread 396 ø 2.4mm headless compression screw short thread 397 ø 2.4mm headless compression screw short thread 398 ø 2.4mm headless compression screw short thread 399 ø 2.4mm headless compression screw short thread 400 ø 2.4mm headless compression screw short thread 401 ø 2.4mm headless compression screw short thread 402 ø 2.4mm headless compression screw long thread 403 ø 2.4mm headless compression screw long thread 404 ø 2.4mm headless compression screw long thread 405 ø 2.4mm headless compression screw long thread 406 ø 2.4mm headless compression screw long thread 407 ø 2.4mm headless compression screw long thread 408 ø 2.4mm headless compression screw long thread 409 ø 2.4mm headless compression screw long thread 410 3.5mm lps small compression plate 411 3.5mm lps small compression plate 412 3.5mm lps small compression plate 413 3.5mm lps small compression plate 414 3.5mm lps small compression plate 415 3.5mm lps small compression plate 416 3.5mm lps small compression plate 417 3.5mm lps small compression plate 418 3.5mm lps small compression plate 419 3.5mm lps small compression plate 420 3.5mm lps small compression plate 421 3.5mm lps small compression plate 422 3.5mm lps small compression plate 423 3.5mm lps small compression plate 424 3.5mm lps small compression plate 425 3.5mm lps small compression plate 426 3.5mm lps small metaphyseal plate 427 3.5mm lps small metaphyseal plate 428 3.5mm lps small metaphyseal plate 429 3.5mm lps small metaphyseal plate 430 3.5mm lps small metaphyseal plate 431 3.5mm lps small metaphyseal plate 432 3.5mm lps small metaphyseal plate 433 3.5mm lps small metaphyseal plate 434 3.5mm lps small metaphyseal plate 435 3.5mm lps small metaphyseal plate 436 3.5mm lps reconstruction round hole plate 437 3.5mm lps reconstruction round hole plate 438 3.5mm lps reconstruction round hole plate 439 3.5mm lps reconstruction round hole plate 440 3.5mm lps reconstruction round hole plate 441 3.5mm lps reconstruction round hole plate 442 3.5mm lps reconstruction round hole plate 443 3.5mm lps reconstruction round hole plate 444 3.5mm lps reconstruction combined hole plate 445 3.5mm lps reconstruction combined hole plate 446 3.5mm lps reconstruction combined hole plate 447 3.5mm lps reconstruction combined hole plate 448 3.5mm lps reconstruction combined hole plate 449 3.5mm lps reconstruction combined hole plate 450 3.5mm lps reconstruction combined hole plate 451 3.5mm lps reconstruction combined hole plate 452 3.5mm lps reconstruction combined hole plate 453 3.5mm lps reconstruction combined hole plate 454 3.5mm lps reconstruction combined hole plate 455 3.5mm lps reconstruction combined hole plate 456 3.5mm lps reconstruction combined hole plate 457 3.5mm lps reconstruction combined hole plate 458 3.5mm lps t plate right angled 459 3.5mm lps t plate right angled 460 3.5mm lps t plate right angled 461 3.5mm lps t plate right angled 462 3.5mm lps t plate right angled 463 3.5mm lps cloverleaf plate 464 3.5mm lps cloverleaf plate 465 3.5mm lps cloverleaf plate 466 3.5mm lps cloverleaf plate 467 3.5mm lps t plate oblique angled 468 3.5mm lps t plate oblique angled 469 3.5mm lps t plate oblique angled 470 3.5mm lps t plate oblique angled 471 3.5mm lps t plate oblique angled 472 3.5mm lps t plate oblique angled 473 3.5mm lps t plate oblique angled 474 3.5mm lps t plate oblique angled 475 3.5mm lps t plate oblique angled 476 3.5mm lps t plate oblique angled 477 3.5mm lps t plate oblique angled 478 3.5mm lps t plate oblique angled 479 3.5mm lps proximal humerus plate short 480 3.5mm lps proximal humerus plate short 481 3.5mm lps proximal humerus plate long 482 3.5mm lps proximal humerus plate long 483 3.5mm lps proximal humerus plate long 484 3.5mm lps proximal humerus plate long 485 3.5mm lps proximal humerus plate long 486 3.5mm lps proximal tibia plate 487 3.5mm lps proximal tibia plate 488 3.5mm lps proximal tibia plate 489 3.5mm lps proximal tibia plate 490 3.5mm lps proximal tibia plate 491 3.5mm lps proximal tibia plate 492 3.5mm lps proximal tibia plate 493 3.5mm lps proximal tibia plate 494 3.5mm lps proximal tibia plate 495 3.5mm lps proximal tibia plate 496 3.5mm lps proximal tibia plate 497 3.5mm lps proximal tibia plate 498 3.5mm lps proximal tibia plate 499 3.5mm lps proximal tibia plate 500 3.5mm lps medial proximal tibial plate 501 3.5mm lps medial proximal tibial plate 502 3.5mm lps medial proximal tibial plate 503 3.5mm lps medial proximal tibial plate 504 3.5mm lps medial proximal tibial plate 505 3.5mm lps medial proximal tibial plate 506 3.5mm lps medial proximal tibial plate 507 3.5mm lps medial proximal tibial plate 508 3.5mm lps medial proximal tibial plate 509 3.5mm lps medial proximal tibial plate 510 3.5mm lps medial proximal tibial plate 511 3.5mm lps medial proximal tibial plate 512 3.5mm lps medial proximal tibial plate 513 3.5mm lps medial proximal tibial plate 514 3.5mm lps medial proximal tibial plate 515 3.5mm lps medial proximal tibial plate 516 3.5mm lps medial proximal tibial plate 517 3.5mm lps medial proximal tibial plate 518 3.5mm lps medial distal tibia low bend plate 519 3.5mm lps medial distal tibia low bend plate 520 3.5mm lps medial distal tibia low bend plate 521 3.5mm lps medial distal tibia low bend plate 522 3.5mm lps medial distal tibia low bend plate 523 3.5mm lps medial distal tibia low bend plate 524 3.5mm lps medial distal tibia low bend plate 525 3.5mm lps medial distal tibia low bend plate 526 3.5mm lps medial distal tibia low bend plate 527 3.5mm lps medial distal tibia low bend plate 528 3.5mm lps medial distal tibia low bend plate 529 3.5mm lps medial distal tibia low bend plate 530 3.5mm lps one third tubular plate 531 3.5mm lps one third tubular plate 532 3.5mm lps one third tubular plate 533 3.5mm lps one third tubular plate 534 3.5mm lps one third tubular plate 535 3.5mm lps one third tubular plate 536 3.5mm lps one third tubular plate 537 3.5mm lps one third tubular plate 538 3.5mm lps one third tubular plate 539 3.5mm lps one third tubular plate 540 3.5mm lps proximal humerus locking plate 541 3.5mm lps proximal humerus locking plate 542 3.5mm lps anterior lateral distal tibial plate 543 3.5mm lps anterior lateral distal tibial plate 544 3.5mm lps anterior lateral distal tibial plate 545 3.5mm lps anterior lateral distal tibial plate 546 3.5mm lps anterior lateral distal tibial plate 547 3.5mm lps anterior lateral distal tibial plate 548 3.5mm lps anterior lateral distal tibial plate 549 3.5mm lps anterior lateral distal tibial plate 550 3.5mm lps anterior lateral distal tibial plate 551 3.5mm lps anterior lateral distal tibial plate 552 3.5mm lps anterior lateral distal tibial plate 553 3.5mm lps anterior lateral distal tibial plate 554 3.5mm lps anterior lateral distal tibial plate 555 3.5mm lps anterior lateral distal tibial plate 556 3.5mm lps anterior lateral distal tibial plate 557 3.5mm lps anterior lateral distal tibial plate 558 3.5mm lps anterior lateral distal tibial plate 559 3.5mm lps anterior lateral distal tibial plate 560 3.5mm lps calcaneal plate 561 3.5mm lps calcaneal plate 562 3.5mm lps calcaneal plate 563 3.5mm lps calcaneal plate 564 3.5mm lps calcaneal plate 565 3.5mm lps calcaneal plate 566 3.5mm lps periarticular proximal lateral tibia plate 567 3.5mm lps periarticular proximal lateral tibia plate 568 3.5mm lps periarticular proximal lateral tibia plate 569 3.5mm lps periarticular proximal lateral tibia plate 570 3.5mm lps periarticular proximal lateral tibia plate 571 3.5mm lps periarticular proximal lateral tibia plate 572 3.5mm lps periarticular proximal lateral tibia plate 573 3.5mm lps periarticular proximal lateral tibia plate 574 3.5mm lps periarticular proximal lateral tibia plate 575 3.5mm lps periarticular proximal lateral tibia plate 576 3.5mm lps periarticular proximal lateral tibia plate 577 3.5mm lps periarticular proximal lateral tibia plate 578 3.5mm lps periarticular proximal lateral humeral plate 579 3.5mm lps periarticular proximal lateral humeral plate 580 3.5mm lps periarticular proximal lateral humeral plate 581 3.5mm lps periarticular proximal lateral humeral plate 582 3.5mm lps periarticular proximal lateral humeral plate 583 3.5mm lps periarticular proximal lateral humeral plate 584 3.5mm lps periarticular proximal lateral humeral plate 585 3.5mm lps periarticular proximal lateral humeral plate 586 3.5mm lps periarticular proximal lateral humeral plate 587 3.5mm lps periarticular proximal lateral humeral plate 588 3.5mm lps proximal tibia plate, posteromedial 589 3.5mm lps proximal tibia plate, posteromedial 590 3.5mm lps proximal tibia plate, posteromedial 591 3.5mm lps proximal tibia plate, posteromedial 592 3.5mm lps proximal tibia plate, posteromedial 593 3.5mm lps proximal tibia plate, posteromedial 594 2.7mm / 3.5mm lps lateral distal fibula plate 595 2.7mm / 3.5mm lps lateral distal fibula plate 596 2.7mm / 3.5mm lps lateral distal fibula plate 597 2.7mm / 3.5mm lps lateral distal fibula plate 598 2.7mm / 3.5mm lps lateral distal fibula plate 599 2.7mm / 3.5mm lps lateral distal fibula plate 600 2.7mm / 3.5mm lps lateral distal fibula plate 601 2.7mm / 3.5mm lps lateral distal fibula plate 602 ø 3.5mm locking screw, self tapping 603 ø 3.5mm locking screw, self tapping 604 ø 3.5mm locking screw, self tapping 605 ø 3.5mm locking screw, self tapping 606 ø 3.5mm locking screw, self tapping 607 ø 3.5mm locking screw, self tapping 608 ø 3.5mm locking screw, self tapping 609 ø 3.5mm locking screw, self tapping 610 ø 3.5mm locking screw, self tapping 611 ø 3.5mm locking screw, self tapping 612 ø 3.5mm locking screw, self tapping 613 ø 3.5mm locking screw, self tapping 614 ø 3.5mm locking screw, self tapping 615 ø 3.5mm locking screw, self tapping 616 ø 3.5mm locking screw, self tapping 617 ø 3.5mm locking screw, self tapping 618 ø 3.5mm locking screw, self tapping 619 ø 3.5mm locking screw, self tapping 620 ø 3.5mm locking screw, self tapping 621 ø 3.5mm locking screw, self tapping 622 ø 3.5mm locking screw, self tapping 623 ø 3.5mm locking screw, self tapping 624 ø 3.5mm locking screw, self tapping 625 ø 3.5mm locking screw, self tapping 626 ø 3.5mm locking screw, self tapping 627 ø 3.5mm locking screw, self tapping 628 ø 3.5mm locking screw, self tapping 629 ø 3.5mm locking screw, self tapping 630 ø 3.5mm locking screw, self tapping 631 ø 3.5mm locking screw, self tapping 632 ø 3.5mm locking screw, self tapping 633 ø 3.5mm locking screw, self tapping 634 ø 3.5mm locking screw, self tapping 635 ø 3.5mm locking screw, self tapping 636 ø 3.5mm cortex screw, self tapping 637 ø 3.5mm cortex screw, self tapping 638 ø 3.5mm cortex screw, self tapping 639 ø 3.5mm cortex screw, self tapping 640 ø 3.5mm cortex screw, self tapping 641 ø 3.5mm cortex screw, self tapping 642 ø 3.5mm cortex screw, self tapping 643 ø 3.5mm cortex screw, self tapping 644 ø 3.5mm cortex screw, self tapping 645 ø 3.5mm cortex screw, self tapping 646 ø 3.5mm cortex screw, self tapping 647 ø 3.5mm cortex screw, self tapping 648 ø 3.5mm cortex screw, self tapping 649 ø 3.5mm cortex screw, self tapping 650 ø 3.5mm cortex screw, self tapping 651 ø 3.5mm cortex screw, self tapping 652 ø 3.5mm cortex screw, self tapping 653 ø 3.5mm cortex screw, self tapping 654 ø 3.5mm cortex screw, self tapping 655 ø 3.5mm cortex screw, self tapping 656 ø 3.5mm cortex screw, self tapping 657 ø 3.5mm cortex screw, self tapping 658 ø 3.5mm cortex screw, self tapping 659 ø 3.5mm cortex screw, self tapping 660 ø 3.5mm cortex screw, self tapping 661 ø 3.5mm cortex screw, self tapping 662 ø 3.5mm cortex screw, self tapping 663 ø 3.5mm cortex screw, self tapping 664 ø 3.5mm cortex screw, self tapping 665 ø 4.0mm cancellous screw, short thread 666 ø 4.0mm cancellous screw, short thread 667 ø 4.0mm cancellous screw, short thread 668 ø 4.0mm cancellous screw, short thread 669 ø 4.0mm cancellous screw, short thread 670 ø 4.0mm cancellous screw, short thread 671 ø 4.0mm cancellous screw, short thread 672 ø 4.0mm cancellous screw, short thread 673 ø 4.0mm cancellous screw, short thread 674 ø 4.0mm cancellous screw, short thread 675 ø 4.0mm cancellous screw, short thread 676 ø 4.0mm cancellous screw, short thread 677 ø 4.0mm cancellous screw, short thread 678 ø 4.0mm cancellous screw, short thread 679 ø 4.0mm cancellous screw, short thread 680 ø 4.0mm cancellous screw, short thread 681 ø 4.0mm cancellous screw, short thread 682 ø 4.0mm cancellous screw, short thread 683 ø 4.0mm cancellous screw, short thread 684 ø 4.0mm cancellous screw, short thread 685 ø 4.0mm cancellous screw, short thread 686 ø 4.0mm cancellous screw, full thread screw 687 ø 4.0mm cancellous screw, full thread screw 688 ø 4.0mm cancellous screw, full thread screw 689 ø 4.0mm cancellous screw, full thread screw 690 ø 4.0mm cancellous screw, full thread screw 691 ø 4.0mm cancellous screw, full thread screw 692 ø 4.0mm cancellous screw, full thread screw 693 ø 4.0mm cancellous screw, full thread screw 694 ø 4.0mm cancellous screw, full thread screw 695 ø 4.0mm cancellous screw, full thread screw 696 ø 4.0mm cancellous screw, full thread screw 697 ø 4.0mm cancellous screw, full thread screw 698 ø 4.0mm cancellous screw, full thread screw 699 ø 4.0mm cancellous screw, full thread screw 700 ø 4.0mm cancellous screw, full thread screw 701 ø 4.0mm cancellous screw, full thread screw 702 ø 4.0mm cancellous screw, full thread screw 703 ø 4.0mm cancellous screw, full thread screw 704 ø 4.0mm cancellous screw, full thread screw 705 ø 4.0mm cancellous screw, full thread screw 706 ø 4.0mm cancellous screw, full thread screw 707 ø 3.5mm locking cancellous screw, self tapping 708 ø 3.5mm locking cancellous screw, self tapping 709 ø 3.5mm locking cancellous screw, self tapping 710 ø 3.5mm locking cancellous screw, self tapping 711 ø 3.5mm locking cancellous screw, self tapping 712 ø 3.5mm locking cancellous screw, self tapping 713 ø 3.5mm locking cancellous screw, self tapping 714 ø 3.5mm locking cancellous screw, self tapping 715 ø 3.5mm locking cancellous screw, self tapping 716 ø 3.5mm locking cancellous screw, self tapping 717 ø 3.5mm locking cancellous screw, self tapping 718 ø 3.5mm locking cancellous screw, self tapping 719 ø 3.5mm locking cancellous screw, self tapping 720 2.7mm / 3.5mm superior anterior clavicle plate 721 2.7mm / 3.5mm superior anterior clavicle plate 722 2.7mm / 3.5mm superior anterior clavicle plate 723 2.7mm / 3.5mm superior anterior clavicle plate 724 2.7mm / 3.5mm superior anterior clavicle plate 725 2.7mm / 3.5mm superior anterior clavicle plate 726 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 727 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 728 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 729 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 730 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 731 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 732 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 733 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 734 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 735 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 736 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 737 2.7mm / 3.5mm superior anterior clavicle plate, with lateral extension 738 2.7mm / 3.5mm posterolateral distal humerus plate 739 2.7mm / 3.5mm posterolateral distal humerus plate 740 2.7mm / 3.5mm posterolateral distal humerus plate 741 2.7mm / 3.5mm posterolateral distal humerus plate 742 2.7mm / 3.5mm posterolateral distal humerus plate 743 2.7mm / 3.5mm posterolateral distal humerus plate 744 2.7mm / 3.5mm posterolateral distal humerus plate 745 2.7mm / 3.5mm posterolateral distal humerus plate 746 2.7mm / 3.5mm posterolateral distal humerus plate 747 2.7mm / 3.5mm posterolateral distal humerus plate 748 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 749 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 750 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 751 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 752 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 753 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 754 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 755 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 756 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 757 2.7mm / 3.5mm posterolateral distal humerus plate, with lateral support 758 2.7mm / 3.5mm medial distal humerus plate 759 2.7mm / 3.5mm medial distal humerus plate 760 2.7mm / 3.5mm medial distal humerus plate 761 2.7mm / 3.5mm medial distal humerus plate 762 2.7mm / 3.5mm medial distal humerus plate 763 2.7mm / 3.5mm medial distal humerus plate 764 2.7mm / 3.5mm medial distal humerus plate 765 2.7mm / 3.5mm medial distal humerus plate 766 2.7mm / 3.5mm lps medial distal humerus metaphyseal plate 767 2.7mm / 3.5mm lps medial distal humerus metaphyseal plate 768 2.7mm / 3.5mm lps medial distal humerus metaphyseal plate 769 2.7mm / 3.5mm lps medial distal humerus metaphyseal plate 770 2.7mm / 3.5mm lps medial distal humerus metaphyseal plate 771 3.5mm lps distal humerus extra articular plate 772 3.5mm lps distal humerus extra articular plate 773 3.5mm lps distal humerus extra articular plate 774 3.5mm lps distal humerus extra articular plate 775 3.5mm lps distal humerus extra articular plate 776 3.5mm lps distal humerus extra articular plate 777 3.5mm lps distal humerus extra articular plate 778 3.5mm lps distal humerus extra articular plate 779 3.5mm lps distal humerus extra articular plate 780 3.5mm lps distal humerus extra articular plate 781 3.5mm lps distal humerus extra articular plate 782 3.5mm lps distal humerus extra articular plate 783 3.5mm lps olecranon plate 784 3.5mm lps olecranon plate 785 3.5mm lps olecranon plate 786 3.5mm lps olecranon plate 787 3.5mm lps olecranon plate 788 3.5mm lps olecranon plate 789 3.5mm lps olecranon plate 790 3.5mm lps olecranon plate 791 3.5mm lps olecranon plate 792 3.5mm lps olecranon plate 793 3.5mm lps olecranon plate 794 3.5mm lps olecranon plate 795 3.5mm lps clavicle hook plate 796 3.5mm lps clavicle hook plate 797 3.5mm lps clavicle hook plate 798 3.5mm lps clavicle hook plate 799 3.5mm lps clavicle hook plate 800 3.5mm lps clavicle hook plate 801 3.5mm lps clavicle hook plate 802 3.5mm lps clavicle hook plate 803 3.5mm lps clavicle hook plate 804 3.5mm lps clavicle hook plate 805 3.5mm lps clavicle hook plate 806 3.5mm lps clavicle hook plate 807 3.5mm lps clavicle hook plate 808 3.5mm lps clavicle hook plate 809 3.5mm lps clavicle hook plate 810 3.5mm lps clavicle hook plate 811 3.5mm lps clavicle hook plate 812 3.5mm lps clavicle hook plate 813 3.5mm lps clavicle hook plate 814 3.5mm lps clavicle hook plate 815 3.5mm lps clavicle hook plate 816 3.5mm lps clavicle hook plate 817 3.5mm lps clavicle hook plate 818 3.5mm lps clavicle hook plate 819 ø 3.5mm locking screw, self tapping 820 ø 3.5mm locking screw, self tapping 821 ø 3.5mm locking screw, self tapping 822 ø 3.5mm locking screw, self tapping 823 ø 3.5mm locking screw, self tapping 824 ø 3.5mm locking screw, self tapping 825 ø 3.5mm locking screw, self tapping 826 ø 3.5mm locking screw, self tapping 827 ø 3.5mm locking screw, self tapping 828 ø 3.5mm locking screw, self tapping 829 ø 3.5mm locking screw, self tapping 830 ø 3.5mm locking screw, self tapping 831 ø 3.5mm locking screw, self tapping 832 ø 3.5mm locking screw, self tapping 833 ø 3.5mm locking screw, self tapping 834 ø 3.5mm locking screw, self tapping 835 ø 3.5mm locking screw, self tapping 836 ø 3.5mm locking screw, self tapping 837 ø 3.5mm locking screw, self tapping 838 ø 3.5mm locking screw, self tapping 839 ø 3.5mm locking screw, self tapping 840 ø 3.5mm locking screw, self tapping 841 ø 3.5mm locking screw, self tapping 842 ø 3.5mm locking screw, self tapping 843 ø 3.5mm locking screw, self tapping 844 ø 3.5mm locking screw, self tapping 845 ø 3.5mm locking screw, self tapping 846 ø 3.5mm locking screw, self tapping 847 ø 3.5mm locking screw, self tapping 848 ø 3.5mm locking screw, self tapping 849 ø 3.5mm locking screw, self tapping 850 ø 3.5mm locking screw, self tapping 851 ø 3.5mm locking screw, self tapping 852 ø 3.5mm cortex screw, self tapping 853 ø 3.5mm cortex screw, self tapping 854 ø 3.5mm cortex screw, self tapping 855 ø 3.5mm cortex screw, self tapping 856 ø 3.5mm cortex screw, self tapping 857 ø 3.5mm cortex screw, self tapping 858 ø 3.5mm cortex screw, self tapping 859 ø 3.5mm cortex screw, self tapping 860 ø 3.5mm cortex screw, self tapping 861 ø 3.5mm cortex screw, self tapping 862 ø 3.5mm cortex screw, self tapping 863 ø 3.5mm cortex screw, self tapping 864 ø 3.5mm cortex screw, self tapping 865 ø 3.5mm cortex screw, self tapping 866 ø 3.5mm cortex screw, self tapping 867 ø 3.5mm cortex screw, self tapping 868 ø 3.5mm cortex screw, self tapping 869 ø 3.5mm cortex screw, self tapping 870 ø 3.5mm cortex screw, self tapping 871 ø 3.5mm cortex screw, self tapping 872 ø 3.5mm cortex screw, self tapping 873 ø 3.5mm cortex screw, self tapping 874 ø 3.5mm cortex screw, self tapping 875 ø 3.5mm cortex screw, self tapping 876 ø 3.5mm cortex screw, self tapping 877 ø 3.5mm cortex screw, self tapping 878 ø 3.5mm cortex screw, self tapping 879 ø 3.5mm cortex screw, self tapping 880 ø 3.5mm cortex screw, self tapping 881 ø 4.0mm cancellous screw, full thread 882 ø 4.0mm cancellous screw, full thread 883 ø 4.0mm cancellous screw, full thread 884 ø 4.0mm cancellous screw, full thread 885 ø 4.0mm cancellous screw, full thread 886 ø 4.0mm cancellous screw, full thread 887 ø 4.0mm cancellous screw, full thread 888 ø 4.0mm cancellous screw, full thread 889 ø 4.0mm cancellous screw, full thread 890 ø 4.0mm cancellous screw, full thread 891 ø 4.0mm cancellous screw, full thread 892 ø 4.0mm cancellous screw, full thread 893 ø 4.0mm cancellous screw, full thread 894 ø 4.0mm cancellous screw, full thread 895 ø 4.0mm cancellous screw, full thread 896 ø 4.0mm cancellous screw, full thread 897 ø 4.0mm cancellous screw, full thread 898 ø 4.0mm cancellous screw, full thread 899 ø 4.0mm cancellous screw, full thread 900 ø 4.0mm cancellous screw, full thread 901 ø 4.0mm cancellous screw, full thread 902 ø 4.0mm cancellous screw, short thread 903 ø 4.0mm cancellous screw, short thread 904 ø 4.0mm cancellous screw, short thread 905 ø 4.0mm cancellous screw, short thread 906 ø 4.0mm cancellous screw, short thread 907 ø 4.0mm cancellous screw, short thread 908 ø 4.0mm cancellous screw, short thread 909 ø 4.0mm cancellous screw, short thread 910 ø 4.0mm cancellous screw, short thread 911 ø 4.0mm cancellous screw, short thread 912 ø 4.0mm cancellous screw, short thread 913 ø 4.0mm cancellous screw, short thread 914 ø 4.0mm cancellous screw, short thread 915 ø 4.0mm cancellous screw, short thread 916 ø 4.0mm cancellous screw, short thread 917 ø 4.0mm cancellous screw, short thread 918 ø 4.0mm cancellous screw, short thread 919 ø 4.0mm cancellous screw, short thread 920 ø 4.0mm cancellous screw, short thread 921 ø 4.0mm cancellous screw, short thread 922 ø 4.0mm cancellous screw, short thread 923 ø 2.7mm locking screw, t8 self tapping 924 ø 2.7mm locking screw, t8 self tapping 925 ø 2.7mm locking screw, t8 self tapping 926 ø 2.7mm locking screw, t8 self tapping 927 ø 2.7mm locking screw, t8 self tapping 928 ø 2.7mm locking screw, t8 self tapping 929 ø 2.7mm locking screw, t8 self tapping 930 ø 2.7mm locking screw, t8 self tapping 931 ø 2.7mm locking screw, t8 self tapping 932 ø 2.7mm locking screw, t8 self tapping 933 ø 2.7mm locking screw, t8 self tapping 934 ø 2.7mm locking screw, t8 self tapping 935 ø 2.7mm locking screw, t8 self tapping 936 ø 2.7mm locking screw, t8 self tapping 937 ø 2.7mm locking screw, t8 self tapping 938 ø 2.7mm locking screw, t8 self tapping 939 ø 2.7mm locking screw, t8 self tapping 940 ø 2.7mm locking screw, t8 self tapping 941 ø 2.7mm locking screw, t8 self tapping 942 ø 2.7mm locking screw, t8 self tapping 943 ø 2.7mm locking screw, t8 self tapping 944 ø 2.7mm locking screw, t8 self tapping 945 4.5mm lps compression plate narrow 946 4.5mm lps compression plate narrow 947 4.5mm lps compression plate narrow 948 4.5mm lps compression plate narrow 949 4.5mm lps compression plate narrow 950 4.5mm lps compression plate narrow 951 4.5mm lps compression plate narrow 952 4.5mm lps compression plate narrow 953 4.5mm lps compression plate narrow 954 4.5mm lps compression plate narrow 955 4.5mm lps compression plate narrow 956 4.5mm lps compression plate narrow 957 4.5mm lps compression plate narrow 958 4.5mm lps compression plate broad 959 4.5mm lps compression plate broad 960 4.5mm lps compression plate broad 961 4.5mm lps compression plate broad 962 4.5mm lps compression plate broad 963 4.5mm lps compression plate broad 964 4.5mm lps compression plate broad 965 4.5mm lps compression plate broad 966 4.5mm lps compression plate broad 967 4.5mm lps compression plate broad 968 4.5mm lps compression plate broad 969 4.5mm lps compression plate broad 970 4.5mm lps compression plate broad 971 4.5mm lps distal femur plate 972 4.5mm lps distal femur plate 973 4.5mm lps distal femur plate 974 4.5mm lps distal femur plate 975 4.5mm lps distal femur plate 976 4.5mm lps distal femur plate 977 4.5mm lps distal femur plate 978 4.5mm lps distal femur plate 979 4.5mm lps distal femur plate 980 4.5mm lps distal femur plate 981 4.5mm lps proximal lateral tibia plate 982 4.5mm lps proximal lateral tibia plate 983 4.5mm lps proximal lateral tibia plate 984 4.5mm lps proximal lateral tibia plate 985 4.5mm lps proximal lateral tibia plate 986 4.5mm lps proximal lateral tibia plate 987 4.5mm lps proximal lateral tibia plate 988 4.5mm lps proximal lateral tibia plate 989 4.5mm lps proximal lateral tibia plate 990 4.5mm lps proximal lateral tibia plate 991 4.5mm lps t plate 992 4.5mm lps t plate 993 4.5mm lps t plate 994 4.5mm lps t plate 995 4.5mm lps t plate 996 4.5mm lps t plate 997 4.5mm lps t plate 998 4.5mm lps t plate 999 4.5mm lps t buttress plate 1000 4.5mm lps t buttress plate 1001 4.5mm lps t buttress plate 1002 4.5mm lps l buttress plate 1003 4.5mm lps l buttress plate 1004 4.5mm lps l buttress plate 1005 4.5mm lps l buttress plate 1006 4.5mm lps l buttress plate 1007 4.5mm lps l buttress plate 1008 4.5mm lps l buttress plate 1009 4.5mm lps l buttress plate 1010 4.5mm lps large metaphyseal plate 1011 4.5mm lps large metaphyseal plate 1012 4.5mm lps large metaphyseal plate 1013 4.5mm lps large metaphyseal plate 1014 4.5mm lps large metaphyseal plate 1015 4.5mm lps large metaphyseal plate 1016 4.5mm lps large metaphyseal plate 1017 4.5mm lps large metaphyseal plate 1018 4.5mm lps large metaphyseal plate 1019 4.5mm lps large metaphyseal plate 1020 ø 5.0mm locking screw, self tapping 1021 ø 5.0mm locking screw, self tapping 1022 ø 5.0mm locking screw, self tapping 1023 ø 5.0mm locking screw, self tapping 1024 ø 5.0mm locking screw, self tapping 1025 ø 5.0mm locking screw, self tapping 1026 ø 5.0mm locking screw, self tapping 1027 ø 5.0mm locking screw, self tapping 1028 ø 5.0mm locking screw, self tapping 1029 ø 5.0mm locking screw, self tapping 1030 ø 5.0mm locking screw, self tapping 1031 ø 5.0mm locking screw, self tapping 1032 ø 5.0mm locking screw, self tapping 1033 ø 5.0mm locking screw, self tapping 1034 ø 5.0mm locking screw, self tapping 1035 ø 5.0mm locking screw, self tapping 1036 ø 5.0mm locking screw, self tapping 1037 ø 5.0mm locking screw, self tapping 1038 ø 5.0mm locking screw, self tapping 1039 ø 5.0mm locking screw, self tapping 1040 ø 5.0mm locking screw, self tapping 1041 ø 5.0mm locking screw, self tapping 1042 ø 5.0mm locking screw, self tapping 1043 ø 5.0mm locking screw, self tapping 1044 ø 5.0mm locking screw, self tapping 1045 ø 5.0mm locking screw, self tapping 1046 ø 5.0mm locking screw, self tapping 1047 ø 4.5mm cortex screw, self tapping 1048 ø 4.5mm cortex screw, self tapping 1049 ø 4.5mm cortex screw, self tapping 1050 ø 4.5mm cortex screw, self tapping 1051 ø 4.5mm cortex screw, self tapping 1052 ø 4.5mm cortex screw, self tapping 1053 ø 4.5mm cortex screw, self tapping 1054 ø 4.5mm cortex screw, self tapping 1055 ø 4.5mm cortex screw, self tapping 1056 ø 4.5mm cortex screw, self tapping 1057 ø 4.5mm cortex screw, self tapping 1058 ø 4.5mm cortex screw, self tapping 1059 ø 4.5mm cortex screw, self tapping 1060 ø 4.5mm cortex screw, self tapping 1061 ø 4.5mm cortex screw, self tapping 1062 ø 4.5mm cortex screw, self tapping 1063 ø 4.5mm cortex screw, self tapping 1064 ø 4.5mm cortex screw, self tapping 1065 ø 4.5mm cortex screw, self tapping 1066 ø 4.5mm cortex screw, self tapping 1067 ø 4.5mm cortex screw, self tapping 1068 ø 4.5mm cortex screw, self tapping 1069 ø 4.5mm cortex screw, self tapping 1070 ø 4.5mm cortex screw, self tapping 1071 ø 4.5mm cortex screw, self tapping 1072 ø 4.5mm cortex screw, self tapping 1073 ø 4.5mm cortex screw, self tapping 1074 ø 4.5mm cortex screw, self tapping 1075 ø 4.5mm cortex screw, self tapping 1076 ø 4.5mm cortex screw, self tapping 1077 ø 4.5mm cortex screw, self tapping 1078 ø 4.5mm cortex screw, self tapping 1079 ø 4.5mm cortex screw, self tapping 1080 ø 4.5mm cortex screw, self tapping 1081 ø 4.5mm cortex screw, self tapping 1082 ø 4.5mm cortex screw, self tapping 1083 ø 4.5mm cortex screw, self tapping 1084 ø 4.5mm cortex screw, self tapping 1085 ø 6.5mm cancellous screw, full thread length 1086 ø 6.5mm cancellous screw, full thread length 1087 ø 6.5mm cancellous screw, full thread length 1088 ø 6.5mm cancellous screw, full thread length 1089 ø 6.5mm cancellous screw, full thread length 1090 ø 6.5mm cancellous screw, full thread length 1091 ø 6.5mm cancellous screw, full thread length 1092 ø 6.5mm cancellous screw, full thread length 1093 ø 6.5mm cancellous screw, full thread length 1094 ø 6.5mm cancellous screw, full thread length 1095 ø 6.5mm cancellous screw, full thread length 1096 ø 6.5mm cancellous screw, full thread length 1097 ø 6.5mm cancellous screw, full thread length 1098 ø 6.5mm cancellous screw, full thread length 1099 ø 6.5mm cancellous screw, full thread length 1100 ø 6.5mm cancellous screw, full thread length 1101 ø 6.5mm cancellous screw, full thread length 1102 ø 6.5mm cancellous screw, full thread length 1103 ø 6.5mm cancellous screw, full thread length 1104 ø 6.5mm cancellous screw, 16mm thread length 1105 ø 6.5mm cancellous screw, 16mm thread length 1106 ø 6.5mm cancellous screw, 16mm thread length 1107 ø 6.5mm cancellous screw, 16mm thread length 1108 ø 6.5mm cancellous screw, 16mm thread length 1109 ø 6.5mm cancellous screw, 16mm thread length 1110 ø 6.5mm cancellous screw, 16mm thread length 1111 ø 6.5mm cancellous screw, 16mm thread length 1112 ø 6.5mm cancellous screw, 16mm thread length 1113 ø 6.5mm cancellous screw, 16mm thread length 1114 ø 6.5mm cancellous screw, 16mm thread length 1115 ø 6.5mm cancellous screw, 16mm thread length 1116 ø 6.5mm cancellous screw, 16mm thread length 1117 ø 6.5mm cancellous screw, 16mm thread length 1118 ø 6.5mm cancellous screw, 16mm thread length 1119 ø 6.5mm cancellous screw, 16mm thread length 1120 ø 6.5mm cancellous screw, 16mm thread length 1121 ø 6.5mm cancellous screw, 16mm thread length 1122 ø 6.5mm cancellous screw, 16mm thread length 1123 ø 6.5mm cancellous screw, 32mm thread length 1124 ø 6.5mm cancellous screw, 32mm thread length 1125 ø 6.5mm cancellous screw, 32mm thread length 1126 ø 6.5mm cancellous screw, 32mm thread length 1127 ø 6.5mm cancellous screw, 32mm thread length 1128 ø 6.5mm cancellous screw, 32mm thread length 1129 ø 6.5mm cancellous screw, 32mm thread length 1130 ø 6.5mm cancellous screw, 32mm thread length 1131 ø 6.5mm cancellous screw, 32mm thread length 1132 ø 6.5mm cancellous screw, 32mm thread length 1133 ø 6.5mm cancellous screw, 32mm thread length 1134 ø 6.5mm cancellous screw, 32mm thread length 1135 ø 6.5mm cancellous screw, 32mm thread length 1136 ø 6.5mm cancellous screw, 32mm thread length 1137 ø 6.5mm cancellous screw, 32mm thread length 1138 ø 6.5mm cancellous screw, 32mm thread length 1139 ø 6.5mm cancellous screw, 32mm thread length 1140 ø 6.5mm cancellous screw, 32mm thread length 1141 ø 6.5mm cancellous screw, 32mm thread length 1142 ø 6.5mm cancellous screw, 32mm thread length 1143 ø 6.5mm cancellous screw, 32mm thread length 1144 ø 6.5mm cancellous screw, 32mm thread length 1145 ø 5.0mm locking cancellous screw, self tapping 1146 ø 5.0mm locking cancellous screw, self tapping 1147 ø 5.0mm locking cancellous screw, self tapping 1148 ø 5.0mm locking cancellous screw, self tapping 1149 ø 5.0mm locking cancellous screw, self tapping 1150 ø 5.0mm locking cancellous screw, self tapping 1151 ø 5.0mm locking cancellous screw, self tapping 1152 ø 5.0mm locking cancellous screw, self tapping 1153 ø 5.0mm locking cancellous screw, self tapping 1154 ø 4.5mm cannulated screw, self drilling, short thread 1155 ø 4.5mm cannulated screw, self drilling, short thread 1156 ø 4.5mm cannulated screw, self drilling, short thread 1157 ø 4.5mm cannulated screw, self drilling, short thread 1158 ø 4.5mm cannulated screw, self drilling, short thread 1159 ø 4.5mm cannulated screw, self drilling, short thread 1160 ø 4.5mm cannulated screw, self drilling, short thread 1161 ø 4.5mm cannulated screw, self drilling, short thread 1162 ø 4.5mm cannulated screw, self drilling, short thread 1163 ø 4.5mm cannulated screw, self drilling, short thread 1164 ø 4.5mm cannulated screw, self drilling, short thread 1165 ø 4.5mm cannulated screw, self drilling, short thread 1166 ø 4.5mm cannulated screw, self drilling, short thread 1167 ø 4.5mm cannulated screw, self drilling, short thread 1168 ø 4.5mm cannulated screw, self drilling, short thread 1169 ø 4.5mm cannulated screw, self drilling, short thread 1170 ø 4.5mm cannulated screw, self drilling, short thread 1171 ø 4.5mm cannulated screw, self drilling, short thread 1172 ø 4.5mm cannulated screw, self drilling, short thread 1173 ø 4.5mm cannulated screw, self drilling, short thread 1174 ø 4.5mm cannulated screw, self drilling, short thread 1175 ø 4.5mm cannulated screw, self drilling, short thread 1176 ø 4.5mm cannulated screw, self drilling, short thread 1177 ø 4.5mm cannulated screw, self drilling, short thread 1178 ø 4.5mm cannulated screw, self drilling, short thread 1179 ø 10.0mm washer 1180 6.5mm cannulated screw, self drilling, 16mm thread length 1181 6.5mm cannulated screw, self drilling, 16mm thread length 1182 6.5mm cannulated screw, self drilling, 16mm thread length 1183 6.5mm cannulated screw, self drilling, 16mm thread length 1184 6.5mm cannulated screw, self drilling, 16mm thread length 1185 6.5mm cannulated screw, self drilling, 16mm thread length 1186 6.5mm cannulated screw, self drilling, 16mm thread length 1187 6.5mm cannulated screw, self drilling, 16mm thread length 1188 6.5mm cannulated screw, self drilling, 16mm thread length 1189 6.5mm cannulated screw, self drilling, 16mm thread length 1190 6.5mm cannulated screw, self drilling, 16mm thread length 1191 6.5mm cannulated screw, self drilling, 16mm thread length 1192 6.5mm cannulated screw, self drilling, 16mm thread length 1193 6.5mm cannulated screw, self drilling, 16mm thread length 1194 6.5mm cannulated screw, self drilling, 16mm thread length 1195 6.5mm cannulated screw, self drilling, 16mm thread length 1196 6.5mm cannulated screw, self drilling, 16mm thread length 1197 6.5mm cannulated screw, self drilling, 16mm thread length 1198 6.5mm cannulated screw, self drilling, 16mm thread length 1199 6.5mm cannulated screw, self drilling, 16mm thread length 1200 6.5mm cannulated screw, self drilling, 16mm thread length 1201 6.5mm cannulated screw, self drilling, 16mm thread length 1202 6.5mm cannulated screw, self drilling, 16mm thread length 1203 6.5mm cannulated screw, self drilling, 16mm thread length 1204 6.5mm cannulated screw, self drilling, 16mm thread length 1205 6.5mm cannulated screw, self drilling, 16mm thread length 1206 6.5mm cannulated screw, self drilling, 16mm thread length 1207 6.5mm cannulated screw, self drilling, 16mm thread length 1208 6.5mm cannulated screw, self drilling, 16mm thread length 1209 6.5mm cannulated screw, self drilling, 16mm thread length 1210 6.5mm cannulated screw, self drilling, 16mm thread length 1211 ø 13.0mm washer 1212 chemiluminiscence instrument ( specifiction attached ) 1213 heamatology analyzer ( specifiction attached ) 1214 gel centrifuge ( specifiction attached ) 1215 gel card reader ( specifiction attached ) 1216 variable pipette ( ce certified ) ...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

22099013 rate contract of eye equipment for eye vision centre , equipments list ( name of equipment for vision centre ) , tonometer ( schiotz model ) , direct ophthalmoscope , illuminated vision drum , trial lens set with trial frame , near vision chart , battery operated torch ( 2 in number ) 500x2 , slit lamp , equipment for district hospital , operating microscope ( basic ) , a scan bio meter , keratometer , slit lamp . refraction units , auto refractometer , flash autoclave , streak retinoscope , tonometer ( schiotz ) , direct ophthalmoscope , nd yag laser , applanation tonometer , phacoemulsifier , microsurgical instruments 400 pc each , indirect ophthalmoscope with 20 lens...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

21882808 rate contract of eye equipment for eye vision centre , equipments list ( name of equipment for vision centre ) , tonometer ( schiotz model ) , direct ophthalmoscope , illuminated vision drum , trial lens set with trial frame , near vision chart , battery operated torch ( 2 in number ) 500x2 , slit lamp , equipment for district hospital , operating microscope ( basic ) , a scan bio meter , keratometer , slit lamp . refraction units , auto refractometer , flash autoclave , streak retinoscope , tonometer ( schiotz ) , direct ophthalmoscope , nd yag laser , applanation tonometer , phacoemulsifier , microsurgical instruments 400 pc each , indirect ophthalmoscope with 20 lens...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

19737274 supply and installation of eye equipment phacoemuisdication machine 2 ________ op erann_microscope ____... svnaptophore 4 ______ steak retnoscope_ ( heins ) ? _______ direct ophthalmoscope_ ( hem b 2oo ) 6 _______ indirect ophthalmoscope ( cordiess ______ applanation tonometer 8 _____ lens 9od & as ] ) ( volks ) pulse oxirneter 10 schiotz tonometer ( czennanv 11 ishchhara chart ( oñ2ini 12 vet c aut er loti nibblinc pon2uer stze o to smm ‘.w 14 b ever ronzuer sinele actionmosquito forceps curved 16 mosquito_forceps _straight 17 bairaquar needle holder micro jaw vith lock 18 lacñmal sac retractor 19 sutunng forceps lx2 teeth 20 kalt needle holder straight 21 ins forcep 22 sterizanon bo d02xl2oxlsmn ) 2j. eye scissnr curve 4 5” lenath 24 eye.scissor carve 4 12_tength 25 . ‘enous scissor 26 hydro dissection 27g needle27 iol ssngle peice ( different dtoptre 28 cresent knife keratome 2.8 30 _......._ 15 no.lencet tip_ ( for_side.port ) 31 bipnlar cauterv probe 32 _....... optical biometry a scan ( jol master 5o0 ) 33 auto refractometer 34 keratometer _.____..._ a scan 36 lens ometer ( digine ) flash autoclave 38 _....... comeal topography with wavefront mnalyser39 ______ n.cj. with pachymeter 40 ______ rr. cautesy with cutting for oculoplasty ____... b scan 42 ______ snellens dnum with illumination and renote ______ tnal box ( =1od sph & ±3 cyi ) 44 _______ adjustable trial frane...

Department Of Health - Jharkhand

19567040 rate contract for medicine and consumable item at sahebganj c.s office 416 dental intraoral e speed film 417 dental x ray film holder 418 dental x ray film developer 419 dental x ray film fixer 420 light cure 421 k file set 06 / 08 / 10 / 15 / 20 / 25 / 30 / 35 / 40 / 45 / 50 / 55 / 60 / 65 / 70 / 75 / 80 number 422 sprader 423 dental round bur 424 dental stright bur 425 dental taper fissure bur 426 dental taper bur 427 fissure bur 428 pear bur dimoned 429 pear bur ( 330 ) 430 taper flat & bur 431 flade fissure bur 432 suture needle size 6 / 7 / 8 433 suture scissor 434 x ray developing box 435 tray 436 dental stone 437 aerotar 438 micromotor complete set 439 imprassion tray dentulous perforated kit set of 8 440 operating microscope 441 a scan 442 b scan 443 streak ratinoscope 444 o.t. table 445 operating chair 446 medicine trolly 447 sterlization set 448 surgical minor instrument 449 trial box+trial frame 450 rotating drum wall + near vision 451 retinoscope 452 opthalmoscope ( direct ) 453 kerotometer ( manual ) 454 torch o ( 3 cell ) 455 corneal loupe 456 slit lamp + autorofretometer + opthalmic chair 457 goniscopy 458 applanation tonometer 459 friedman visual field anaylosr 460 fundus photography machine 461 color vision chart 462 lencometer 463 retinal camera 464 tonometer 465 foreign body remover machine 466 ac 467 trial lens set illuminated with 232 lens and trial frame 468 distant vision illuminated drum with snellens chart 469 jaeger eye chart 470 direct ophthalmoscope 471 indirect ophthalmoscope 472 retinoscope 473 20 d lens 474 90 d lens 475 78 d lens 476 4 mirror gonio lens 477 slit lamp ( aia 11 5s / 5l ) with applanation tonometer and motorised stand 478 autorefractokeratometer and motorised stand 479 non contact tonometer => open tender...

JHARKHAND MEDICAL AND HEALTH INFRASTRUCTURE DEVELOPMENT AND PROCUREMENT CORPORATION LIMITED - Jharkhand

19324996 supply and installation of eye equipment phacoemuisdication machine 2 ________ op erann_microscope ____... svnaptophore 4 ______ steak retnoscope_ ( heins ) ? _______ direct ophthalmoscope_ ( hem b 2oo ) 6 _______ indirect ophthalmoscope ( cordiess ______ applanation tonometer 8 _____ lens 9od & as ] ) ( volks ) pulse oxirneter 10 schiotz tonometer ( czennanv 11 ishchhara chart ( oñ2ini 12 vet c aut er loti nibblinc pon2uer stze o to smm ‘.w 14 b ever ronzuer sinele actionmosquito forceps curved 16 mosquito_forceps _straight 17 bairaquar needle holder micro jaw vith lock 18 lacñmal sac retractor 19 sutunng forceps lx2 teeth 20 kalt needle holder straight 21 ins forcep 22 sterizanon bo d02xl2oxlsmn ) 2j. eye scissnr curve 4 5” lenath 24 eye.scissor carve 4 12_tength 25 . ‘enous scissor 26 hydro dissection 27g needle27 iol ssngle peice ( different dtoptre 28 cresent knife keratome 2.8 30 _......._ 15 no.lencet tip_ ( for_side.port ) 31 bipnlar cauterv probe 32 _....... optical biometry a scan ( jol master 5o0 ) 33 auto refractometer 34 keratometer _.____..._ a scan 36 lens ometer ( digine ) flash autoclave 38 _....... comeal topography with wavefront mnalyser39 ______ n.cj. with pachymeter 40 ______ rr. cautesy with cutting for oculoplasty ____... b scan 42 ______ snellens dnum with illumination and renote ______ tnal box ( =1od sph & ±3 cyi ) 44 _______ adjustable trial frane...

Department Of Health - Jharkhand

18568332 rate contract for machine & equipments 183 amalgam carrier in sliver 184 murcury ball burnisher 185 carver (dimond) 186 compactor 187 element carrier 188 gic (glass ionomer cement) 189 zinc phosphate cement 190 temporary filling material 191 electric ventouse 192 crash card (ss) 193 trial box , trial frame, lens, metal rim (205x6 cye) (complete set (for ophthalmic) 194 baby weighing machine digital 195 high vaccum suction machine 196 radient baby warmer 197 right angel artry 4 198 right angel artry 6 199 trial frame adult (for ophthalmic) 200 trial frame children (for ophthalmic) 201 self illuminated retinoscope (for ophthalmic) 202 ophthalmoscope (for ophthalmic) 203 automated autoref stand (for ophthalmic) 204 conjunctival scisser (for ophthalmic) 205 corneal scisser (for ophthalmic) 206 dilar (for ophthalmic) 207 simko 21 no guage (for ophthalmic) 208 f.b. spnd (for ophthalmic) 209 2 mirror cronioscope (for ophthalmic) 210 90 d lens (for ophthalmic) 211 fluorrescein strip (for ophthalmic) 212 disposable needle 26 g (for ophthalmic) 213 iucd kit 214 minilap kit 215 ppiucd forcep 216 uterus collection (sister u and mama u) 217 water cooler with purifire (120 ltr. storage capacity, 80 ltr. cooling capacity, stainless steel, two tap 218 water cooler with purifire (80 ltr. storage capacity, 60 ltr. cooling capacity, stainless steel, two tap 219 water cooler with purifire (40 ltr. storage capacity, 20 ltr. cooling capacity, stainless steel, two tap 220 digital hemoglobinometer 221 hemoglobinometer (1. sample volume <10 ul 2. total hb concentration measurement range 0.25 g/dl 3. toime for total concentration measurement <5 seconds 4. should have error rate less than 5% 5. cd/us fda/ iso approved 6. automatic correction of hb. 7. 20 222 digital x rey film (konika) 8x10 223 digital x rey film (konika) 10x12 224 digital x rey film (konika) 12x12 225 digital x rey film (konika) 12x15 ...

Department Of Health - Jharkhand

17732471 rate contract of eye equipment for eye vision centre 1 tonometer 2 direct ophthalmoscope 3 illuminated vision testing drum 4 trial lens sets with trial frames ( adult & child ) r 5 snellen’s& near vision charts 6 battery operated torch 3 cells 7 slit lamp with motorized table...

Government Of Jharkhand - Jharkhand

17712274 rate contract of eye equipment for medical colleges 1 operating microscope 2 phacoemulsification machine 3 slit lamp 4 keratometer 5 a scan ultrasonography 6 direct ophthalmoscope 7 indirect ophthalmoscope 8 streak retinoscopy 9 tonometer ( schiotz ) 10 ab scan 11 auto refractometer 12 nd yag laser 13 field analyser 14 pulse oximeter 15 perimeter 16 b scan 17 digital slit lamp 18 green laser 19 fundus camera 20 operating table 21 oct ( optical coherence tomography ) 22 slit lamp with fundus camera 23 auto start silent generator 10 kva 24 specular microscope with pachymeter 25 lensometer 26 flash auto clave machine ( s class 22 lt. ) 27 bipolar coagulater ( wet field coutry ) 28 uv lamp for ot 29 cataract set...

Department Of Health - Jharkhand

17477635 rate contract of eye equipment for eye vision centre 1 tonometer 2 direct ophthalmoscope 3 illuminated vision testing drum 4 trial lens sets with trial frames ( adult & child ) r 5 snellen’s& near vision charts 6 battery operated torch 3 cells 7 slit lamp with motorized table...

Government Of Jharkhand - Jharkhand

17460192 rate contract of eye equipment for medical colleges 1 operating microscope 2 phacoemulsification machine 3 slit lamp 4 keratometer 5 a scan ultrasonography 6 direct ophthalmoscope 7 indirect ophthalmoscope 8 streak retinoscopy 9 tonometer ( schiotz ) 10 ab scan 11 auto refractometer 12 nd yag laser 13 field analyser 14 pulse oximeter 15 perimeter 16 b scan 17 digital slit lamp 18 green laser 19 fundus camera 20 operating table 21 oct ( optical coherence tomography ) 22 slit lamp with fundus camera 23 auto start silent generator 10 kva 24 specular microscope with pachymeter 25 lensometer 26 flash auto clave machine ( s class 22 lt. ) 27 bipolar coagulater ( wet field coutry ) 28 uv lamp for ot 29 cataract set...

Rajendra Institute Of Medical Science - Jharkhand

17276687 supply and installation of equipments for geriatric centre rims, ranchi vide 1 glucormeters 2. nebulizers 3. suction apparatus 4. infusion pumps 5. ecg machine 6. defibrilator 7. card iac monitor 8. multi channel monitor 9. ventilator 10. laryngoscope 11. ophthalmoscope 12. auroscope ( otoscope ) 13. stethoscope 14. sphygrnomoanorneters 15. x ray viewing box 16. portable x ray 17. portable usg 18. high end usg 19. trans electric nerve stimulator 20. short wave diathermy 21. wax bath 22. parallel bars 23. walking sticks 24. walkers 25. calipers 26. stationary cycle ( static ) 27. exercise bicycle 28. pulley 29. gait training operators 30. lumber traction 31. cervical traction 32. shoulder wheel 33. infra red lamp...

Rajendra Institute Of Medical Science - Jharkhand

17071830 supply and installation of equipments for geriatric centre rims, ranchi vide 1 glucormeters 2. nebulizers 3. suction apparatus 4. infusion pumps 5. ecg machine 6. defibrilator 7. card iac monitor 8. multi channel monitor 9. ventilator 10. laryngoscope 11. ophthalmoscope 12. auroscope ( otoscope ) 13. stethoscope 14. sphygrnomoanorneters 15. x ray viewing box 16. portable x ray 17. portable usg 18. high end usg 19. trans electric nerve stimulator 20. short wave diathermy 21. wax bath 22. parallel bars 23. walking sticks 24. walkers 25. calipers 26. stationary cycle ( static ) 27. exercise bicycle 28. pulley 29. gait training operators 30. lumber traction 31. cervical traction 32. shoulder wheel 33. infra red lamp...

Health Department - Jharkhand

13964665 rate contract of eye equipments for pilot vision centre 1 tonometer ( imported ) 2 direct ophthalmoscope ( imported ) heine, neitz, keeler, ) 3 illuminated vision testing drum 4 trial lens sets with trial frames ( adult & child ) 5 snellens & near vision charts 6 slit lamp ( imported ) with motorized table 7 streak retinoscope ( imported ) heine, neitz, keeler, ) 8 90 d lens volk ( imported ) 9 digital vision chart 10 digital camera & adopter 11 ups ( uninterrupted power supply ) 12 it system at vision centre 13 computer system at vision centre 14 broadband connectivity at vision centre 15 printer 16 vision centre management system 17 vision centre management system ( vcms ) 18 video conferencing...

Health Department - Jharkhand

7824996 rate contract of eye equipments tonometer (imported) (reister), direct ophthalmoscope (imported) heins, neitz, keeler), illuminated vision testing drum, trial lens sets with trial frames (adult & child), snellens & near vision charts, battery operated torch 3 cells, slit lamp,...