Animal Husbandry And Veterinary Department - Jharkhand

41008403 tender for supply of veterinary medicines and others 2 ciprofloxacin 3 ciprofloxacin 4 ciprofloxacintinidazole ( 1.5gm + 1.8 gm ) 5 ciprofloxacintinidazole ( 250mg + 300mg ) 6 enrofloxacin 10% ( 100mg / ml ) 7 enrofloxacin 10% ( 100mg / ml ) 8 enrofloxacin 20% ( la ) 9 enrofloxacin ( 150 mg ) 10 enrofloxacin 10% 11 gentamicin ( 40mg / ml ) 12 gentamicin ( 40mg / ml ) 13 ceftriaxone 14 ceftriaxone 15 ceftriaxone 16 ceftriaxone 17 ceftriaxone + tazobactum ( 500mg+62.5mg ) 18 ceftriaxone + tazobactum ( 3gm+375mg ) 19 ceftriaxone + tazobactum ( 4gm+500mg ) 20 amikacin 250mg / ml 21 amikacin 250mg / ml 22 oxytetracycline inj ( 50 mg / ml ) 23 oxytetracycline inj ( 50 mg / ml ) 24 oxytetracycline inj 200 mg / ml ( la ) 25 oxytetracycline inj 200 mg / ml ( la ) 26 tetracycline hydrochloride bolus ( 500mg / 1gm ) 27 tetracycline hydrochloride powder ( 50mg tetracycline / gm ) 28 amoxycillin + cloxacillin ( 1.5gm + 1.5gm ) 29 amoxycillin + cloxacillin ( 250 mg + 250 mg ) 30 chlorpheniramine maleate ( 10mg / ml ) 31 chlorpheniramine maleate ( 10mg / ml ) 32 meloxicam ( 5mg / ml ) 33 meloxicam ( 5mg / ml ) 34 meloxicam paracetamol ( 10mg + 150mg ) 35 meloxicam paracetamol ( 10mg + 150mg ) 36 meloxicam paracetamol ( 100mg + 1500mg ) 37 tolfenamic acid ( 40mg / ml ) 38 dexamethasone inj ( 4mg / ml ) 39 isofluperidone inj ( 2mg / ml ) 40 dicyclomin hcl 2% 41 flunixin meglumine ( equiv. to 50mg / ml ) 42 tranexamic acid ( each ml containstranexamic acid 100mg ) 43 antiseptic cream 44 antiseptic lotion 45 antiseptic lotion 46 antiseptic lotion 47 ivermectin ( ivermectin 1% w / v ) 48 ivermectin ( ivermectin 1% w / v ) 49 iron preperations contains ferrous fumarate 1500mg, vitamin b12 75mcg, folic acid 7500mcg 50 atropine sulphate 1% 51 atropine sulphate 1% 52 albendazole tab ( each tab contains 150 mg ) 53 albendazole bolus ( each bolus contains 1.5 gm ) 54 albendazole bolus ( each tab contains 3 gm ) 55 albendazole liquid 2.5% w / v 56 albendazole liquid 2.5% w / v 57 fenbendazole tab ( each tab contains 150 mg ) 58 fenbendazole bolus ( each bolus contains 1.5 gm ) 59 fenbendazole bolus ( each tab contains 3 gm ) 60 ivermectin ( la ) ( 5mg / ml ) 61 ivermectin ( la ) ( 5mg / ml ) 62 oxyclozanide liquid + levamisole 6% / ml 63 iron preparations each ml contains iron sorbitol citric acid ( iron contains 50mg, folic acid 500mcg, hydroxy cobalamine 500mcg ) 64 butophosphane with b12 ( butophosphane 100mg / ml, vitamin b12 500mg / ml ) 65 butophosphane with b12 ( butophosphane 100mg / ml, vitamin b12 500mg / ml ) 66 diminazine diaceturate rtu ( 70mg / ml ) with phenothiazone ( 375mg / ml ) per vial 67 buparvaqunone ( 50mg / ml ) 68 isometamedium chloride ( 250mg / ml ) 69 qunapyramine sulphate 1.5gm and qunapyraminechloride 1gm per vial 70 xylocane 2% 71 sulfadimidine bolus ( each bolus 5gm ) 72 streptomicin+penicillin inj ( procaine penicillin g15 lac + penicillin g sodium 5 lac + streptomycin sulphate 2.5gm ) per vial 73 infusions ( fluids and electrolytes ) : 74 calcium and magnesium borogluconate inj, for intravenous use ( calcium borogluconate 25%w / v, magnesium hypophosphite 5% w / v, dextrose anhydrous 20% w / v ) 75 electrolyte infusion ( dextrose 20gm+sodium chloride 0.6gm+potasium chloride 0.04 gm, calcium chloride dihydrate 0.027gm+sodium lactate 0.312 gm ) per 100 ml 76 feed additives and others : 77 ecobolic 78 ecobolic 79 multivitamin ( containing b1+b2+b6+b12 ) 80 multivitamin ( containing a+d3+e+k ) 81 multivitamin + liverextract 82 herbal wound spray 83 wound ointment 84 wound ointment 85 mineral mixture ( containing vitamin a, d3, e, nicotinamide, cobalt, copper, iodine, sodium, sulphur, zinc, calcium and phosphorus ) 86 mineral mixture ( containing vitamin a, d3, e, nicotinamide, cobalt, copper, iodine, sodium, sulphur, zinc, calcium and phosphorus ) 87 calcium ( 1700mg ) , phosphorous ( 850mg ) vitamine d3 ( 8000 i.u ) and vitamin b12 ( 100mcg ) minerals and vitamin oral suspension 88 indigenous & herbal drug : 89 antidiarrhoeal powder 90 antidiarrhoeal powder 91 stress reliver liquid 92 stomachic powder 93 antringent powder 94 expectorant powder 95 liver tonic 96 estrous inducer cap 97 uterine cleanser 98 uterine cleanser 99 antimaggot / anti bacterial comprehensive topical spray 100 galactogogues 101 antizymotic liquid 102 anti inflammatory spray for mastitis 103 anti inflammatory ointment for mastitis 104 anti inflammatory ointment for mastitis 105 rumenotoric bolus 106 hormones : 107 hydroxy progesterone caproate ( 250mg / ml ) 108 cloprostenol sodium ( 263 mcg / ml ) 109 chemicals : 110 phenyl ( black ) 111 phenyl ( white ) 112 povidine iodine 10% w / v 113 magnesium sulphate ( mg so4 ) 114 potassium iodide ( vi ) 115 sodium bi carbonate ( nahco3 ) 116 pottassium permagnate ( kmno4 ) 117 hydrogen preoxide ( h2o2 ) 118 hydrogen preoxide ( h2o2 ) 119 tincture iodine / benzoin etc. 120 tincture iodine / benzoin etc. 121 bandage 122 bandage 123 cotton 124 plaster of paris etc...

Health Department - Jharkhand

40913834 supply of medicine(for jssk) 23 24 inj atropin 2ml, inj traxol s 1.5 gm, inj amikacin 500 mg, inj gentamycin 80 mg 2 ml/10 ml, inj metron iv 100 ml, inj tramado 2 ml, inj pantoprazol 40 mg, inj ondenstron 2 ml, inj ampoxin 500 mg, inj ampoxin 1 gm, inj fortwin 1 ml, inj ranitidine 2 ml, inj pepzo 4.5 mg, inj deriphylin 2 ml, inj dexona 2 ml/10ml/30 ml, inj adrenalin 1 ml, inj gtn (nitroglycerine)5 ml, inj trenexa 5 ml, inj oxytocine 2 ml, inj dextrose 5%, inj isolyte p, inj manitol 20%, iv canula 18,20,22,24, easy fix, leucoplast 4;, foley catheter 16 no, uro bag, xylocain jelly 2%, e.t. tube(cuffed), inj termin, inj pethidin, inj diazepam, inj sodicard, inj nikethamide, inj avil, inj labetolol, chromic catgut with needle 0,1,2, plain catgut 1, prolene 1, prolene mesh, usg gelly 5 liter, b.p. blade 24,22 no, savlon 500 ml/100 ml, savlon 100ml, sprit 100ml, povidone iodine scrub, povidone iodine oint, bandage 2, rapidure 4;, inj ofloxacin, inj lasix, insullin syringe 2 ml, dispo syringe 3 ml, inj calcium gluconate, iron tonic, iron folic with calcium tabs, inj termin, inj ketamin 50 10 ml, inj nifedipine 5 ml, 10ml, inj dicyclomine, inj k nate, b.t. set, mucus extractor, cord clamp, sanitary pad, gloves no.6, (surgicare), gloves no.6.5,(surgicare), caps ampicilline+cloxacilline, inj ampicilline 1 gm, cap depin 5 mg, cidex soluction 5 lit, formalin solution 5 lit, tab mesoprost 1x10, section tube, inj, cefotaxim 1.125 gm, tabs dicylomine+paracitamol, inj anafortan, inj drotin, inj phenobarbltone, inj pipzo 1.125 mg, inj mero 125 mg, syp neurokin, inj dopamin 5 ml, pediaset, baby diper, baby towel, inj pan 40 mg, inj methergin 3ml, colin, handwash 500ml, senitizer 500ml, inj anti d, tab iron, inj phenytain sodium, inj heparin, tab astaymin, baby dress, abg reagant pack(blood gas analyzer), quality cleaner kit (blood gas analyzer), heoarin solution 5 ml(blood gas analyzer), dally cleaner kit(blood gas analyzer), etc....

Indian Army - Jharkhand

40886143 bids are invited for injured personnel carrier emergency sleeping bag , injured personnel carrier ipc , emergency blanket gold and silver , compression bandage 6 inch with closure bar , compression bandage 6 inch with closure bar and additional pad total quantity : 12...

Steel Authority Of India Limited - Jharkhand

40819307 bids are invited for spanner, driving, dwn: cob exp 0226 ( q3 ) , driving wheel & axle assly; f / cp; mt; bat 7 ( q3 ) , wheel, bandage blank, dwn: cob 6081a ( q3 ) total quantity : 60...

Health Medical Education And Family Welfare Department - Jharkhand

40768369 bids are invited for tab labetalol 100mg , cap ampicillin trihydrate 500mg , inj gentamycin 40mg , inj ampicillin 500mg , tab metronidazol 400mg , tab misoprostol 200mcg , tab dicyclomine 10mg , inj magnesium sulphate 10ml , inj oxytocin 2ml , inj menadion vitamin k3 , sodium chloride iv 500ml , dextrose iv injection 500ml , sodium bicarbonate injection 10ml , inj calcium gluconate 1gm , tab drotavarine 40mg , inj lignocain hcl 30ml , tab paracetamol 500mg , tab ibuprofen 400mg , tab multivitamin , inj promethazine 25mg , inj diclofenac 25mg in 3ml , compound sodium lactate iv injection 500ml , inj pentazocin lactate 30mg , inj adrenaline 1mg , inj atropine 1ml , inj dopamine 40mg 5ml , inj dexamethasone 4mg 2ml , tab fresemide 40mg , inj betamethasone sodium phosphate 4mg 1ml , inj amikacin 100mg , absorben cotton ip 500gm , povidone iodine solution 500ml , disposable examination gloves , surgical gloves sterile 7.5 , hypodermic syringe for single use bp 5ml , hypodermic syringe for single use bp 10ml , hypodermic needle for single use bp 22g and 23g , cotton bandage 10cm x 5mtr , absorbent gauze than 90cm x 18mtr , surgical spirit bp 500ml , iv set with hypodermic needl e21g , intra cath cannula for single use 18g , intra cath cannula for single use 22g , chromic catgut no 1 round body needle , chromic catgut no 2 round body needle , cord clamp , mucus sucker , folleys catheter 16fr , sticking plaster 2.5cm x 5mtr , spinal needle 23g , mersilk no 1 0 on cutting needle , mersilk no 2 0 on cutting needle total quantity : 495900...

Department Of Information Technology - Jharkhand

40730854 bids are invited for medicine as per requirement ( q3 ) zinc and iron tab domperidone tab paracetamol tab. 500 mg omeprazole cap 20mg cetirizine tab 5 mg / 10 mg nd5 nflox tz ranitidine 150 mg paracetamol tab. 250 mg tablet / ibrufen tab multivitamin tablet multivitamin syp glucometer strips 50 strips pack poc glucospot hb strips 50 strips pack poc company dettol 1 lts bp machine battery needle box 24gx1 cotton bandage 6inch gauge betadine sol 1lts gloves 100pc box thermometer total quantity : 1...

Department of Animal Husbandry and Fisheries - Jharkhand

40592862 bids are invited for veterinary medicine feed supplements and chemicals ciprofloxacin , ciprofloxacin tinidazole 1.5gm and 1.8 gm , ciprofloxacin tinidazole 250mg and 300mg , enrofloxacin 10 percent 100mg per ml , enrofloxacin 20 percent la , enrofloxacin 150 mg , enrofloxacin 10 percent , gentamicin 40mg per ml , ceftriaxone , ceftriaxone and tazobactum 500mg and 62.5mg , ceftriaxone and tazobactum 3gm and 375mg , ceftriaxone and tazobactum 4gm and 500mg , amikacin 250mg per ml , oxytetracycline inj 50 mg per ml , oxytetracycline inj 200 mg per ml la , tetracycline hydrochloride bolus 500mg per 1gm , tetracycline hydrochloride powder 50mg tetracycline per gm , amoxycillin and cloxacillin 1.5gm and 1.5gm , amoxycillin and cloxacillin 250 mg and 250 mg , chlorpheniramine maleate 10mg per ml , meloxicam 5mg per ml , meloxicam paracetamol 10mg and 150mg , meloxicam paracetamol 100mg and 1500mg , tolfenamic acid 40mg per ml , dexamethasone inj 4mg per ml , isofluperidone inj 2mg per ml , dicyclomin hcl 2 percent , flunixin meglumine equiv to 50mg per ml , tranexamic acid each ml contains tranexamic acid 100mg , antiseptic cream , antiseptic lotion , ivermectin ivermectin 1percent w.v , ivermectin ivermectin 1 percent w.v , iron preperations contains ferrous fumarate 1500mg, vitamin b12 75mcg, folic acid 7500mcg , atropine sulphate 1 percent , albendazole tab each tab contains 150 mg , albendazole bolus each bolus contains 1.5 gm , albendazole bolus each bolus contains 3 gm , albendazole liquid 2.5 percent w.v , fenbendazole tab each tab contains 150 mg , fenbendazole bolus each bolus contains 1.5 gm , fenbendazole bolus each bolus contains 3 gm , ivermectin la 5mg per ml , oxyclozanide liquid and levamisole 6 percent per ml , iron preparations each ml contains iron sorbitol citric acid iron contains 50mg, folic acid 500mcg, hydroxy cobalamine 500mcg acid 500mcg, hydroxy cobalamine 500mcg , butophosphane with b12 butophosphane100mg per ml, vitamin b12 500mg per ml , butophosphane with b12 butophosphane 100mg per ml, vitamin b12 500mg per ml , diminazine diaceturate rtu 70mg per ml with phenothiazone 375mg per ml per vial , buparvaqunone 50mg per ml , isometamedium chloride 250mg per ml , qunapyramine sulphate 1.5gm and qunapyramine chloride 1gm per vial , xylocane 2 percent , sulfadimidine bolus each bolus 5gm , streptomicin and penicillin inj procaine penicillin g15 lac and penicillin g sodium 5 lac and streptomycin sulphate 2.5gm per vial , calcium and magnesium borogluconate inj, for intravenous use, calcium borogluconate 25 percent w.v, magnesium hypophosphite 5 percent w.v, dextrose anhydrous 20 percent w.v , electrolyte infusion dextrose 20gm and sodium chloride 0.6 gm and potasium chloride 0.04 gm, calcium chloride dihydrate 0.027gm and sodium lactate 0.312 gm per 100 ml , hydroxy progesterone caproate, 250mg per ml , cloprostenol sodium 263 mcg per ml , ecobolic , multivitamin containing b1, b2, b6, b12 , multivitamin containing a, d3, e, k , multivitamin and liverextract , herbal wound spray , wound ointment , mineral mixture containing vitamin a, d3, e, nicotinamide, cobalt, copper, iodine, sodium, sulphur, zinc, calcium and phosphorus , calcium 1700mg, phosphorous 850mg vitamine d3 8000 i.u and vitamin b12 100mcg minerals and vitamin oral suspension , antidiarrhoeal powder , stress reliver liquid , stomachic powder , antringent powder , expectorant powder , liver tonic , estrous inducer cap , uterine cleanser , antimaggot or anti bacterial comprehensive topical spray , galactogogues , antizymotic liquid , anti inflammatory spray for mastitis , anti inflammatory ointment for mastitis , rumenotoric bolus , phenyl black , phenyl white , povidine iodine 10 percent w.v , magnesium sulphate mg so4 , potassium iodide vi , sodium bi carbonate nahco3 , pottassium permagnate kmno4 , hydrogen preoxide h2o2 , tincture iodine or benzoin etc , bandage , cotton , plaster of paris etc total quantity : 1087450...

Health Department - Jharkhand

40563724 rate contract for medicine and surgical items , acetazolamide tablet 250 mg each tab , acyclovir ointment 3%5 gm tube , adrenaline injection 1mg / ml 1ml. ample , albendazole oral liquid 200 mg / 5ml 10 ml bottle , albendazole tablet 400mg. , allopurinoltablet 100mg. , allopurinol tablet 300mg , amiodarone tablet 100 mg , amiodaronetablet 200 mg , amitriptyline tablet 25 mg , amitriptyline tablet 50 mg , amlodipine tablet 2.5 mg , amlodipine tablet 5 mg , amoxicillin capsule 250mg. , amoxicillin capsule 500mg , amoxicillinoral liquid 125 mg / 5ml 60 ml , amoxicillin ( a ) + clavulanic acid ( b ) dry syrup 125 mg ( a ) + 31.25 mg ( b ) / 5ml30 ml bottle , amoxicillin ( a ) + clavulanic acid ( b ) powder for injection 1 g ( a ) + 200 mg ( b ) each , amoxicillin ( a ) + clavulanic acid ( b ) tablet 500 mg ( a ) + 125 mg ( b ) .each , ampicillin powder for injection 1g.each , ampicillin powder for injection 500 mg.each , anti d immunoglobulin ( blank ) vial with diluent , anti rabies immunoglobulin ( blank ) vial with diluent , anti tetanus immunoglobulin ( blank ) each , ascorbic acid ( vitamin c ) tablet 100 mg , ascorbic acid ( vitamin c ) tablet 500 mg , atenolol tablet 100 mg , atenolol tablet 50 mgeach tab , atorvastatin tablet 10 mgeach tab , atorvastatin tablet 20 mgeach tab , atropine drops 1%5 ml vial each , atropine injection 0.6mg / ml 1 ml. ample.1ml each , azithromycin oral liquid 200 mg / 5ml.15 ml bottle each , azithromycin powder for injection 500mgeach , azithromycin tablet 250mg.each tab , azithromycin tablet 500mg. each tab , benzathine benzy lpenicillin powder for injection 12 lac units each , benzathine benzyl penicillin powder for injection 6 lac units . each , benzoyl peroxidegel 2.5%each , benzyl penicillin powder for injection 10 lac unitseach , betamethasone cream 0.05% ( 15gm tube ) , ointment , betamethasone injection 4 mg / ml in 2ml. vial.2ml , bisacodyl suppository 5 mgeach , bisacodyl tablet 5 mgeach tab , bleaching powdercontaining not less than 30% w / w10kg bag of available chlorine ( as per i.p ) , budesonide nasal spray 100 mcg / doseeach , budesonide respirator solution for use in nebulizer 0.5 mg / ml in 1ml.amp.1 ml. amp. , budesonide respirator solution for use in nebulizer 1 mg / ml in 2ml.ample.2 ml. amp. , budesonide respirator solution for use in nebulizer 1mg / ml1ml.amp. 1 ml. amp. , bupivacaine injection 0.5% ( hydrochloride ) in 4 ml. ample to be mixed with 7.5%glucose solution ( for spinal anesthesia ) 4 ml. amp. , bupivacaine injection0.25% in vial; each , calamine lotion ( as per ip ) each , calcium carbonatetablet 250 mgeach , tablet 500 mgeach , calcium gluconate injection 100 mg / ml 10ml. ample.10 ml. amp. , capreomycin powder for injection 1g1 gm , captoril tabs 25mg. each , captoril tabs 50mg. each , carbamazepine cr tablet400 mgeach , carbamazepine cr tablet 200 mg each , carbamazepine oral liquid 100 mg / 5 ml100 ml bottle , carbimazole tablet 10 mgeach , carbimazole tablet 5 mgeach , carboxy methylcell ulose drops 0.5% ( 10ml ) , eye drop , cefadroxil oral liquid 125 mg / 5ml30 ml bottle, syrup , cefadroxil tablet 1g each tab , cefadroxil tablet 500mg. each tab , cefazolin powder for injection 1g1 gm , cefazolin powder for injection 500 mg.500 mg , cefixime oral liquid 100 mg / 5 ml ( 30 ml bottle ) , cefixime tablet 200 mg. each tab , cefixime tablet 400 mg.each tab , cefotaxime powder for injection 1 g1 gm , cefotaxime powder for injection 250 mg.250 mg , cefotaxime powder for injection 500 mg500 mg , ceftazidime powder for injection 1 g1 gm , ceftazidime powder for injection 250 mg ..250 mg , ceftriaxone powder for injection 1 gm 1 gm , ceftriaxone powder for injection 2 gm 2 gm , ceftriaxone powder for injection 250 mg 250 mg , ceftriaxone powder for injection 500 mg 500 mg , cetirizine oral liquid 5 mg / 5ml60 ml bottle , cetirizine tablet 10mg.each tab , cetrimide solution 20% ( concentrate for750 mldilution ) , chloroquine oral liquid 50 mg / 5 ml60 ml bottle , chloroquine tablet 150 m , chlorpheniramine oral liquid 2 mg / 5ml30 ml bottle , chlorpheniramine tablet 4mg. , cholecalciferol oral liquid 400 iu / ml30 ml bottle , cholecalciferol tablet 1000 iu, each tab , cholecalciferol tablet 60000 iueach tab , ciprofloxacin drops 0.3 % eye and ear drop.10 ml bottle / drop , ciprofloxacin ointment 0.3%each , ciprofloxacin oral liquid 250 mg / 5ml.each , ciprofloxacin tablet 250mg. each tab , ciprofloxacintablet 500mg. each tab , clarithromycin oral liquid 125mg / 5ml30 ml bottle , clarithromycin tablet 250mg.each tab , clarithromycin tablet 500 mg.each tab , clindamycin capsule 150 mgeach tab , clindamycin capsule 300 mgeach tab , clobazam tablet10mgeach tab , clobazam tablet 5 mgeach tab , clonazepam tablet 0.25 mgeach tab , clonazepam tablet 0.5 mgeach tab , clopidogrel tablet 75 mgeach tab , clotrimazole cream 1%15 gm tube , clotrimazole drops 1% ear drop.10 ml bottle / drop , clotrimazole pessary 100 mg ( 1x10 ) x 10 tabs , co trimoxazole [ sulphamethoxazole ( a ) +trimethoprim ( b ) ] 100 mg sulfamethoxazole + 20 mg trimethoprim ( as pediatric tablet ) each , co trimoxazole [ sulphamethoxazole ( a ) +trimethoprim ( b ) ] oral liquid 200 mg ( a ) + 40 mg ( b ) / 5ml.60 ml bottle , co trimoxazole [ sulphamethoxazole ( a ) +trimethoprim ( b ) ] tablet 400 mg ( a ) + 80 mg ( b ) each tab , co trimoxazole [ sulphamethoxazole ( a ) +trimethoprim ( b ) ] tablet 800 mg ( a ) + 160 mg ( b ) each tab , cycloserinecapsule 10mg. each cap , cycloserine capsule 25mgeach cap , darunavir tablet 600 mgeach tab , deflazacort 12mg tab.each tab , deflazacort 6mg tab. each tab , dexamethasone injection 4mg / ml in 2 ml. vial.2 ml. vial , dexamethasone injection tablet 0.5mg.each tab , dextran 4010% injectioneach , diazepam injection 5 mg / ml 2ml.ample.2 ml. amp. , diazepam tablet 5 mgeach tab , diclofenac injection 25mg / ml 3ml ampleeach tab , diclofenac tab.sr 100mg. each tab , diclofenac tablet 50mg ; each tab , dicloxacillin capsule 250 mg.each cap , dicloxacillin capsule 500 mg. each cap , dicloxacillin oral liquid 125 mg / 5 ml.each , dicloxacillin powder for injection 250 mgeach , dicyclomine injection 10 mg / ml in 2ml. ample.2 ml. amp. , dicyclomine oral solution 10mg / 5ml30 ml bottle , dicyclomine tablet 10 mgeach , diethylcarbamazine tablet 100mgeach , diethylcarbamazine tablet 50mg. each , digoxin tablet 0.25 mgeach , diloxanide furoatetablet 500 mgeach , diltiazem sr tablet 90 mgeach , diltiazem tablet 30 mgeach , diltiazem tablet 60 mgeach , dinoprostonetablet 0.5 mgeach , domperidone oral liquid 1 mg / ml. 30ml. phail30 ml phail , domperidonetablet 10 mgeach tab , doxycycline capsule 100mg. each cap , doxycycline dry syrup 50mg / 5mleach , drotaverine inj. 20mg / ml2ml.ample.2 ml. amp. , drotaverine tab.40mg &each tab , enalapril tablet 2.5 mgeach tab , enalapril tablet 5 mgeach tab , erythromycin ointment 0.5% , escitalopram tablet 10 mgeach tab , escitalopram tablet 5 mgeach tab , ferrous saltstablet equivalent to 60 mg of elemental ironeach tab , fluconazole oral liquid 50 mg / 5 ml30 ml bottle , fluconazole tablet 150mg. each tab , flunarizine tablet 10 mgeach tab , flunarizine tablet 5 mgeach tab , fluoxetine capsule 20 mgeach cap , fluoxetine capsule 40 mgeach cap , fluphenazine depot injection 25 mg / mleach , folic acid tablet 5 mgeach tab , framycetin cream 0.5%each , furosemide injection 10 mg / ml in 2ml ample2 ml. amp. , furosemide tablet 40 mgeach tab , fusidic acid cream 2%10 gm tube , gentamicin drops 0.3%10 ml bottle / drop , gentamicin injection 10mg / ml in 2ml. vial.2 ml. vial , gentamicin injection 40mg / ml in 2ml. vial2 ml. vial , glimepiride tablet 1 mgeach tab , glimepiride tablet 2 mgeach tab , glucose injection 10%each , glucose injection 5%each , glucose injection 50%each , glucose ( a ) + sodium chloride ( b ) injection 5% ( a ) + 0.9% ( b ) each , glycerin oral liquid60 ml , glyceryl trinitrate sublingual tablet 0.5 mgeach , griseofulvin tablet 125mg.each tab , griseofulvin tablet 250mg.each tab , haloperidol tablet 10 mgeach tab , haloperidol tablet 5 mgeach tab , homatropine drops 2%each , hydrochlorothiazide tablet 12.5 mgeach tab , hydrochlorothiazide tablet 25 mgeach tab , hydrocortisone injection 100 mg in 1ml .vail1 ml. vial , hydrocortisone injection 200 mg in 2ml. vial.2 ml. vial , hydrogen peroxide solution 6% ( 400 ml ) , bottle , hydroxocobalamin 1mg in 1ml. in 30ml. vail.c434i.m. only30 ml. vial , hydroxy urea capsule 500 mgeach cap , hyoscine butylbromide injection 20 mg / ml 1mlample.1 ml. amp. , hyoscine butylbromidetablet 10 mgeach tab , ibuprofen oral liquid 100 mg / 5ml60 ml bottle , ibuprofen tablet 200mg.each tab , ibuprofentablet 400mg.each tab , imipramine tab. 10mg, each tab , imipramine tab. 25mg.each tab , insulin ( soluble ) injection 40 iu / mleach , intermediate acting ( nph ) insulininjection 40 iu / mleach , intraperitoneal dialysis solution as licensed each , isosorbide dinitratetablet 10 mgeach tab , isosorbide dinitratetablet 5 mgeach tab , isosorbide 5 mononitrate sr tablet 30 mgeach , ispaghula granules / husk / powder each , ketamine injection 10mg / ml ; , labetalol injection 5 mg / ml 20 ml.vial.20 ml. vial , levo thyroxine tablet 100 mcgeach tab , levo thyroxine tablet 50 mcgeach tab , levofloxacin tablet 250mg. each tab , levofloxacin tablet 500mg. each tab , lignocaine eye drop 4% , lignocaine injection for spinal anaesthesia: 5% ( hydrochloride ) in 2 ml ampoule to be mixed with 7.5% glucose solution2 ml. amp. , lignocaine injection2% in vial . , lignocaine topical forms2% to 4% ampoule , lignocaine ( a ) + adrenaline ( b ) dental cartridge: 2% ( a ) + 1:80 000. ( b ) , linezolid tablet 600mg , lorazepam injection 2mg / ml in 1 ml. ample.1 ml. amp. , lorazepam tablet 1mg. each tab , lorazepam tablet 2mg.each tab , magnesium sulphate injection 500mg / mlin 2ml. ample.2 ml. amp. , mannitol injection 10%each , mannitol injection 20%each , mebendazole oral liquid 100 mg / 5ml30 ml bottle , mebendazole tablet 100mg.each , mecobalamin inj. 500?gm / ml. 1ml. ample.1 ml. amp. , mecobalamin tab. 500?gmeach , mefenamic acid capsule 250mg. each , mefenamic acid capsule 500 mg.each , mefenamic acid oral liquid 100 mg / 5ml30 ml bottle , mephentermine inj.30mg / ml 1ml. ample.1 ml. amp. , metformin tablet 1000 mg. ( immediate and controlled release ) each , metformin tablet 500 mg. ( immediate and controlled release ) each , methotrexate tablet 2.5 mg , methotrexate tablet 5mg. , methyl prednisolonetablet 16 mgeach , methyl prednisolonetablet 8 mgeach , methyldopatablet 250 mg.each , methyldopa tablet 500 mgeach , methylergometrine injection 0.2 mg / ml in 1ml. ample.1 ml. amp. , methylergometrine tablet 0.125 mgeach , methylrosanilinium chloride ( gentian violet ) topial preparation 0.25% to 2%each , metoclopramide injection 5 mg / ml in 2ml. ample.2 ml. amp. , metoclopramide oral liquid 5 mg / 5 ml30 ml bottle , metoclopramide tablet 10 mgeach , metoprolol sr tablet 50 mgeach , metoprolol tablet 25 mgeach , metoprolol tablet 50 mgeach , metronidazole injection 500 mg / 100ml in vialeach , metronidazole oral liquid 200 mg / 5 ml.30 ml bottle , metronidazole tablet 200mg.each , metronidazole tablet 400mg. each , morphineinjection 10mg / ml in 1ml ample. 1 ml. amp. , moxifloxacin tablet 200mg. each , moxifloxacin tablet 400mgeach , n acetylcysteine injection200mg / ml 5ml.ample5 ml. amp. , n acetylcysteine sachet 200 mg. each , naloxone injection 0.4mg / ml in 1ml. ample.1 ml. amp. , natamycin drops 5%each , neostigmine injection 0.5mg / ml in 1ml. ample.1 ml. amp. , nifedipinetablet 10 mgeach , nitrofurantoin oral liquid 25 mg / 5mleach , nitrofurantoin tablet 100mg. each , nystatin oral liquid 100, 000iu / mleach , nystatin pessary 100, 000iueach , nystatin tablet 500, 000iueach , olanzapine film coated 10mg., tab. each , olanzapine film coated 5mg., tab. each , omeprazole capsule 10 mgeach , omeprazole capsule 20 mgeach , omeprazole capsule 40 mgeach , ondansetron tablet 4 mgeach , ornidazole 500mg. tab.each , ostelamivir 30mg, tab. each , ostelamivir 60mg, tab.each , oxytocin injection 10 iu / ml in 1ml. ample.1 ml. amp. , oxytocin injection 5 iu / ml in 1ml. ample.1 ml. amp. , pantoprazole 40mg cap .each , pantoprazole injection 40 mgeach , paracetamolall licenced oral liquid dosage forms andstrengths syrup 125 mg / 5ml & 60 ml bottle , paracetamoldrop 100mg / ml. each , paracetamolinjection 150mg / ml 2ml.ample.2 ml. amp. , paracetamoltablet 500 mgeach , permethrincream 5%15 gm tube , permethrinlotion 1%60 ml bottle , pheniramineinjection 22.75mg / ml 2ml. ample.2 ml. amp. , phenobarbitoneoral liquid 20 mg / 5ml , phenobarbitonetablet 30 mg. , phenobarbitone tablet 60 mg. , phenylephrine drops 10 % , phenylephrine drops 5% , phenytoin tablet 100mg. , phenytoin tablet 50mg. , phytomenadione injection ( vitamin k1 ) 10 mg / ml in 5 ml. ample.5 ml. amp. , phytomenadione ( vitamin k1 ) tablet 10mg , pilocarpine drops 2%5ml bottle / drop , pilocarpine drops 4%5ml bottle / drop , potassium chloride injection 150 mg / ml in 20ml. ample.20 ml. amp. , potassium chloride oral liquid 500 mg / 5 ml60 ml bottle , povidone iodinesolution 4% 500 ml , pralidoxime chloride ( 2 pam ) injection 25mg / ml in 20 ml. ample.20 ml. amp. , prednisolone drops 1%each , prednisolone oral liquid 5 mg / 5 ml 30 ml bottle , prednisolone tablet 10mgeach , prednisolonetablet 5mg. each , premix insulin 30:70 ( regular:nph ) injection injection 40 iu / mleach , primaquinetablet 15 mgeach , primaquinetablet 7.5 mgeach , proparacainedrops 0.5%each , propofolinjection 10mg / ml; 20mg / mleach , propranololtablet 40 mgeach , pyridoxinetablet 100 mgeach , pyridoxinetablet 50 mgeach , rabies vaccine ( blank ) 0.5 ml diluent , ramipriltablet 2.5 mgeach , ramipriltablet 5 mgeach , ranitidineinjection 25 mg / ml in 2ml. ample.2 ml. amp. , ranitidineoral liquid 75 mg / 5 ml100 ml bottle , ranitidine tablet 150 mgeach , riboflavin tablet 5 mgeach , ringer lactate injection ( as per ip ) 500 ml , risperidone tablet 2 mgeach , risperidone tablet 4 mgeach , salbutamol inhalation ( mdi / dpi ) 100 mcg / doseeach , salbutamol oral liquid 2 mg / 5 ml100 ml bottle , salbutamol respirator solution for use in nebulizer 5mg / mleach , salbutamol tablet 2 mgeach , salbutamol tablet 4 mgeach , salicylic acid ointment 6%30 gm tube , silver sulphadiazine cream 1%20 gm tube , snake venomantiserumpowder with diluant ( 10 ml vial ) , injection b ) lyophilized polyvalent , sodium bicarbonate injection ( as per ip ) 10 ml, ampoule , sodium chloride injection 0.45%each , sodium chloride injection 0.9%each , sodium valproateoral liquid 200 mg / 5ml100 ml bottle , sodium valproatetablet 200mg. each , spironolactonetablet 25 mg each , spironolactone tablet 50 mg each , telmisartan tablet 20 mg each , telmisartan tablet 40 mg each , terbinafine 250mg tab.each , terbinafine ointement 2% each , tetanus toxoid ( blank ) each , thiamine injection 100 mg / mleach , thiaminetablet 100 mgeach , tinidazole inj.2mg / ml 400ml vial.400 ml. vial , tinidazole tab. 500 mg each , tranexamic acid injection 100 mg / ml in5 ml.ample.5 ml. amp. , tranexamic acid tablet 500 mgeach , tropicamide eye drop 1% 5mlvial , vitamin a capsule 100000 iu each , vitamin a capsule 50000 iu each , vitamin a injection 50000 iu / ml 2ml. ample2 ml. amp. , vitamin a oral liquid 100000 iu / ml100 ml bottle and 2 ml spoon with 1 2 ml marking , water for injection each , xylometazoline nasal drops 0.05 %10 ml bottle / drop , xylometazoline nasal drops 0.1 %10 ml bottle / drop , factor viii 250 iu , factor viii 500 iu , factor viii 1000 iu , factor viii 1500 iu , vwd 250 iu , vwd 500 iu , factor viii mimic 30 mg ( emicizumab ) , factor viii mimic 60 mg ( emicizumab ) , factor ix pd 500 iu , factror ix 1000 iu , factror ix 600 iu , factror ix 1200 iu , ehl factorviii 500 iu , ehl factorviii 1000 iu , ehl factorviii 250 iu , ehl factorviii 1500 iu , ehl factorviii 2000 iu , fiba 500 iu , fector viii mg , plazma derivates fix 600 iu , plazma derivates fix 1200 iu , ab pacili 100 mg , rem rtu , rtu doce , adpaxil 100 / 30 / 260 mg , adpem 100 / 500 mg , emetant iv 150 mg , emetant cao , adcumin syrup , caxfila 160 mg , vincentra 150 / 440mg , abiratred 500mg tab 60s , aprecap 125 / 80mg cap 3s , arsenox 10mg inj 10ml , xpreza 100mg inj , benzz 100mg inj , bimode 100mg inj , bleochem 15un inj , proteoz 2mg inj , cazanat 40mg tab 30s , capsy 500mg tab 10s , kemocarb 150mg inj , kemocarb 450mg inj , selcoxib 200mg cap 10s , cisplat 50mg inj 50ml , platin 50mg inj , cycloxan 1gm inj , endoxan 50mg tab , biobin1gm inj 10ml , biobin 100mg inj , dabaz 500mg inj , dacilon 0.5mg inj , decmax 4mg tab 8s , rtu doce 120mg inj , rtu doce 80mg inj , taxocare 120mg inj , duxocin 50mg inj , metodox 50mg inj , epixtra 10mg inj , epixtra 50mg inj , erlotad 100mg tab 10s , posid 100mg inj , neukine 300 mcginj , 5 flucel 250mg inj , 5 flucel 500mg inj 10ml , oncofluor 500mg inj 10ml , gem rtu 1 gm inj , gem rtu 1.4gm inj , gem rtu 200mg inj , holoxan 2gm inj , ifomid m 2g injection , imat 400mg 10s , irnocam 100mg inj 5ml , inotad 100mg inj , bionase 10k inj , bionase 5k inj , lagicad 5000iu inj , lenvat 10mg tab 30s , letroz 2.5mg tab 5s , biovorin 50mg inj , leugard depot 22.5mg inj , lupride depot 11.25mg inj , lipodox 50mg inj 25ml , 6 mp 50mg tab 10s , biotrexate 2.5mg tab 10s , biotrexate 500mg inj 5ml , adxate 500mg inj 20ml , folitrax 50mg inj , oxiplat 100mg inj , oxiplat 50mg inj , bevetex 100mg inj , nanoxel 30mg inj , petaxel 100mginj 16.7ml , taxonab 100mg inj , palnox inj 0.25mg , pegstim 6mg / 6ml inj , pemnat 100mg inj , pemnat 500mg inj , enfiera 100mg inj , enfiera 500mg inj , sutinat 25mg cap 28s , sutinat 12.5mg tab 28s , tamodex 20mg tab 10s , glioz 100 mg cap 5s , topotec 2.5mg inj 2.5ml , vivitra 440mg inj , chemoblast 10mg inj , uniblastin 10mg inj 10ml , unicristin 1mg inj 1ml , vinlon 1mg inj , natzold 5mg inj 100ml , adcumin syp 100ml , artery forcep spencer wells 5, 6 straight / curved , artery forcep spencer wells 7 straight / curved , artery forcep spencer wells 8 straight / curved , artery forcep spencer wells 9, 10 straight / curved , artery kelly forceps 5½ straight / curved , artery forcep crile 5½, / 6½ straight / curved , artery forceps rochester pean 5½, 6¼ staright / curved , artery forceps rochester pean 7¼ , 8 staright / curved , artery forceps rochester pean 9, 10 staright / curved , artery forcep moynihans 5¾ straight / curved , artery forcep dandy side curved 5¾ , artery forcep adson 7¾ straight / curved , aretryforceplahey8, 9 ( longitudinal ) , artery forcep gemini mixture6, 7 , artery forcep gemini mixture 8, 9 , artery forceps right angled 6 , artery forceps right angled 7 , artery forceps right angled 8 , artery forceps right angled 10 , artery forceps right angled 6 ( longitudinal ) , artery forceps right angled 7 ( longitudinal ) , artery forceps right angled 8 ( longitudinal ) , artery forceps right angled 10 ( longitudinal ) , mosquito artery forcep 5 straight / curved , halstead ultrafine haemostaticforcep 4, 5, 6 straight / curved , kochers artery forcep 6 straight / curved , kochers artery forcep 7, 8 straight / curved , sinus forcep 6 , sinus forcep 7, 8 , baby mosquito forceps 3.5, 4 straight / curved , vasectomy / nsv ring forcep , vasectomy / nsv point forcep , allis tissue forcep 6 , allis tissue forcep 7 , allis tissue forcep 8 , baby allis tissue forcep 4, 5 , allis tissue forceps 6 1x2 teeth fine , allis tissue forceps6 with autraumatic teeth , allis nc tissue forceps8 with autraumatic teeth , stille allis tissue forceps light pattern delicate 6, 8 , littlewood tissue forceps 7½ , lane tissue forcep 6, 7 , babcock tissue forceps 4, 5 serrated / slit jaws , babcock tissue forcep 6 , babcock tissue forcep 8 , babcock tissue forcep 6autraumatic , babcock tissue forcep 8autraumatic , towel clip cross action4 , towel clip backhaus 4, 5 , towel clip backhaus 5½, 6 , towel clamp 5 / 6 with ball stops , towel clip moynihan 7½ , halsey needle holder4, 5 , mayo hegar needle holder 5, 6 , mayo hegar needle holder 7 , mayo hegar needle holder 8 , mayo hegar needle holder 9, 10 , bozeman needle holder 6 double curved , bozeman needle holder 7double curved , bozeman needle holder 8 double curved , derf needle holder 4¾ , webster needle holder 5 , kilner needle holder 5¼ 6½ , mathieu needle holder 6¼ 7½ , ryder needle holder 4, 5, 6 , ryder needle holder 7 , ryder needle holder 8 , debakey needle holder 6 , debakey needle holder 7 , debakey needle holder 8 , scissor fine straight / curved 4 , scissor fine straight / curved 5 , scissor fine straight / curved 6 , scissor s / s, s / b straight / curved 5, 6 , scissor s / s, s / b straight / curved 7 , scissor s / s, s / b straight / curved 8 , scissor s / s, s / b straight / curved 9, 10 , doyen abdominal scissor 8 straight / curved , ferguson abdominal scissors 7 , sims scissors 8 s / s straight / curved , kelly fistula scissors 6¼ straight / curved , scissor metzenbaum straight / curved 4 , scissor metzenbaum straight / curved 5, 6 , scissor metzenbaum straight / curved 7 / 7½ , scissor metzenbaum straight / curved 8 , scissor metzenbaum straight / curved 9, 10 , scissor nelson metzenbaum straight / curved 9, 10 , scissor mayos straight / curved 5, 5½ , scissor mayos straight / curved 6, 6½ , scissor mayos straight / curved 7½, 8 , scissor mayo stille 6 , scissor mayo stille 8 , scissor suture cutting heath 6 / 4.5 , scissor suture cutting littauer 4½, 5½ , scissor wire cutting 5½ , scissor episiotomy barnes 5, 6 , scissor episiotomy 7 , scissor bandage cutting / plaster cutting 6 , scissor bandage cutting / plaster cutting 7.5 / 8 , plaster cutting scissor 9 heavy spring action , scissor umbilical cord 4 , scissor counter / tailor 8, 9, 10 , scissor t.c tip metzenbuam 5 / 6 imported edge , scissor t.c tip metzenbuam 7 imported edge , scissor t.c tip metzenbuam 8 imported edge , scissor t.c tip mayo5 / 6 imported edge , scissor t.c tip mayo7 imported edge , scissor t.c tip mayo8 imported edge , dissecting forceps plain / tooth 4, 5, 6 , dissecting forceps plain / tooth 7 , dissecting forceps plain / tooth 8 , dissecting forceps plain / tooth 9, 10 , dissecting forceps 2 x 3, 4 x 5 teeth, 5, 6 , dissecting forceps 2 x 3, 4 x 5 teeth, 7, 8 , dissecting forceps plain / tooth adson 4, 5 , dissecting forceps plain / tooth adson 6 , dissecting forceps plain / tooth adson 7 , dissecting forceps russian 6 , dissecting forceps waugh plain / tooth 5 6 , dissecting forceps waugh plain / tooth8 , dissecting forceps mcindoes 6 , dissecting forceps gillies 6 , dissecting forceps ramsay / bonney 7 , dissecting forceps pake 4.5 fine jaws , dissecting forceps pake6 fine jaws , dressing forceps 6 , dissecting forceps russian 8 , dissecting forcepdebakeyautraumatic grip5, 6 , dissecting forcepdebakeyautraumatic grip7, 8 , dressing forceps cushing 7¼ bayonet shape pl / th , dressing forceps adson 8¼ bayonet shape plain / toothed , dressing forceps wilde5 angular , dressing forceps splinter 4, 4½ , hook sharp / blunt, single , hook sharp / blunt, double , probe malleable 5, 6 , probe malleable 7, 8 , probe with eye , sinus probe 6 malleable , fistula probe / director , lockhart mummery fistula probe set of 4 , b.p.handle / scalpel handle flat no 3 / 4 , b.p.handle / scalpel handle flat no 3 long , b.p.handle / scalpel handle flat no 7 , b.p.handle / scalpel handle roundno 3, / 4 , b.p.handle / scalpel handle round doubleno 3&4 , sponge holding forcep 6 , sponge holding forcep 7 / 8 , sponge holding forcep 9.5 10 , mayo safety pin forcep holder 6, 7, 8 , syme aneurysm needle 6.5 , michel clip extracting forcep , bull dog clip 1, 1½, 2 , bull dog clamp vascular serratiom 1½, 2 2½ straight / curved , bull dog clamp vascular serratiom 3, 3½, 4, 5 straight / curved , key hernia director , collingwood stewart hernia forcep , kocher thyroid dissector6¼, 6½, 7 , nested trocar set of 3 , varicose vein strippers , vericose vein stripper complete in box , sterilisingforcepcheatle heavy 10 , sterilisingforcepcheatle heavy 12 , sterilisingforcepcheatle 6, 8 , harrison bowl sterilisingforcep 14, 18 , plaster cutting saw , foreign body remover , amputation saw , clip applying forcep no 100, 200, 300, 400 , staple removing forcepmetal , placenta kelly forceps 12 cvd , intestinal clamp doyen 8 straight / curved , intestinal clamp doyen 9, 10straight / curved , intestinal clamp kochers 5, 6straight / curved , intestinal clamp kochers 8, 9, 10straight / curved , intestinal clamp autraumatic ( 2 x 3 ) serration9, 10straight / curved , danis brown intestinal forcep 7 , payr intestinal clamp 8¼, 10 , pool suction tube , tincler suction tube10 , suction tube set with three interchangeable tubes with handle , yankaur suction tube , geary grunt cholecystectomy forcep 9 , lahey cholecystectomy forcep 7¾ , moynihan cholestectomyforcep 8¾ , moynihan cholestectomyforcep 11½ , desjardines gall stone forcep , bake bile duct dilators set of nine 8 , moynihan probe 13¾ , chaetle gall stone scoop 13 , foss milking forcep 7 , vaginal wall retractor , czerny retractor double ended 6 , czerny retractor double ended 8 , langenbeck retractor¼, ½, ¾, , langenbeck retractor1, 1½ , langenbeck set ( set of 11 ) , morris retractor 1½ / , 2 / , 2½ blade , doyens retractor 2, 2½ , doyens retractor 3, 3½ , deaver abdominal retractor ½, ¾, 1x12 , deaver abdominal retractor 1½, 2x 12 , deaver abdominal retractor 2½, 3x 12 , deavers retractor mini 1 / 4, 1 / 2 , kelly retractor 1½x 7½, 2¼x 7½ , volkman retractor 1 / 2 / 3 prongs , volkman retractor 4 / 5 / 6 prongs , lane retractor½x ¾, 1x 1¼ , moynihan retractor ½x 1 , balfour abdominal retractor , pozzi abdominal retractor , swift jolly abdominal retractorwith 6 blades , krischner retractor set , balance retractor with 6 prongs , cheek retractor , jolls thyroid retractor , jansen mastoid retractor small / large , alms skin retractor self retaining blunt prongs 4 , single hook retractor , double hook retractor , self retaining retractor mollison 4 / 5 / 5.5 2x2prongs , self retaining retractor mollison 4 / 5 / 5.5 3x3prongs , self retaining retractor mollison 4 / 5 / 5.5 3x4prongs , self retaining retractor mollison 63x4prongs , self retaining retractor mollison 63x3prongs , self retaining retractor mollison 64x4prongs , self retaining travers retractor 4x5teeth8 , self retaining travers retractor 4x4teeth8 , self retainingweislander retractor 3x4teeth 5½ , roux retractor set of 3 s / s , c shape retractor set of 3 , us army retractor set of 2 , allison lung retractor , finochito retractor adult with 6 blades , finochito retractor adult , finochito retractor child , finochito retractor infant , cloward retractor 6complete with 5 pair blades , cloward retractor 10complete with 5 pair blades , inge spreader 6¼ , inge spreader 10 , st. millar retractor / cats paw retractor , ina retractor , catheter female standard type , catheter male set of 12 , catheter male ( single ) , henrick kidney pedicle clamp10½ , mayo clinic pedicle clamp 9¾ , cooley renal artery forcep , randal renal calculasforcep set of 4 , turner warwick renal stone forcep 7½ shallow / deep curved , irwin pyelo lithotomy forcep 4 , thompson walker retractor , thompson walker abdominal retractor complete system , millin prostatic capsule forcep t shaped jaw 9 , prostatectomy scissors curved on flat 10 , clutton urethral sound 10½ set of 12 , clutton urethral soundpadiatric , lister urethral sound 11 set of 12 , hey groves retrograde bougies 6¾ set of 3 , catheter introducer foleys , suprapubic trocar 6mm / 8mm / 10mm , suprapubic trocar slitted 6mm / 8mm / 10mm , hydrocele trocar , thompson walker penile clamp with silicon guard , gwilliam hysterectomy clamp8 straight / curved , gwilliam hysterectomy clamp8 straight / curved without teeth , heaney hysterectomyclamp8 single tooth straight / curved , heaney hysterectomyclamp 8 double toothed straight / curved , maingot hysterectomy clamp forcep 8 straight / curved , hysterctomy clamp clamp 2 x 3 autaumatic jaw 8 st / cvd , hysterectomy horizontal & vertical serration 8 st / cvd. , wertheim cullen pedicle clamp 8½ right angled , somer uterus holding forcep 10 , dartigues uterus holding forcep 10 , collin uterus holding forcep 10 , bonneymymectomy clamp 10½ , doyen myoma screw 6, 7 ring / t handle , auvard vaginal speculam weighted , doyen rectangular retractor small, mediumlarge , wertheim retractor blade 95mm x 38mm , landon vaginal retractor 3½ x 1 , gelpi retractor , sims duckbill speculam double endedextra large , sims duckbill speculam double ended large , sims duckbill speculam double endedmedium , sims duckbill speculam double ended small , cusco vaginal speculam extra large , cusco vaginal speculam large , cusco vaginal speculam medium , cusco vaginal speculam small , cusco vaginal speculam virgin , hawkins ambler cervix dilators 6¾ set of 16 , hegar cervix dilators set of 10 double ended , dilator cervix dr. das model set of 12 double ended , uterine curette s / b 9½ double ended , sims uterine qurettes sharp / blunt 10 small / med / lar s / e , vaginal wall retractor , uterine flushing qurettessmall, medium large 11½ , horrocks uterine curette 10¼ , bozeman uterine dressing forcep 10 , bonney uterine polypus forcep 10 , vant uterine polypus forcep 10 , uterine volsellumforcep 1x1 teethtenaculam forcep10 , uterine volsellumforcep 2x2 teeth 10 , teales uterine volsellumforcep 3 x 4, 4 x 5 teeth 8 , teales uterine volsellumforcep 3 x 4, 4 x 5 teeth 10 , galabin uterine sound 11½ , horrocks uterine sound 12 , sims uterine sound 13 , novak suction curette 10 , sharman endometrial biopsy curette 8¾ , i.u.d removing hook 12½ , robin intra uterine cannula , leech wilkinson inta uterine cannula / hsg , uterine manipulator , uterine elevator ( volsellum with sound ) 10 , van doren cervical biopsy punch 10½ , faure biopsy punch 8¼ , schubert biopsy punch 10¼ , leech wilkinson cevical biopsy punch 8 , schumaker cervical biopsy punch 9½ shaft , shirodkar cervical clamp 10 , tischler biopsy forceps with lock , goodwin amniotomyforcep 10½ , m.t.p.cannula set of 4 , ovamforcep small / medium / large cup , maclintock ovum forcep 9½ , greenhalgh ovum forcep 9½ , green armytage clamp forcep , wrigley obstetric forcep 11 , simpson obstetric forcep 11 , anderson obstetric forcep 15 , obstetric forceps k.n.das with axis traction , smellie perforators 10½ , schroeder uterine scoops 1 to 6 sizes , d.& c set special , silicon vaccum extractor 50mm , silicon vaccum extractor 60mm , silicon vaccum extractor 70mm , dressing drum 9x9 , dressing drum 11x9 , dressing drum 11x4.5 , dressing drum 15x11 , autoclave , instrument trolley 27l x 18w x 36 h , instrument trolley 36 l x 20wx36 h , instrument trolley 42 lx 20 w x 36 h...

Steel Authority Of India Limited - Jharkhand

40229750 bids are invited for spanner, driving, dwn: cob exp 0226 (q3) , driving wheel & axle assly; fcp; mt; bat 7 (q3) , wheel, bandage blank, dwn: cob 6081a (q3) total quantity : 60...

Civil Hospital - Jharkhand

40219684 tender for supply of medicine aceclofenac ip 100mg + paracetamol ip 325mg + serratiopeptidase ip 15mg tablet aceclofenac + paracetamol tablet 100mg/325mg tab paracetamol tab 650mg amikacine 500 mg/2 ml inj vial amoxicillin 500 mg cap amoxicillin + clavulinic acid 228.5mg/5ml syp 30 ml antacid liquid dried aluminium hydroxide gel 250 mg, magnesium trisilicate 250mg, activated methyl polysiloxane 50mg per 5 ml 200ml artesunate powder for injection 60 mg with diluent bandage roll 15cm x 9 mtr.x12 beclomethasone dipropionate 0.025% w/w + clotrimazole 1.00% w/w cream rms blood administration set 200 micron filter budesonide nebulizer 0.5mg/2ml cefuroxime axetil tablet 500mg cetrimide + clorohexidine 3% +1.5% 1 itr cetrizine 10mg tab ciprofloxacin 500 mg + tinidazole 600 mg tab ciprofloxacine i.v. 100 ml cotton roll [500gm net] cough syrup/5ml contains diphenhydramine. hcl 14mg,ammonium chloride 0.1gm, sodium citrate 50mg,menthol 1mg 60ml dexamethasone injection 4mg/ml in 2 ml. amp dextrose inj ip i.v 5%w/v [d5] 500ml diclofenac gel 1%, 30gm. dicyclomine hydrochloride 10 mg + paracetamol 325 mg tab etophylline+theophylline inj 84.5 mg + 25.3 mg ferrous ascorbate and folic acid suspension 150ml equivalent to 30mg elemental iron + ip 550mcg french chalk 400g pkt frusemide tablet 40mg fungal diastase + pepsin syrup 12.5mg+7.5mg 200ml fusidic acid cream 2% w/w 10 gm tube gauze than 90cmx18mtr haemacceal 500ml [11111] iv hydroxyethyl starch (hetastarch) 6 % i.v. cannula i.v. set 150 cm rms with filter levosalbutamol 1.25mg + ipratropium bromide 500mcg respiratory solution 2.5ml linezolid iv infusion 200mg/100ml in 300 ml bott linezolid tablet 600 mg liver tonic syrup 225 ml mannitol 20% ip 100 ml mephenteramine inj. 30 mg/ml (neon) metronidazole ip iv fluid 500mg/100ml montelukast sodium + levocetirizine hydrochloride tab moxifloxacin eye ointment 0.5% w/w 5 gm moxifloxacin hcl 0.5% wv and benzalkoniun chloride 0.02% vv eye & ear drop multiple electrolytes + dextrose injection type i ip (electrolyte p injection) 500 ml multivitamin infusion 10 ml inj multivitamin + multimineral with lycopene + l lysine + antioxidants + methylcobalamin syrup 200ml nifedipine 10/5 mg capsule pantoprazole paracetamol phenytoin inj 50 mg drop multivitamin 30 ml povidone lodine 5 % 500 mi ringer lactate solution for inj ip 500ml [rl] rubber sheet 10 metre sodium chloride and dextrose inj i.p. 500ml dns (0.9% w/v sodium chloride + 5% w/v dextrose) [dns] sodium chloride injection ip 0.9% w/v normal saline 500 ml spirit 500ml bott surgical gloves 7 no sterile 21gm insuline syring 1 ml [0000] syringe dispo 3 ml [00] syringe dispo 5 ml tetanus vaccine 10 ml/0.5ml vial three way stopcock tramadol injection 50mg/ml traneximic acid inj 500mg/5ml urine bage ursodeoxycholic acid tab 300mg vitamin b complex tablets n.f.i.vitamin b1 i.p. 2 mgvitamin b2 i.p. 2 mgvitamin b6 i.p. 0.50 mg niacinamide ferrous ascorbate 10mg and folic acid 100mcg drop 15ml inj iron sucrose gynee gloves [00] adrenaline injection 1 mg/ml 1 ml ample amikacin ip 100mg/2ml inj amoxicillin 500 mg cap ampicillin 125mg + cloxacillin 125mg injection powder with anti d immunoglobin (human) 300 mcg autoclave indicator tape 19mm x 50mt bacillus clausii spores suspension 2*10/10ml b complex with multivitamin drops 15 mi blood transfusion set levobupivacaine 5mg + 80mg 4ml( neon) cabergoline tab 0.5mg calcium phosphorus ip 774mg magnesium hydroxide ip 75mg zinc gluconate usp 4mg and vitamin d3 ip 200 iu 150 ml camylofin dihydrochloride 25 mg/ml inj citicholin 250 mg amp cefixime paediatric drop 25 mg cefotaxime 125 mg with diluent inj clotrimazole mouth paint 1% cotton roll 400 gm paciface 100 ml bott dextrose diaper guard cream 30 gm diazepam inj 5mg/ml dicyclomine hydrochloride 10 mg + paracetamol 325 mg tab dicyclomine injection 10 mg/ml in 2ml. ample. [00] digestive enzymes drops 15ml disposable syringe dopamine hydrochloride 40 mg / mi ecg jelly doppler jelly 250 ml erythromycin estolate 100mg/ml drop ferrous ascorbate 10 mg and folic acid 100 mcg drop gentamicin inj. 40 mg / mi in 2ml. vial glutaraldehyde disinfectant solution 2.45% w/v 5 litre haemacceal 500ml [11111] heparin sodium ip 25000 iu/ 5ml + benzyl alcohol ip 1% v/v hydrocortisone succinate 100 mg/2ml vial. ibuprofen paracetamol suspension each 5 ml contain in calcium gluconate ip 10% 10m amp intracath 20 no isoxsuprine hydrochloride 40mg iv cannula 20 g [00] iv cannula 26 g ketoconazole cream ip 1% w/w 15gm |labetall 100mg tab |labelalol lu bugil neon lactulose 6gm/15ml 100ml syrup levetiracetam injection 100 mg/ml in 5ml vial [0000] lignocaine hydrochloride gel ip 30gm 2% lignocaine injection ip 2% in 30ml vial magnesium sulphate inj 500 mg/ml in 2 ml. ample mefenamic acid 50mg paracetamol 125mg suspension 60ml meropenem powder for injection 125mg/vail metronidazole ip iv fluid 500mg/100ml midazolam 5 mg / mi mifepristone 200mg +misoprostol 200 mg of combipack 4+1 tab mma kit mometasone furoate 0.1%+chlorocresol 0.1% moxifloxacin eye ointment 0.5% w/w 5 gm |mupirocin oint 2% saline nasal drop ondansetron 2mg/ml inj orodispersible oxytocin injection pantoprazole paracetamol drop 100mg/ml pentazocine lactate inj i.p 30 mg/ml permethrin 5% lotion phenobarbitone phytomenadione inj 1mg/1ml luliconazole + terbinafine oint potassium chloride povidone lodine ointment 5%/20 gm prednisolone sodium phosphate oral drops promethazine hcl 25mg/2ml racecadotril ip 10 mg/5ml ranitidine injection 25 mg/ml in 2ml ample ringer lactate solution for inj ip 500ml [rl] simethicone 40mg with dill oil bp 0.005ml and fennel oil 0.0007ml drop syringe dispo 1 ml [0000] dispovan syringe dispo 2 ml [000] terbutaline sulphate 1.5mg + bromhexine hcl 4mg/5ml thermometre digital thiocolchicoside injection 4mg/2ml traneximic acid inj 500mg/5ml zinc sulfate 20 mg/5 mi albendazole 400 mg tab albendazole oral liquid 200 mg/ 5 mi 10 ml bottle amoxicillin a+ clavulanic acid b 1g a + 200mg b powder for inj with diluant [00] ampicillin powder for injection 500 mg with diluant anti rabies serum equine rabies immunioglobulin 1500 iu/5 ml anti rabies vaccine 2.5 iu/dose, 1 ml amoxycilline 250mg cap azithromycin 500 mg tablet cefixime tablet 200 mg syp cefixime 50mg/ml cefixime tablet 400 mg cefotaxime powder cetrizine oral liquid 5mg/5ml chloroquine tablet 150 mg ciprofloxacin tablet 250 mg ciprofloxacin tablet 500 mg co trimoxazole [sulphamethoxazole [a]+trimethoprim [b]] oral liquid 200 ma [a]+40 ma [b1/5 mi co trimoxazole [trimethoprim [a]+ sulphamethoxazole [b]] tablet 800 ma [a] + 160 ma (bi diclofenac injection 25mg/ml in 3 ml diclofenac tablet 50 mg domperidone oral suspension 1mg/ml in 30 ml doxycycline 100mg capsule drotaverine inj. 20 mg/ml 2ml. ample furosemide inj 10 mg / mi in 2ml amp gentamicin inj. glimepiride tab 2 mg ibuprofen 200 mg tab levofloxacin tablet magnesium sulphate inj. 500 mg/ml in 2 ml. ample metoclopramide ip tab 10 mg metronidazole tablet 400 mg oral rehydration salt ip 20.5 gm per sachet pheniramine inj. 22.75 mg/ml 2ml ample ranitidine injection 25 mg/ml in 2ml ample ranitidine tab 150 mg snake venom antiserum lyophilized polyvalent powder with diluant 10 ml vial inj. sodium bicarbonate inj as per ip zinc sulphate dispersible tab ip 20 mg inj cefotaxime 1gm with diluent inj ceftriaxone 1gm with diluent inj neostigmine methyl sulphate 2.5mg/5ml size 1,chromic 1/2 circle rb heavy 40mm, 76cm size 1,chromic 1/2 circle rb heavy 45mm, 100cm size 1,chromic 1/2 circle rb heavy,40mm,152cm coared polyglactin size 1, 1/2 circle rb, 1/2 circle,40mm coared polyglactin size 1,1/2 circle rb, 1/2 circle,da 30mm acyclovirointment 3% adrenaline injection 1mg/ml 1ml. ample. albendazoleoral liquid 200 mg/5ml albendazole tablet 400mg. allopurinoltablet 100mg amiodarone amitriptyline amlodipine tablet amoxicillin capsule amoxicillin oral liquid 125 mg/5ml elastic adhisive bandage chlorohexidine gauze dressing amoxicillin (a) + clavulanic acid (b)tablet 500 mg (a) + 125 mg (b). ampicillin powder for injection ascorbic acid atenolol tablet atorvastatin tablet atropine drops 1% atropine injection 0.6mg/ml 1 ml. ample. azithromycinoral liquid 200 mg/5ml. etc.,...

Indian Army - Jharkhand

40172728 bids are invited for rescue and safety kits vein finder handhelld , emergency scissors , advance tourniquet , universal emergency medical splints , compression bandage 6 inch with closer bar and additional pad , handheld autoclavable suction device total quantity : 10...

Indian Army - Jharkhand

40172726 bids are invited for rescue and safety kits emergency compression bandage 6 inch with closer bar israeli bandage , pocket stretcher , bag valve mask , needle for pneumothorax , chest seal twin pack total quantity : 9...

Health Department - Jharkhand

39893338 rate contract for medicine at sadar hospital bokaro , drug item list , 3 ply mask , 3 8% sodium litratt 500ml , abdominal bet (large) , abdominal bet (medium) , abdominal bet (small) , absorbent cotton roll , ac kit (adult) , aceclofenac + pcm tab (100 mg+ 325 mg) , aceclofenac pcm syp (60 ml) , acetylsalicylic acid mouth dissolving tab (100 mg) , acetylsalicylic acid mouth dissolving tab (150 mg) , acetylsalicylic acid mouth dissolving tab (75 mg) , act kit (1 4 years) , act kit (5 8 years) , act kit (9 14 years) , act kit (less than 1 years) , acyclovir 5% cream (10gm) , acyclovir tab (200 mg) , acyclovir tab (400 mg) , acyclovir tab (800 mg) , adrenaline bitartrate laj (iml) 1 mg/ml , albendazole suspension (10 ml), 200 mg/5ml , albendazole tab (400 mg) , albumine (20ml bottle) , alkline phosphate (100ml bottle ) , alpha beta artither inj (2ml) , alprazolam tab (0.25 mg) , aluminium hydoxide + magnesium hydoxide tab (400 mg+ 400 mg) , ambu bag (adult) , ambu bag (paediatric) , amexicillin + clavulinic acid syp (30 ml) , amikacin sulphate inj (2ml), 100 mg/2ml , amikacin sulphate inj (2ml), 250 mg/2ml , amikacin sulphate inj (2ml), 500 mg/2ml , aminophyline inj (25 mg/ml) , amiodarone tab 100 mg , amiodarone tab 200 mg , amitriptylline tab (10 mg) , amitriptylline tab (25 mg) , amitryphylin tab (10 mg) , amitryphylin tab (25 mg) , amlodarone inj (3 ml) 50 mg/ml , amlodipine tab (10 mg) , amlodipine tab (2.5 mg) , amlodipine tab (5 mg) , amoxicillin + clavulinic acid inj (1,2gm) , amoxicillin + clavulinic acid tab (375 mg) , amoxicillin + clavulinic acid tab (625 mg) , amoxicillin 125 mg dt , amoxicillin 250 mg dt , amoxicillin capsules (250 mg) , amoxicillin capsules (500 mg) , amoxicillin drop (15 ml) , amoxicillin dry syrup (30ml)) , amoxicillin dry syrup (60ml) , amphotericin ini (20 mg) , ampicillin cap (250 mg) , ampicillin cap (500 mg) , ampicillin inj (1 gm) , ampicillin inj (250 mg) , ampicillin inj (500 mg) , anafortan ini (2ml) , anithramycin laj (500mg) , antacid syp (170ml) , antacid syp (megaldrate 400 mg + simethecone 20 mg/5ml) , anti rabbies inj (multi dose with 5 syringe) , anticold drop (10 ml) , anticold syp (60 ml) , anticold tab , anti safety lotion (1 l) , anti safety lotion (100 ml) , antispamodic drop (10 ml) (dicyclomine+ activated dimethicone) , antispasmodic syp (30 ml) (mefanamic acid+ pcm) , antispasmodic tab (dicyclomine 20 mg + pcm 325 mg) , artisunate inj (120 mg) , artisunate inj (60 mg) , artracurium inj (10 mg/ml)2.5 ml , ascorbic acid shewable tab (vitamin c 500 mg) , aso titre kit , atenolol tab (25 mg) , atenolol tab (50 mg) , atorvastatin (hypolipidemic) tab 10 mg , atorvastatin (hypolipidemic) tab 20 mg , atorvastatin (hypolipidemic) tab 5 mg , atropine inj (1ml) 0.6 mg/ml , avs inj (anti venoum snake) lyphalised , azithromycin suspension (15ml) 100mg/5ml , azithromycin suspension (15ml) 200mg/5ml , azithromycin tab (250 mg) , azithromycin tab (500 mg) , b.p blade no.10 , b.p blade no.11 , b.p blade no.12 , b.p blade no.15 , b.p blade no.20 , b.p blade no.21 , b.p blade no.22 , b.p blade no.23 , b.p blade no.24 , b.t set , baby diaper small size , baby tawels , bandage than (90 cm * 16 mtr ) 32 tpi clothes , bearathine bearyl penicillin inj (12 lakh) , benzathine benzyl penicillin inj (6 lakh) , benzyl benzonte lotion (100 ml) , betamethasone dipropionate cream (10gm) , betamethasone inj (2ml) 4 mg/ml , betamethasone tab (0.5 mg) , bethamethasone drop (10 ml) , bgem card (blood gas analyzer kit) , bio waste basket all four colours (30 ltr) , bio waste troley (set of three) , biohazard bags (red, yellow, black, blue) , birlubine direct (100ml bottle) , birlubine total (100 ml bottle) , bisacodyl tab ( 5 mg) , blood group abo & rh (3*10ml) , botropase inj (1 ml) , bp appratus mannual machine , bti (for polluted & non polluted water) , bucket plastic brand 15 ltr , budesonide nebuliser suspension (2 ml) 0.5 mg/2ml respues , bupivacine inj (20 ml) , bupived the by (heavy) (opivaccine 5mg/ deshige 80 mg/ml)(anawin negal , buprofun tab (400 mg) , bupropion tab (150 mg) , buskopan inj (20 mg/ml) , c pap , calamine lotion (100ml) , calcium carbonate + vitamin d3 tablets (250 mg) , calcium carbonate + vitamin d3 tablets (500 mg) , calcium drop (15 ml) , calcium gluconate inj (10 ml) , calcium syp. (200 ml) , cap disposable , capaia loj (1 ml) , capnia inj (2 ml) , captopril tab (25 mg) , captopril tab (50 mg) , carbamazapine syp (100 ml) 100mg/5ml , carbamazapine tab (200 mg) , carbamazepine tab (100mg) , carbamazepine tab (200mg) , carbamazepine tab (400mg) , carboprost inj (1 ml) 125 mcg/ml , carboprost inj (1 ml) 250 mcg/ml , carboxymethyle cellulose eye drop (10ml) , cardboard box for falcon tube sample collection storage , cefepime inj (1 g) , cefixime 100 mg dt , cefixime 200 mg tab , cefixime 50 mg dt , cefixime drop (15) , cefixime dry syp. (30 ml) 50 mg/5 ml , cefoperazone + salbectum inj (1000 mg + 500 mg) , cefoperazone + salbecturn inj (500 mg + 500 mg) , cefotaxime inj (1) , cefotaxime inj (125 g) , cefotaxime inj (250 g) , cefotaxime inj (500 g) , ceftriaxone inj (250 g) , ceftriaxone inj (500 g) , ceftriaxone inj vial 1g , ceftriaxone laj (125 g) , ceftriaxone salbectum inj (750 mg) , ceftriaxone+ salbectum inj (1.5g) , ceftriaxone+ salbectum inj (375 mg) , centrifuse machine , centrifuse machine fixed angle rotoe hade) (neuation technology) , cephalexin 125 mg dt , cephalexin capsules (250 mg) , cephalexin capsules (500 mg) , cetrizine 10mg tab , cetrizine syrup (30 ml) cephalexin dry syp (30ml) 125 mg/5 ml , chemic catgat with needle nol , chloramphenicol cap (250 mg) , chloramphenicol cap (500 mg) , chloramphenicol eye drop (5 ml) 0.4% , chloramphenicol inj (1gm) , chlorhexidine mouth wash (100ml) , chloroquine phosphate tab (250 mg) , chloroquine syp (60 ml) , chlorpromazine tab 100 mg , chlorthalidone tab (12.5 mg) , chlorthalidone tab (6.25 mg) , cholecalciferol cap (60000 iu)/cap , cholesterol (500 ml bottle) , chomic catgat with needle no0 , chomic catgat with needle no2 , ciprofloxacin eye drop (5 ml) , ciprofloxacin hcl 500mg+ tinidizale 600 mg tab , ciprofloxacin hel tab (250mg) , ciprofloxacin hel tab (500mg) , ciprofloxacin lv. (100 ml) 200 mg/100ml , clindamycin inj (2 ml) 300 mg/ml , clomiphene (ovulation) tab 100 mg , clomiphene (ovulation) tab 50 mg , clonazepam (0.5 mg) , clopidogrel tab (75 mg) , clotrimazole 1% cream (15gm) , clotrimazole and lidocain ear drop (10ml) , clotrimazole veginal pessary , co trimoxazole ds tab (trimethoprin 160 mg + sulphamethoxazole 800 mg) , co trimoxazole pead. tab (trimethopria 20 mg + sulphamethoxazole 100 mg) , co trimoxazole ss tab (trimethoprin 80 mg + sulphamethoxazole 400 mg) , co trimoxazole syp (wimethoprin 40 mg , cotton roll (500 gm) net , cotton thred , cotton zig zag (300 gm) net , cough drop (15 ml) , cough expectorant (100ml) , cough expectorant (60ml) , cough syp (100ml), dmr+ cpm formula , cough syp (60ml), dmr + cpm formula , cough syp (beohnchodialetor) (60ml) , cough syp (bronchodialetor) (100ml) , cough syp 100 ml codense cpm formula , cough syp 60 ml codeinae + cpm formula , covid 19 detection amphification kit ( anqstrom) , cpm tab (25mg) , creatnine (500 ml bottle) , crepe bandage 6 , crp test kit (turbi) 50ml bottle , cryo vial (himedia) , cryochill vial (1.8 ml) (tarsons) , cycloserine tab (250 mg) , deep freezer ( 20 degree) (100 ltr) (celfrost) , dengue ns 1 antigen kit , dexamethasone inj (2ml)4 mg/ml , dexamethasone tab (0.5 mg) , dextrose & sodium chloride (500 ml) (5%+0.9% w/v) (dns) , dextrose 10% tv (500 ml) , dextrose 25% iv (100 ml) 25% w/v , dextrose 5% iv (500 ml) , diazepam inj (2 ml) 5 mg/ml , diazepam tab (2 mg) , diazepam tab (5 mg) , diclofenac 100 sr tab , diclofenac oint (30) , diclofenac pain spray (55 gm) , diclofenac sodium inj (1ml) 75mg/ml , diclofenac sodium inj (3ml) 75mg/3ml , diclofenac sodium tab (50 mg) , diclofenac sodium+ pcm tab (50 mg + 325 mg) , dicyclomine hel inj (2ml) 10 mg/ml , dicyclomine tab (10 mg) , dicyclomine tab (20 mg) , di ethylcarbamazine tab (100 mg) , digoxin inj (2 ml) 250 mcg/ml , digoxin tab (0.25mg) , diltiazem sr tab 90 mg , diltiazem tab 30 mg , diltiazem tab 60 mg , diphenylhydantoin tab (100 mg) , disposable needle 18,20,22,26 , disposable syring (0.5 ml) , disposable syring with niddle( insulin ) (1ml) , disposable syring with niddle(10ml) , disposable syring with niddle(1ml) , disposable syring with niddle(20ml) , disposable syring with niddle(2ml) , disposable syring with niddle(3ml) , disposable syring with niddle(50ml) , disposable syring with niddle(5ml) , disposal gown , dnase rnase free water (himedia) , dobutamine inj. (5 ml) (1 mg/ml) , domperidone tab (10 mg) , donperadon drop (10 ml) , dooperadon syp. (30 ml) , dopamine inj (40mg/ml) , dopamine inj (5 ml) , doxycycline capsule (100 mg) , doxycycline inj (100mg) , doxylamine succinate 10mg + pyridoxine 10mg tab , dr morpean glucometer , drotaverine inj (2 ml) 20 mg/ml , drotavin tab (40 mg) , ecg / altura sound gelly (250 ml) , ecg/ultrasound jelly 250 ml , edta vial (100 pcs pkd) non vaccume tube, double cap , elastoplast bandage , electric cattle , electronic sphygnomanometer , elhamsylate tab (250 mg) , enalapril tab (10 mg) , enalapril tab (2.5 mg) , enalapril tab (5 mg) , enalaprilat inj (1 ml) 1.25/ml , enoxaparin inj (0.4 ml pre filled syringe) 40 mg/amp , enoxaparin inj (0.6 ml pre filled syringe) 60 mg/amp , enzyme syp (100 ml) , ephedrine inj (1ml) 30 mg/ml , erythromycin 125 dt , erythromycin syp (60 ml) , erythromycin tab (250 mg) , erythromycin tab (500 mg) , erythropoietin inj (4000tl) , escitalopram oxalate tab (10 mg) , escitalopram tab (10 mg) , ethambutol tab (400 mg) , ethambutol tab (800 mg) , ethamrylate inj (2 ml) 125 mg/ml , ethamsylate tab (500 mg) , ethanol 100% (himedia) , ethiophylin + theophylin inj (2 ml) , ethiophylin theophylin tab , etonidate irj (10 ml) 2 mg/ml , etoylline + theoylline tab 150 ng sr , etoylline + theoylline tab 300 mg sr , examination gloves ( all size ) , falcon tubes stand , famotidine tab (20 mg) , famotidine tab (40 mg) , feeding cup with spoon , fentanyl (2 ml) 50 mcg/ml , filter tips (qiagen) machine only 1000 ?l , fire extinguisher , five para moniter (12 screen ) with peadatric wrist probe , floride lon meter , fluconazole cap/ tab (150 mg) , fluoxetin cap (20 mg) , fluoxetine tab (2 mg) , fluphenazine inj (25 mg) , fluride vial , fluride vial (100 pcs pkd) non vaccume tube, double cap , foleys catheter (2 way) no 10 , foleys catheter (2 way) no 12 , foleys catheter (2 way) no 14 , foleys catheter (2 way) no 16 , foleys catheter (2 way) no 18 , foleys catheter (2 way) no 20 , foleys catheter (2 way) no 22 , foleys catheter (2 way) no 24 , foleys catheter (2 way) no 6 , foleys catheter (2 way) no 8 , folic acid tab (5 mg) , forcape size 6*8 , fradiomycin ointment (10 gm) , fully automated analyser cleanser chemical (100 ml) , fully digital bp machine , furosemide inj (2 ml) (10 mg/ml) , furosemide tab (40 mg) , gama benzine hci lotion (100 ml) , gauze than (90cm * 16 mtr) , gemtial violet 0.5% paint (30 ml) , gentamicin b/e drop (5ml) , gentamicin eye drop (5 ml) , gentamicin inj (100 ml) , gentamicin inj (2 ml) 10 mg/ml , gentamicin inj (2 ml) 40 mg/ml , gentamicin inj (20ml) , glass slide ( per box) 50pcs , glibenclamide tab (5 mg) , glimepride tab (1 mg) , glimepride tab (2 mg) , glimepride tab (3 mg) , glimepride tab (4 mg) , gluco meter strip of same company , gluco meter with 2 years warrenty , glucose(hypoglycaemia) inj 25% , glucose (1000 ml bottle) , glucose c or d powder (1 kg) , glucose c or d powder (100 gm) , glucose c or d powder (200 gm) , glucose c or d powder (500 gm) , glyceryl trinitrate sublingual tab (0.5 mg) , griseofulvin cap/ tab (250 mg) , gulcometer strip 25stp. (dr. morphen) , haexatrin inj , haloperidol inj , haloperidol inj (2 ml) , haloperidol tab , halothane inj (30 ml) , hand wash (standred quality)200ml , hand wash (standred quality)5 ltr. , hand wash (standred quality)500ml , haolperidol inj , hb pipette , hb tube square , hbsag kit (hepatatis b rapid test card) 1 step , hdlcholesterol (100 ml bottle ) , hemacil (500 ml) , hemoglobin meter , hemoglobin strip , heparin (5 ml) 25000iu/mi , heparin (5 ml) 5000iu/mi , hernia mesh no 10°15cms , hernia mesh no 15*15cms , hernia mesh no 6*11cms , hernia mesh no 7*15cms , hiv & syphilis combo rapid test kit , human anti d immunoglobuline (300 mcg/2ml) , human premixed insullin inj 30/70 (40 units/ml) , human premixed insullin inj 50/50 (40 mg/ml) , human soluble insulin inj (40 iu/ml) , hydrochlorothiazide tab (12.50 mg) , hydrochlorothiazide tab (25 mg) , hydrocortisone inj (100 mg) , ibuprofun syp (60 ml) , ibuprofun tab (200 mg) , ibuprofun+ pcm tab , ibuprofun+paracetamol syp (60 ml) , ieucoplast , ifa tab (l), 100 mg elemental iron + 500 mcg folic acid (red & blue) , ifatab (s), 30 mg elemental iron + 250 mcg , imipramine tab (75 mg) , immerssion oil (25 ml) , inh 300 , inj ringer lactate 500m! , inj. normal saline (sod chloride) 500ml , insulin regular (10ml) 40 ju/ml , intermediate acting (nph) insuline inj. 40 iu/ml , iron & folic acid syp (100 ml) (ferrous salt) , iron sucrose inj (2.5 ml) 50 mg/2.5 ketamine hel inj (10 ml) 10 mg/ml , isolite p (paediatric maintenance fluid) 500 ml/bottle , isoniaziazid tab (300 mg) , isopropyl rubbing alcohol (100ml bottle) 68 72% v/v , isopropyl rubbing alcohol (400ml bottle) 68 72% v/v , isopropyl rubbing alcohol (5000ml jar) 68 72% v/v , isosorbid 5 mononitrate tab (10 mg) , isosorbid 5 mononitrate tab (20 mg) , isosorbid mononitrate sr tab (30 mg) , isosorbid mononitrate sr tab (60 mg) , iv cannula ( 18 no ) , iv cannula ( 20 no ) , iv cannula ( 22 no ) , iv cannula ( 24 no ) , iv cannula ( 26 no ) , iv set , ivig inj , jsb stain 1 (500 ml) bottle , jsb stain 2 (500 ml) bottle , k95 mask , ketamine hel inj (10 ml) 50 mg/ml , lab apron , lab wash (1 ltr bottle) , labetolal tab (100 mg) , labetotal inj (2 ml) , labetotal inj (5mg/ml) , labman drybath incubator , lenezolid tab (600 mg) , leshmain stain , levetiracetam inj (5ml) 500mg/vial , levocetrizine syp (30 ml) (2.5 mg/5 ml) , levocetrizine tab (5 mg) , levofloxacin inj (500 mg) , levofloxacin iv (100 ml) , levofloxacin tab (500 mg) , levoranouemol +ipratropium brominde nesuising solution (2.5 h)41.25m 500.men)/2.1.ml , levosalbutamol nebulising solution (2.5 ml) 0.63 mg/2.5 ml , levothyroxine tab (0.05mg) , levothyroxine tab (0.1mg) , levothyroxine tab (25 mcg) , lidocaine oral gel (10 gm) , lifebusy soap 125gm , lignocaine inj (2 %) (preservative free for iv use) , lignocaine+ adrenaline inj (30 ml) , linzolid iv 300 ml (2 mg/ml) , lithium carbonate tab (300 mg) , livaocain hel inj (30 ml) 2% w/v , livenocain gelly (30gm) , lorazepam inj , lorazepam inj (2 ml) 1 mg/ml , lorazepam tab (1 mg) , lorazepam tab (2 mg) , ls instruments (80 degree) ultra low temp. freezer , ls instruments bs 2 , ls instruments leminar airflow , ls instruments pass box , ls instruments vertical auto clave (12*20) , magnesium sulphate inj 500 mg/ml , manitol 20% (100 ml) , manitol 20%, (350 ml) , mannual sphygnomanometer , maxyfloxacine eye drop (10 ml) , mct tube (1.5 ml ) (tarsons) , mct tube (2 ml ) (tarsons) , mct tube 1.5 ml /2 ml , mct tube stand , mefloquin tab (250 mg) , menadione sodium inj (0.5 ml) 1 mg/0.5 ml , mephentermine inj (10 ml) , meropenam inj (1000 mg) , meropenam inj (125 mg) , meropenam inj (250 mg) , metformin sr tab (1000 mg) , metformin sr tab (500 mg) , metformin tab (500 mg) , metformin tab (750 mg) , methenol (500 ml) , methylcobalamin tab (1500 mcg) , methylcobalamine (1500 mcg/amp) , methyldopa tab (250mg) , methyldopa tab (500mg) , methylergometrine maleate inj (1 ml) 0.2 mg/ml , metoclopramide inj (2 ml) 5 mg/ml , metoclopramide syp (30 ml) , metoprolol succinate sr tab (25 mg) , metoprolol succinate sr tab (50 mg) , metoprolol succinate tab (25 mg) , metoprolol succinate tab (50 mg) , metronidazole 1v. (100 ml) 500 mg/100ml , metronidazole syp (60 ml) 100 mg/5ml , metronidazole syp (60 ml) 200 mg/5ml , metronidazole tab 200 mg , metronidazole tab 400 mg , micro hps (100 ml) , micro hps (1000 ml) , micro pipate ( veriable) 1 5 ml , micro pipette (10 to 100 ml) , micro pipette (100 to 1000ml) , micro pipette (thermo scientific) 02 20 ?l , micro pipette (thermo scientific) 100 1000 ?l , micro pipette (thermo scientific) 20 200 ?l , micro pipette tips (20 to 200 ?l ) (himedia) , micro pipette tips 1/4 universal , micro tips 5 ml , microablumin test strip (per test) , microdrip set , midazolam inj (10 ml) 1 mg/ml , mifepristone tab (200 mg) , mini centrifuse machine (with pcr strip rotter) (neuation technology) , misoprostol tab (200 mg) , mma drag kit (mifepristone 200 mg + misoprostol 200 mg) , montelucast 10 mg tab , montelucast 5 mg tab , montelucast+levocetrizine syp (30 ml) (4 mg+2.5 mg/5 ml) , montelucast+levocetrizine tab (10 mg + 5 mg) , mosquito fogging machine model 180p , mosquito fogging machine small size , moxifloxacine tab (400 mg) , moxyfloxacine+dexamethasone eye (10 ml) , mug plastic brand 1 ltr , multichannel micro pipette (thermo scientific) , multivatimin inj (10 ml) for infusion , multivitamin cap. , multivitamin drop (15 ml) , multivitamin syp (100 ml) , multivitamin tab (as per schudle v of f&c)) , n acetyl cysteine effervisent tab (600mg) , n/10 hcl , n/2. ns (0.45% sodium chloride) (500 ml) , neomycin + bacitracin ointment 15 g (5 mg + 500 iu/g) , neonatal eye protector , neosligmine inj (5 ml) 2.5mg/5ml , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 14 mg , nicotine patch 21 mg , nicotine patch 7 mg , nitrile gloves (all size) , noradrenaline inj (2 mg/ml) , normal saline, injection, 540ml, 0.9% , nylon no 1 (76 cras) , nylon no 2 0 (76 cms) , nylon no 3 0 (76 cms) , o2 hood (all size) , ofloxacin + orinidazole tab (200+ 500 mg) , ofloxacin dt (100 mg) , ofloxacin lv. (100 ml) 200 mg/100 ml , ofloxacin syp (30 ml) , ofloxacin tab (200 mg) , ofloxacin tab (400 mg) , ofloxacin+metronidazole syp (30 ml) , ofoxacin + omidazole syp (30 ml) , olanzapine tab (10 mg) , omeprazole + domeperidon cap (20+ 10) , omeprazole cap (20 mg) , ondemoetrone drop (10 ml) , ondencetron inj (2 ml) 2mg/ml , ondencetron tab (4 mg) , oral gel nexanox , oral gel omigreal , ors powder 21.8 g (as per who formula) , ors powder pead 4.2 g (as per who formula) , oseltamarir 75 mg , oxytocin inj (1 ml) 5 iu/ml , paediatric nasal prongs (pretern 3mm, 3.5mm) , pantoprazale laj (40 mg/vial) , pantoprazole +domperidone tab/cap , pantoprazole tab (40 mg) , paper tape(size 2 inch) legth 9 mtr /pcs , paper tape (size 1 inch) legth 9 mtr /pcs , paper tape (size 1/2 inch) legth 9 mtr /pcs , para film , paracetamol drop (60ml) 100 mg/ml , paracetamol iv (100 ml) 1000 mg/100 ml , paracetamol kid dt (125 mg) , paracetamol lej (2 ml) 150 mg/ml , paracetamol sr tab (1000 mg) , paracetamol syrup (60ml) 125 mg/5ml , paracetamol syrup (60ml) 250 mg/5ml , paracetamol tab (250 mg) , paracetamol tab (500 mg) , paracetamol tab (650 mg) , parafilm 2 , pedia drip set , pentarocin inj (1 ml) , pentazocaine lactate inj (30 mg/ml) , phenermine melcate inj (2ml) 22.75mg/ml , phenobarbitone inj (2ml) (200 mg/ml) , phenobarbitone syp (100 ml) , phenobarbitone tab (30 mg). , phenobarbitone tab (60 mg). , phenytoin sodium laj (2 ml) 50 mg/ml , phytomenahione inj (1 ml) (vitamin k1) , pioglitazone tab (15 mg) , piperacillin tazobactum (1 gn+ 125 mg/vial) , piperacillin tazobactum (2 gm +250 mg/vial). , piperacillin tazobactum (4 gm+ 500 mg/vial) , plain vial (100 pcs pkd) non vaccume tube, double cap , plan catheter no 10 , plan catheter no 6 , plan catheter no 7 , plan catheter no 8 , plan catheter no 9 , plaster of paris 15 kg , plaster of paris 50 kg , polyvitamin tab , potassium chloride inj (10 ml) 15% w/v , potassium chloride tab (1500 mg) , potassium chloride tab (600 mg) , potassium chloride tab (750 mg) , povidine lodione gurple (100 ml) , povidone lodine soln. (2 litre) 5% w/v , povidone lodine soln. (500 ml) 5% w/v , povidone lodine surgical scrub (500 ml) , povidone todine oint (15m) 5% w/v , ppe kit (stendred size) , prednisolan tab (10 mg) , prednisolan tab (20 mg) , prednisolan tab (30 mg) , prednisolan tab (40 mg) , prednisolan tab (5 mg) , pregnancy rapid test card , pricking needle (per box of 100 pcs) , primaquine tab (15 mg) , primaquine tab (2.5 mg) , primaquine tab (7.5 mg) , prolene no2 0 (76 cms) , prolene nol (76 cms) , promethagin syp (60ml) 5mg/5ml , promethazime inj , promethazime inj (2 ml) 25 mg/ml , promethazime tab (25mg) , promethazine inj (50 mg) , propofol 1% (10 mg/ml) , propranolol tab 10 mg , propranolol tab 40 mg , propranolol tab 80 mg , pulse oximeter , pyrazinamide tab (500 mg) , pyrazinamide tab (750 mg) , pyrethrum extract 2% for spare spray , pyrethrum extract 2% space spary /ltr , pyridoxin (100 mg) , qiagen automated nucleic acid extraction system , qiagen pipette tips (1000 ?l) , qiagen viral rna mini kit , quinine sulphate inj (2ml) , quinine sulphate tab (300 mg) , ra test kit (turbi) 50ml bottle , rabeprazole inj (iv) 20 mg/vial , rabiprazole + domperidom tab/cap , rabiprazole tab (20 mg) , ramipril tab 2.5 mg , ramipril tab 5 mg , ranatidine syp (30 ml) , ranitidine inj (2 mi) 25 mg/ml , ranitidine tab. (150 mg) , ranitidine tab. (300 mg) , ranitidine+ donperidone tab , refrigerator 2 8 with glass self , resperidone tab 2 mg , ringer lactate inj (500 ml) as per ip , risperidone+ trihexyphenidy1 (2 mg ) , rotar adapter (qiagen) machine only , rtpcr machine (bio red cfx 96) with computer system , ryles tube no 10 , ryles tube no 12 , ryles tube no 14 , ryles tube no 16 , ryles tube no 18 , ryles tube no 20 , ryles tube no 5 , ryles tube no 6 , ryles tube no 8 , salbutamol sulphate inhalor (200 mdi) , salbutamol sulphate syp (100 ml) 2 mg/5ml , salbutamol sulphate tab (2 mg) , salbutamol sulphate tab (4 mg) , sanitany pad (deluxe)/ pkd of 7 pcs , sanitizer 100ml , sanitizer 200 ml , sanitizer 5 ltr , sanitizer 500 ml , scissors size 6*8 , sepsivac inj (0.3 ml) , sepsivac inj (0.6 ml) , sgot (500ml bottle) , sgpt (500ml bottle ) , silk no 2 0 (76 cms) , silk no 3 0 (76 cms) , silk no1 (76 cms) , silver sulfadirine oint. (250 g) , silver sulfadizine oint. (30 gm) , skin stapler , slide (50 pcs)box , sline stand (standred quality) , small dustbin , sodium bicarbonate inj (10 ml) 7.5% w/v , sodium chloride (100 ml) (3% w/v) , sodium chloride (500 ml) (0.9% w/v) , sodium chloride iv (100 ml) 0.9% w/v , sodium citrate 3.8% (500 ml) , sodium meta bisulfate (500 ml/bottle) , sodium valpourate tab (200 mg) , sodium valproate inj (100 mg/ml) , spironolactone tab 25 mg , spironolactone tab 50 mg , sprit lamp 50 ml , streptokinase inj (15 laks)/vials , streptokinase inj (7.5 laks)/vials , succinyl cholin chloride inj (50 mg/ml) , suction machine (electric) , sugar test strip , sulphamethoxazole 200 mg) , surgical cap disposable , surgical gloves 6 , surgical gloves 6.5 , surgical gloves 7 , surgical gloves 7.5 , surgical gloves 8 , suxamethonium inj (2 ml) 50 mg/ml , t.t inj (5 ml) , t.t laj (0.5 ml) , teicoplanin inj (400 mg/vail) , telmisartan tab (10mg) , telmisartan tab (20mg) , telmisartan tab (40mg) , telmisartan tab (80mg) , temephos , temphos/ltr.(polluted & non polluted water) , test tube stand (48 tubes) , tetra , thiopentone sodium inj (500 mg/vail) , three way cannula , tinidazole tab (500 mg) , tissue pepar(per box of 100 pcs) , toclinimab (400 mg) , tooth paste hydeat k 100gm , tooth paste hydent pro 10gm , tooth paste sensodent k 100gm , total protein (200ml bottle) , towel 1.5*2.0 feet , tramadol + pcm cap , tramadol cap (100 mg) , tramadol inj (2 ml) , tranexamic acid + pcm cap , tranexamic acid cap (500 mg) , tranexamic acid laj (5 mi) , triglyceride (500 ml bottle , trihexyphenidy tab (2 mg) , trihexyphenidyl tab (2 mg) , tub plastic brand 20 ltr , urea (500 ml bottle) , uric acid kit (200ml) bottle , urin bag (adult) , urin bag (pead.) , urine strip(10 parametor )per bottle of 100 test , urine strip(2 parametor )per bottle of 100 test , urine strip(4 parametor )per bottle of 100 test , v.d.r.l (syphiline rapid test card) , vancomycin inj (1000 mg) , vancomycin inj (500 mg) , vancorium inj (4 mg/2ml) , vantilator (neonatal) , vasopresain inj (1 ml) 5 mg/ml , vecuronium inj (2 ml) 4mg/amp , vencomycil (1000 mg/vail) , vencomycil (500 mg/vail) , verapamil tab (40 mg) , verapamil tab (80 mg) , vickryl no 0 (90 cms) , vickryl no 1 (90 cms) , vickryl no 1 with 180 cms (doubble niddle) , vickryl no 2 0 (90 cms) , vitamin a cap (200000 iu) , vitamin a syp (100000 iu/ml) , vitamin a&d cap (vit a 5000 iu vit. d3 400 iu/cap). , vitamin b complex , vitamin b 12 , vitamin b complex syp (100 ml) , vitamin d3 satchet (1 gma) , vortex mixture machine (neuation) , vtm stand (tarsons) , w.b.c diluting fluid (500 ml/ bottle) , waiting chair (3 in 1) (stainless steel) , wash bottle (500 ml bottle) , water bath (remi) , wax dissolvent ear drop (10ml) , weighing machine (digital) , weighing machine (mannual) , widal kit (10*4 ml) , x ray film 10*12(green) 50 pc/pkt , x ray film 12*15(green) 50 pc/pkt , x ray film 8*10(green) 50 pc/pkt , x ray film dental (green) 150 pc/pkt , zeeper bag (plastic)/kg , zinc tab (20 mg) , zinc tab (50 mg) , zolpidem tab (10 mg)...

Animal Husbandry And Veterinary Department - Jharkhand

39825756 supply for veterinary medicines and others veterinary medicine, feed supplements and chemicals , medicine : , ciprofloxacin , ciprofloxacin , ciprofloxacintinidazole (1.5gm + 1.8 gm) , ciprofloxacintinidazole (250mg + 300mg) , enrofloxacin 10% (100mg/ml) , enrofloxacin 10% (100mg/ml) , enrofloxacin 20% (la) , enrofloxacin (150 mg) , enrofloxacin 10% , gentamicin (40mg/ml) , gentamicin (40mg/ml) , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone , ceftriaxone + tazobactum (500mg+62.5mg) , ceftriaxone + tazobactum(3gm+375mg) , ceftriaxone + tazobactum (4gm+500mg) , amikacin 250mg/ml , amikacin 250mg/ml , oxytetracycline inj (50 mg/ml) , oxytetracycline inj (50 mg/ml) , oxytetracycline inj 200 mg/ml (la) , oxytetracycline inj 200 mg/ml (la) , tetracycline hydrochloride bolus (500mg/1gm) , tetracycline hydrochloride powder (50mg tetracycline/gm) , amoxycillin + cloxacillin (1.5gm + 1.5gm) , amoxycillin + cloxacillin (250 mg + 250 mg) , chlorpheniramine maleate (10mg/ml) , chlorpheniramine maleate (10mg/ml) , meloxicam (5mg/ml) , meloxicam (5mg/ml) , meloxicam paracetamol (10mg + 150mg) , meloxicam paracetamol (10mg + 150mg) , meloxicam paracetamol (100mg + 1500mg) , tolfenamic acid (40mg/ml) , dexamethasone inj (4mg/ml) , isofluperidone inj (2mg/ml) , dicyclomin hcl 2% , flunixin meglumine (equiv. to 50mg/ml) , tranexamic acid (each ml containstranexamic acid 100mg) , antiseptic cream , antiseptic lotion , antiseptic lotion , antiseptic lotion , ivermectin (ivermectin 1% w/v) , ivermectin (ivermectin 1% w/v) , iron preperations contains ferrous fumarate 1500mg, vitamin b12 75mcg, folic acid 7500mcg , atropine sulphate 1% , atropine sulphate 1% , albendazole tab (each tab contains 150 mg) , albendazole bolus (each bolus contains 1.5 gm) , albendazole bolus (each tab contains 3 gm) , albendazole liquid 2.5% w/v , albendazole liquid 2.5% w/v , fenbendazole tab (each tab contains 150 mg) , fenbendazole bolus (each bolus contains 1.5 gm) , fenbendazole bolus (each tab contains 3 gm) , ivermectin (la) (5mg/ml) , ivermectin (la) (5mg/ml) , oxyclozanide liquid + levamisole 6%/ml , iron preparations each ml contains iron sorbitol citric acid (iron contains 50mg, folic acid 500mcg, hydroxy cobalamine 500mcg) , butophosphane with b12 (butophosphane 100mg/ml, vitamin b12 500mg/ml) , butophosphane with b12 (butophosphane 100mg/ml, vitamin b12 500mg/ml) , diminazine diaceturate rtu (70mg/ml) with phenothiazone (375mg/ml) per vial , buparvaqunone (50mg/ml) , isometamedium chloride (250mg/ml) , qunapyramine sulphate 1.5gm and qunapyraminechloride 1gm per vial , xylocane 2% , sulfadimidine bolus (each bolus 5gm) , streptomicin+penicillin inj (procaine penicillin g15 lac + penicillin g sodium 5 lac + streptomycin sulphate 2.5gm) per vial , infusions (fluids and electrolytes) : , calcium and magnesium borogluconate inj, for intravenous use (calcium borogluconate 25%w/v, magnesium hypophosphite 5% w/v, dextrose anhydrous 20% w/v) , electrolyte infusion (dextrose 20gm+sodium chloride 0.6gm+potasium chloride 0.04 gm, calcium chloride dihydrate 0.027gm+sodium lactate 0.312 gm) per 100 ml , feed additives and others : , ecobolic , ecobolic , multivitamin (containing b1+b2+b6+b12) , multivitamin (containing a+d3+e+k) , multivitamin + liverextract , herbal wound spray , wound ointment , wound ointment , mineral mixture (containing vitamin a, d3, e, nicotinamide, cobalt, copper, iodine, sodium, sulphur, zinc, calcium and phosphorus) , mineral mixture (containing vitamin a, d3, e, nicotinamide, cobalt, copper, iodine, sodium, sulphur, zinc, calcium and phosphorus) , calcium (1700mg), phosphorous (850mg) vitamine d3 (8000 i.u) and vitamin b12 (100mcg) minerals and vitamin oral suspension , indigenous & herbal drug : , antidiarrhoeal powder , antidiarrhoeal powder , stress reliver liquid , stomachic powder , antringent powder , expectorant powder , liver tonic , estrous inducer cap , uterine cleanser , uterine cleanser , antimaggot/anti bacterial comprehensive topical spray , galactogogues , antizymotic liquid , anti inflammatory spray for mastitis , anti inflammatory ointment for mastitis , anti inflammatory ointment for mastitis , rumenotoric bolus , hormones : , hydroxy progesterone caproate (250mg/ml) , cloprostenol sodium (263 mcg/ml) , chemicals : , phenyl (black) , phenyl (white) , povidine iodine 10% w/v , magnesium sulphate (mg so4) , potassium iodide (vi) , sodium bi carbonate (nahco3) , pottassium permagnate (kmno4) , hydrogen preoxide (h2o2) , hydrogen preoxide (h2o2) , tincture iodine/benzoin etc. , tincture iodine/benzoin etc. , bandage , bandage , cotton , plaster of paris etc...

Ministry Of Statistics And Programme Implementation - Jharkhand

39820818 bids are invited for boq for procurement of medicines esofine dsr , telmet 40mg , dolo 650mg , dvn plus , cifran oz , azee 250mg , ondem md , zerodol p , dolo 500mg , ors , savlon 100ml , bandage 4 inch , bandaid , cotton 100gm total quantity : 117...

Indian Army - Jharkhand

39768603 proposal for procurement of drugs and consumables proposal for procurement of drugs and consumables , ibuprofen syrup 100 mg / 5m1 bott of 50 ml , pheniramine maleate inj 22.75 mg per ml amp of 2ml , antiseptic mouth wash containing sodium fluoride & triclosan bott of 100 150ml , chlorhexidine mouth wash 0.12% sugar and alcohol free bottle of 450 500 ml in amber coloured bottle , mupirocin 2% oint tube of 5 gm , chlorhexidine solution containing chlorhexidine gluconate bp 7.5% v / v cetrimide bp 15% w / v 500 ml bott ( savlon ) , cap dicyclomine 10mg , clotrimazole vaginal pessary 100mg , povidone iodine 200 mg pessary , tobramycin 0.3% bott of 5 ml , cypropheptadine hci 2 mg / 5ml bott of 100 ml , syringe disposable, plastic, sterile, 2 ml with needle , insulin disposable syringe 1ml , vaccum blood collection tubes with needles : sterile tube with out gel 5ml , lumbo sacral belt ( xxl ) , adhesive plaster tape 3 inches box of 4 microfoam , adhesive plaster tape 4 inches box of 3 microfoam , bandage elastic adhesive, 6 cm x 3 metres unstretched and 5 6 metres when stretched. , bandage open wove uncompressed 6 cm x 4 metres , bandage open wove uncompressed 10 cm x 4 metres , dressing medicated gauze paraffin, of 24 10 cm x 10 cm, tin , gauze surgical, open wove, unmedicated: 60 cm x 3 metres packet , calcium test kit ( mono vials 25test ) , cervical collar ( size m ) , cervical collar ( size l ) , glucose powder , lumbo sacral belt ( xl ) , suppository bisacodyl , tab cough lozenges ( dextromethorphan hydrobromide ) , tab doxofyll 400mg + ambroxol 30mg , tab thyroxin sodium 62.5mcg , tab thyroxin sodium 88mcg , tab verapamil 40mg , methyl alcohol jar of 2.5 ltr , ra factor ( kit of 25 test ) , deionized water 5 ltr jar , tacrolimus 0.1% ( w / w cream 10 gm , syp drotaverine 10mg , tab amifru 40 ( fusemide 40 + amiloride 5mg ) , urocolor 10 ( test strips for urinalysis ) , tab macvestin 500mg , oint lidocaine ( 1.5% w / w ) + nifedipine ( 0.3% w / w ) , anklet , insulin pen needle , ecg roll ( 50mm x 20 mts ) pack of 5 rolls , chloride test kit ( true chemie ) , capillary tube ( for clotting time test ) , kit potassium ( mono vails ) , paper roll elisa reader , paper roll ( pos 5725 ) , for semi auto analyzer...

Indian Army - Jharkhand

39635322 bids are invited for adhesive plaster zinc oxide , adhesive plaster micro porus tape , adhesive plaster micro porous tape , bandage open woven , lint absorbent , suspensory bandage , diclofenc gel , framycetin tube total quantity : 2172...

Health Department - Jharkhand

39485354 supply for office stationery, equipments etc. , items names : , executive chair , revolving chair , study chair , office table , almirah ( for office use ) , glass almirah , journal rack , computer table , dinning table set ( 1 table + 6 chairs ) , dinning table , lab table , examination table , stool steel chair , bed side locker , single bed ( for hostel ) ( double decker ) , almirah , chair , table , needleholder : , 6 , 7 , 8 , suture cuttingscissors , sutureneedle : , straight , curved , mackintosh roll : , full bed length ( qtyin meters ) , draw mackintosh , extra for treatment and dressing , hot water bag , ice caps , ice collar , corrugated rubber sheet , gloves different sizes , catheters : , urinary catheters , foleys catheters , nasal catheters , plain catheters , rectal catheters , finger stalls different sizes ( set ) , air rings , mucus sucker , breast pump , nipple shield , gastric lavage tube , ryles tube , flatus tube , blakemore sange staken tube , rubber tubes with different diameter and size , rectale syringe with nozzle , ring pressories each size , douche nozzle different sizes , mortar and pestle , nelsons inhaler , spirit lamp , test tube stand , test tube holder ( in dozen ) , sterilizer small , portable autoclave , weighing scales , adult weighing scale , baby weighing scale , back rest , splints different sizes , i. v .stand , microscopes , sphygmomanometer ( mercury ) , a regular ( dial ) , b electronic ( digital ) , stethoscope , over bed table ( cardiac table ) , screens / bed side curtains , three way adapter , mattress: , adult , child , mattress cover: , adult , child , bed sheets , baby cot sheets , draw sheets , sandbags with covers , sponge cloth , hot water bag covers , ice cap covers , air ring / cushion covers , gowns masks , patient s clothes: , male ( set ) , female ( set ) , baby dresses of different sizes ( set ) , diapers different sizes ( set ) , trolley cover , dirty linen bag / box , leggings ( pair ) , perineal sheets , triangular bandages , many tailed bandages , eye shields , dusters , slings , t binder , screen curtains ( set ) , adult human articulated skekelton with hanging facility in a glass cupboard with locking facility. , full set of dis articulated human skeleton. , full size human body showing all muscles and articals , human torso : , male , female , skin cross section , heart and large blood vessels , heart with detachable parts on a stand , eye with different sections , ear with different sections , human brain with spinal cord , lungs and trachea , larynx , digestive system: , stomach , female reproductive system: , uterus on stand , male reproductive system , urinary system: , kidney: , joints and ligaments: , wrist , elbow , shoulder , ankle , knee , hip , teeth , skeleton system , muscular system: , showing different muscles of the body , joints and ligaments: , nervous system: , brain , cardio vascular system , respiratory system , lungs , trachea , larynx , digestive system , oral cavity , teeth , stomach pancreas and spleen , small intestine , large intestine , liver and gallbladder , kidney macroscopic structure , skin , eye , ear , female reproductive system , menstrual cycle , male reproductive system , endocrine glands , first aid for burns , cardiac pulmonary resuscitation: , adult , children , infant , first aid charts or emergencies such as fracture, drowning, wounds, poisoning, bites ( each ) , stages of development of embryo ( set ) , female bony pelvis , foetal skull , female dummy ( zoe model ) / obstetrical training with doll , placenta , full size fetus , new born baby , baby cradle , breast changes in pregnancy , uterine changes in pregnancy showing height of uterus at different terms of pregnancy , stages of labour , first stage , second stage , third stage , breech presentation , complete breech , incomplete breech , foot presentation , shoulder presentation , face presentation , brow presentation , twin pregnancy , placenta previa different stages , caput succedaneum, cephalhaematoma , congenital malformation of new born: , cleft lip palate , spina bifida , hydrocephalus , anencephalus , all in one computer set , laptop , xerox machine , color printer , air conditioner , lcd projecter , lcd screen , over head projecter , community health nursing for anm , community health nursing for anm ( hindi ) , health worker keliyepathyapustak , community health nursing ( samudayikswasthvigyan ) ( hindi ) , nursing manual of nutrition and therapeutic diet , essentials community health nursing in hindi , where there is no doctor a village health care handbook , where there is no doctor hindi , mecical surgical nursing , fundamentals of nursing , principal & practice of nursing , health promotion for anm , aaharavumposhan , text book of anatomy & physiology for nurses , anatomy & physiology anotomy and physiology for nurses ( sharirrachanavigyanevamsharirkriyavigyankewalnursonke live ) ( hindi ) , prathamiksahayataevamsankatkalindekhbbal ( hindi ) first aid and emergency care , manual of first aid ( prathamikupcharka manual ) ( hindi ) , health promotion , nurse keliyemanovigyanavumswasthya , psychiatric meantal health nursing , text book of microbiology for nurses , sukhamjivvigyankipathyapustak ( text book for microbiology for nurses ) ( hindi ) , primary health care nursing for anm , psychology and sociology for anm and bt students , nursing arts proceduces ( nursing kemoolsidhanth ) valume i ( hindi ) , fundamentals of nursing ( hindi ) , senior nursing procedure ( nursing kemoolsidhant volume ii ( hindi ) , sociology for nurses , pharmacology for nurses , medicine kipathyapustak , baal swasthya nursing for anm , child health nursing for anm ( hindi ) , quick look nursing pathophysiology , comprehensive manual of pediatric nursing procedures , pediatric nursing , english for nursing , textbook of computer in nursing , textbook of obstetrics , midwifery & gynecological nursing ( hindi ) , maternal & neonatal nursing care plans , midwifery for anm , midwifery and gynecological , nursing ( hindi ) , manual of midwifery procedures , pedicatric nursing care plans , cumulative record for general nursing midwifery course , health centre management , imnci module for basic health worker , chart booklet , simplified partograth ( big size ) , family planning , journal of midwifery, women health &gynaecological nursing. , journal of community & social health nursing , patient cots adult , child , bed side locker , revolving stools / chair , manikins for demonstrating nursing procedure: , adult male imported , adult female , child manikin , new born , cpr ( full body ) , trays different sizes: , 24x16 , 14x10 , 11x9 , 8x5 , trays with cover assorted sizes , bowls: , 16diameter , 10diameter , 4diameter , 2 3diameter , bowls with cover , 6diameter , 4diameter , enema can , 1 1t. capacity , 1 / 2 1t. capacity , kidney trays of assorted sizes ( big ) , measuring jugs , 1000 ml. , 500 ml. , 250 ml. , assorted size basins , catheter dish with cover , knife dish with cover , feeding cups , douche can , sputum mugs , bed pans , urinals male , funnel: , 4diameter , 2diameter , jars with covers: , 12x8 , 6x4 , dressing drums: , 8x4 , 12x9 , tub for sitz bath , saucepan with lid: , 1 1t. capacity , 2 1t. capacity , kettle: , 1 1t. capacity , 2 1t. capacity , trolleys with upper and lower shelves ( without steel top ) , pint measure , gallipots , mugs , bottle brush , cheatle forceps , sponge holding forceps , artery clamps: , straight 6 , curved6 , dissecting forceps: , toothed , non toothed , mosquito forceps , kocher’s , scissors: , surgical 8 , bandage , mayos cutting scissors , tissue forceps , sinus forceps , biopsy forceps , liver biopsy needle , alice forceps , probe , groove director with probe , mouth gag , tongue depressor , tongue holding forceps , nasal speculum , aural speculum , re tractors: , single hook , double hook , bladder sound , male urethral dilator ( set ) , packing forceps: , nasal , oral , ear irrigation syringe , ear speculum , shaving set , safety razor with blades , bard parker knife handle , surgical blades different sizes set ) , catheters , airway , laryngoscope: , paediatric , adult , proctoscope , infusion set , autoscope , ophthalmoscope , tracheostomy set with various size of tracheal tubes ( set ) , head mirror , tanning fork , oxygen cylinder with stand , oxygen mask , measuring cups: , 240ml. , 120 ml. , 30 ml. , undine , eyebath cup , pipettes & droppers , glass connection: different types e.g. y.t.l. ( each ) , wolfs bottle , conical flasks , ounce glass , dram glass , thermometers : , oral , rectal , bath , room , lotion , pulse meter , urinometer , lactometer , heamoglobinometer , specimen glasses , test tubes ( dozen ) , glass slides with cover ( box ) , bottels500 ml. capacity for lotion and mixtures , automizer , manometer , glucometer , head mirror , tuberculin syringe , insulin syringe with needle , needle all sizes ( one dozen each ) , lumbar puncture needle , trochar, cannula for abdominal paracentesis , i.v. cannula different type sand sizes , biopsy needle : , adult , children...

Health Department - Jharkhand

39468446 supply for materials supply for materials and medical equipments , equipments name: , hospital seat bed , semi flower bed with ms side rail , flower bed with ms side rail , hospital i.c.u bed , hospital bed matress , hospital pellow , hospital sline stend , hospital bed side locker , hospital 3 fold screen , hospital strecture on trolly , pediatric bed , pediatric flower bed , ecg machine computerized , ventilators ( adult ) , pulse oxymeter , a.c1.5 ton 5 star with fitting , a.c 2ton 5 star with fitting , stabilizer automatic for ac double phase 5 kva , stabilizer automatic for ac double phase 3 kva , b.p apparatus stand model (isi mark) , stehoscope (isi mark ) , thermometer ( isi mark) , ecg paper roll cardiart gen x 3 cardiart 6208 view , suction machine , foetal doppler ( pocket doppler ) , foetal doppler ( tabple top ) , r o water machine , autocalve double drum , kidney tray big , curve kocher clamp , iv set ( adult ) , uro bag , sanitary pads , focus light , plastic apron , shoe cover , disposable cap , rubber sheet , eb x49 xga projector brightness: 3600lm with hdmi port (optional wi fi) , dustbin with lid 30 ltr. , hub cutters ( mannual ) , hub cutters ( electric ) , water container ( steel 20 ltr) , stools for immunization room (steel ) , torch light 4 cell , air rotor , bed pan (ss) , coolers big (isi mark) , table cloth , double door 308 litres 5 star refrigerator , 205 l direct cool single door 5 star refrigerator , chromic catgut 1/0no , chromic catgut 2/0no , chromic catgut 3/0 no , shadoless cellar light led , mersilk 1/0 no , mersilk 2/0 no , surgical instrument set , foelys cather 14 no , foelys cather 8 no , foelys cather 10 no , foelys cather 16 no , foelys cather 18 no , disposable syringe 3 ml , disposable syringe 10ml , disposable syringe 5 ml , disposable syringe 20 ml , b.p blade ( 15 no. ) , b.p blade ( 20 no. ) , b.p blade ( 22 no. ) , spinal needle 25 no , skin hook single , skin hook double , foreign body remover , foreign body extractor , needle holder ( big) 9’’ , needle holder ( small ) 6’’ , tooth forceps , plainforceps , scissors mayo’s ( 7’’ & 9’’) , scissors ( suture cutting ( 7’’ & 9’’) ) , b.p handle no 3 , b.p handle no 4 , surgical spirit 500 ml , scissors 8’’ , pen elkos first , handi palast ( round ) , lifter , intrument sterliser ( electric ) small , intrument sterliser ( electric ) medium , intrument sterliser ( electric ) large , arteriforcep medium straight , arteriforcep medium curve , arteriforcep large , elices forceps , niddle holder 8’’ , abdominal retracter small , abdominal retracter medium , abdominal retracter large , doins retracter , bone lever small , bone lever large , bone holdinyforcep small , bone holder forcep large , periostium elevator , pop 50 kg drum , towel clip , k wire1 , k wire1.5 , k wire2 , ss – wire 20 , ss – wire 22 , ss – wire 24 , k – nail all size , v – nail , sq – nail , cotton roll 400gm nett. , cotton roll 100gm nett. , kit kath 16 no , kit kath 18 no , kit kath 20 no , kit kath 22 no , kit kath 24 no , bandage 6 inch , bandage 4 inch , gauze than , green cloth , cotton bed sheet , blanket ( 4x 6 )2.5 kg , blanket ( 4x 6 )3 kg , carpet ( dari )( 30/ 30) , bp instrument electronic chargeable , glucose meter (isi mark) , hemoglobin test machine , stethoscope (isi mark) , thermometer genral , x ray view box large size , pulse oximeter , blood bag ( singal ) hl , hiv rapid card aspen , hbsag papid card aspen , hcv rapid card aspen , para hit total (mp) , r.p.r test card aspen , r.p.r test strip aspen , blood group kit (abd) arkary , anti ab arkray , anti human globulin arkray , 22% bovine albumin arkray , hiv elisa kit , hbsag elisa kit , hcvelisa kit , hiv rapid card retroquik , hbsag rapid card hepaview , hcv rapid flaviscreen , refrigerator digital thermometer , blood bag collection monitor , glass slide blue star , distilled wateer , sodium hypochlorite solution. , khan/khans test tube borosil , copper sulphate crystal , lancetblood , dobule cap e.d.t.a tube , khan/khans test tube stand 60 hole plastic , colorimeter , digital weight machine baby , digital adult weight machine , b.p machine ( mercury ) , elisa processor transasia elan 30 s , pumping ball/smiley ball , electric insects killer , elisa reader , elisa washer , autoclave electric vertical( pressur & temp display) , blood bag tube sealer , drabkins reagent , measuring cylinder 50ml , hydrometer ( specific gravity ) , pippet stand , cuvette ( for colorimeter) , needle destroyer ( electric ) , blood bag storage refrigerator , blood bag storage refrigerator thermofisher 650 ltr. , hydrogen peroxide 500 ml , hydrogen peroxide 100 ml , ec( 500 ml ) , stirrup pump ( ddt spray machine ) , cotton roll 25 gm nett. , cotton rol l 50 gm nett. , cotton roll 200 gm nett. , cotton roll 400 gm nett. , crepe bandage 6’’ , crepe bandage 4’’ , office table t9with two drawer , examination table , office table t104( three drawer ) , office table t8both side drawer , patient stool revolvingtable , impres table 1800mm , premium visitor chair with full arm , chair ch7b , laseda high back chair , sedna high back chair , bandage 6 , bandage 4 , revolving chair with arm , barvo high back chair , computer table c3d , strowel plain (almira 20 gauge )7’’/3.5’’ , strowel plain (almira 20 gauge )4’’/3.5’’ , steel rack 6’’/3’’ ( 5 rack ) , mattrics 3 seeter chair with arm , mosquito net small , mosquito net medium , mosquito net large , xerox machine (mp 2014) , didital ups eb 1650 ah inverter with inva tubular battery 220 ah , computer i3/11 gen/ 8 gb ram / 512 gb ssd rom/ windows 11/20” display/web came , • printers • laser printer • m438nda laserjet a3 monochrome all in one printer with network, duplex & adf , scannerlide 120 , coolers big ( isi mark ) , pillows covers , pillows , wire cutter , digital x ray machine 100ma , pen drive 32gb(hp) , pen drive 16gb(hp) , floor duster with handle , plastic chiar , epson ecotank m3170 wi fi all in one monochrome ink tank printer ith adf & duplex , computer table , office table size 4ft x 2.5ft double drawers , office table size 3ft x 2ft single drawers , laptop core i5 12th gen. 8gb ram, 1tb/ssd hard disk/ 2gb graphics, windos 11 , 3.8% sodium citrate solution 500 ml , abo & rh(anti ab&d) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent gauze than 18 m x 90 cm special , adenosine , airway 0 no. , airway 1 no. , airway 2 no. , airway 3 no. , airway 4 no. , ambu bag adult , ambu bag pediatric , ambu bag neonatal , apron , aso latex (span) (20 pcs) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , baby cap , baby dress , baby socks , baby tag , barium chlorine 500 ml , bendicts solution 500 ml , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blood bag350 ml , blood bag 100 ml , botroclot 10ml , bovine albumin 22% (5 ml) , bt set , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 24 no , cannula 26 no , capillary tube , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , cleansole , color coded bins black 20 litre , color coded bins black 40 litre , color coded bins black 60 litre , color coded bins black 80 litre , color coded bins blue 20 litre , color coded bins blue 40 litre , color coded bins blue 60 litre , color coded bins blue 80 litre , color coded bins red 20 litre , color coded bins red 40 litre , color coded bins red 60 litre , color coded bins red 80 litre , color coded bins yellow 20 litre , color coded bins yellow 40 litre , color coded bins yellow 60 litre , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , lam/i gel 01234 , lancet (100 pcs) , leishmans stain (500 ml) , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malaria pf/pv antibody card rapid test (50 kits) , malaria pf/pv antigen card rapid test (30 kits) , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , memantine , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micropore 1 inch , micropore 1/2 , micropore 2 , mucus sucker , iron bed , mattress 3x6 , foot step , dustbin plan , hydraulic bed , bucket , bed side screen , test tube (khan tube) , test tube (khan tube) 2.5 3 ml , test tube (khan tube) 3 4ml , test tube holding clamp , test tube rack , thiopentone , thrombophob ointment , tissue paper roll , tourniquet , color coded bins yellow 80 litre , cord clamp , cotton roll 400gm nett , cotton thread , cover glass (100 pcs) , cpr (latex) (20 pcs) , creatinine(creast) (35 pcs) , crescent blade disposable , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1ltr , distilled water 5ltr , donepezil , duolin respules , ec (700 ml) (agrawal) , ecg jelly , edta vial , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , enoxaparin , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , g.v. paint lotion 400ml , glacial acetic acid (500 ml) , glass slide (100 pcs) , gloass rod , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer strip , glucometer (ozocheck) , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hbsag card rapid test kit (50 pcs) , hcv rapid (30 kits) , heavy duty gloves , hiv card rapid test (50 kits) , nasal prongs (neonats) (cannula) , needle straight , new born diaper , oxygen mask adult , oxygen mask child , paraffin mesh , pedia set , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial , pottasium permagnate (400gm) , povidone iodine lotion 500ml , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pyrethrum extract 2% , rhyles tube16 no. , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , saline set , shoe cover disposable , side port disposable , slide dying rack , sodium calcium hypochloride (5 litre) , spirit 100 ml , spirit 1000 ml , spirit (methylated) 1000ml , sprit lamp , stritching thread , suction catheter , suction tube6fr , suction tube 8 fr , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , uro bag , vdrl (strip) , vdrl (syphilis) card rapid test (100pcs) , vdrl rapid card , vdrl rapid latex , vicryl(1 0) , vicryl1no , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl (2 0) , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , yellow tips for micropipette , temophos 25 ltr , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , swab , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , towel (24x18) , plastic mug 1 ltr , plastic bucket 20 ltr , anteseptic soap 75 gm , plastic sputum container with sticker , lence paper , potasium per magnate , zipper pouch , falcun tube , oxygen regulator with flow meter , non chlorinated biohazard bags black size 80kg , non chlorinated biohazard bags blue size 80kg , non chlorinated biohazard bags red size 80kg , non chlorinated biohazard bags yellow size 80kg , non chlorinated biohazard bags black size 2litre , non chlorinated biohazard bags red size 2litre , non chlorinated biohazard bags black size 40kg , non chlorinated biohazard bags blue size 40kg , non chlorinated biohazard bags red size 40kg , non chlorinated biohazard bags yellow size 40kg , hemogllobin test kit , hemogllobin test strips , lancet , glucometer , glucometer strips rate per pc , urine strips , hiv and syphilis test kit , hiv test kit , syphilis test kit , sickle cell rapid test kit , iodine test kit , hbsag test kit , filariasis test kit , malaria test kit , sanitary pad , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , oxygen cylinder small , oxygen cylinder medium , oxygen cylinder large , tubular battery 220 ah , ambu bag , eletric automatic unicron demmart star dental chair , dental x ray machine , vatech rvg sensor , desktop & color printer , dentail air compresor , auto clave , ultrasonic scalerhand pic walldent , waldent digital glass bed sterlizer , gdc extraction forcep kit set of 12 , gdc root elevator set kit10 , local anesthesia with aderenaline , dental micro moter with straight contra hand pic , walldent pro dental set 15 , mask , waldent dental lead appron , dental patient drape , gdc surgical curettee 3 (186) , air rotor handpic 2 lead (nsk) dyna , type 1 glass ionomer restorative , type 2 glass iconomer restrative , waldent composite kit , ewaldent eco plus light curring unity 2 , waldent endomeeter hand pic esw 2 , super endogald hand portopear file ( pack og of ) , waldeent flexgald rotry file 21 mm 25 mm , waldeent h hand file gald rotry 21 mm 25 mm , waldent e dta gutta percha paint 6% , waldent seal pexrin baid roat camal sealing matrial , raund barrel , stat barrel , farama cresal , calsium hydroxide podear 10 , saliva ejector , un chamber with 12 tray , gownpreparatior kit , endo2 bur , flish box , dj 16 , k hhand file , k file 6 to 15 , k file 8 to 15 , micro tourch & gas , skin mirar , mouth mirror , dental probe , dental twerer , dental cement carrier , steel visitor chair , transmittance / absorbance photometry based digital haemoglobinometer with auto / self calibration (no manual code / chip insertion) and 0 25gm/dl , strips / cuvette compatible with above digital haemoglobinometer , fad gdh enzyme based glucometer strips (1 glucometer free on 1,000 strips) , boronate affinity chromatography method based hba1c glycated haemoglobin analyzer with inbuilt bluetooth for wireless data transfer, in built rechargeable battery and weight less than 100g , strips compatible with above hba1c glycated haemoglobin analyzer , reflectance photometry based lipid analyzer for measuring tc, hdl, tg, ldl & tc / hdl ratio and inbuilt bluetooth for wireless data transfer , strips compatible with above lipid analyzer , auto disable / safety lancet (28g) with ec declaration of conformity / usfda & iso 13485:2016 , nt probnp rapid card , vitamin d rapid card , troponin i rapid card , troponin t rapid card , point of care device for hemoglobinopathies (sickle cell &? thalassemia) testing , point of care rapid test kit for sickle cell anaemia and beta thalassemia screening compatible with above device , portable automated abrneonatal hearing screeningdevice : based onbrainstem evoked response audiometry (bera) method batteryoperated device high sensitivity and specificity (more than 97%) test time: less than 5 minutes usb port and wi fi enabled non invasive and easy to use easy interpretable report: pass, refer and redo as the result validated and recommended by icmr (indian council of medical research) & department of health research (dhr) ministry of health,government of india...

Health Department - Jharkhand

39466638 supply for medicine , medicine name , cap. amoxyclilline 250 mg , cap. omeprazole20mg , cap. ampicillin 500 , cap. amoxcline 500 mg , cap. dapin 10mg , cap. dapin 5 mg , cap. amoxcyclline 500mg+ cloxacline500mg , cap.multivitamin , cap. amoxycilline ( 250 mg ) + cloxacilline ( 250mg ) , cap. ampicilline 500mg , cap. cefalamine ( 250 mg ) , cap. cephalamine ( 500 mg ) , cap. cephalexin 250 mg , cap. cephalexine ( 250 mg ) , cap. cephalexine ( 500mg ) , cap. cholicalciferol 2000iu , cap. cholicalciferol 30000iu , cap. cloxacillin 250 mg , cap. cloxacillin 500mg , cap. depin ( 10 mg ) , cap. depin ( 5 mg ) , cap. doxycycline ( 100 mg ) , cap. griseofulvin 250mg , cap. omeprazole ( 10mg ) , cap. omeprazole ( 20mg ) , cap. vitamin a 200000 iu , cap.omeprazole20 mg , cap.pantoprazole + donperidone , tab. ciprofloxacine 250mg , tab. diclofenac sodium 75 mg , tab. drotaverine 40mg , tab. etophylline + theophylline 150mg sr , tab. ibuprofen 200mg , tab. ofloxacin 200 mg , tab. ofloxacin + orindazole , tab. vitamin b complex , tab. pcm 500mg , tab. pcm 650 mg , tab. amoxycilline + clavulanic acid 375 mg , tab. cefixime 500 mg , tab. azithromycine 250 mg , tab. azithromycine 500 mg , tab. meteronidazole 200 mg , tab. meteronidazole 400 mg , tab. co trimoxazole ss tablets 80 / 400mg , tab. co trimoxazole ds 800mg / 160mg tablet , tab. ciprofloxacin250 mg , tab. ciprofloxacin 500 mg , tab. ranitidine + domporidom 150mg , tab. aceelofanac 100 mg + pcm 325mg , tab. ranitidine + domporidom 300 mg , tab. fluconazole 150 mg , tab. fluconazole 400 mg , tab. glimepiride 2 mg , tab. levocetrizine 5mg , tab. misoprost 200mg , tab. carbamazepine 200mg , tab. clomipramina 25 mg , tab. clonazepam0.5mg , tab. haloperidol 5mg , tab. olanzapine 7.5mg , tab. fluoxetine 10mg , tab. lorazepam 2 mg , tab. escitalopam 5 mg , tab. phenytoin sodium 100mg , tab. rispridone 2mg , tab. rispridone 4mg , tab. lithiumcarbonate 300mg , tab. sodium valproate 200mg , tab. sodium valproate 500mg , tab. donepezil 5mg , tab. zolpidem 10mg , tab. amitriptyline 25mg , tab. chloroquine 250 mg , tab. primaquine 2.5 mg , tab. primaquine 7.5 mg , tab. fluconazole 400mg , tab. fluconazole 200 mg , tab. dexamethasone , tab. thyroxine sodium 100mg , tab. thyroxine sodium 50 mg , tab. limcee , tab. calcium d3 , tab. fluoxetine 20 mg , tab. folic acid 5mg , tab. folic acid large , tab. furosemide 40mg , tab. glibenclamide 5mg , tab. glimepride ( 2 mg ) , tab. glyceryl trinitrate 0.5 mg , tab. griseofulvin 250mg , tab. hydrochlorothiazide 12.5 mg , tab. hydrochlorothiazide 25 mg , tab. ibuprofen 400mg , tab. ibuprofen 400mg + paracetamole 325mg , tab. imipramine25mg , tab. ketrolac ( 50 mg ) , tab. labetalol 100mg , tab. lanoxin0.25mg , tab. lasix 40 mg , tab. levitiracetam , tab. levocetrizine 5mg , tab. levofloxacin ( 500mg ) , tab. levofloxacine 250mg , tab. lithium carbonate 300mg , tab. lorazepam 2mg , tab. losartan potassium 50mg. , tab. metformin ( 500 mg ) sr , tab. methyl prednisolone 4mg , tab. methyl prednisolone 8mg , tab. metoclopramide 10mg , tab. metronidazole ( 200mg ) , tab. metronidazole ( 400mg ) , tab. mifepristone 200mg , tab. misoprostol 200?g , tab. naltrex1one , tab. nefedipine 20 mg , tab. nitrocontin ( 2.6 mg ) , tab. norfloxacin 400 mg+ tinidazole 600 mg , tab. ofloxacin100mg. , tab. ofloxacin 200mg , tab. ofloxacin 400mg , tab. ofloxacin 200mg + ornidazole ( 500mg ) , tab. olanzapine 5 mg , tab. olanzapine 10mg , tab. olanzapine 7.5 mg , tab. phenytoin sodium 100 mg , tab.resperidone 1 mg , tab.resperidone 2 mg , tab.resperidone 4 mg , tab. ondansetron ( 4 mg ) , tab. ondansetron ( 8 mg ) , tab. ornidazole 500mg , tab. p.c.m. d.t. ( 250 mg ) , tab. p.c.m. d.t. ( 500 mg ) , tab. p.c.m. d.t. ( 600 mg ) , tab. pantoprazole 40mg , tab. pheniramine maleate 25mg , tab. pheniramine maleate 50mg , tab. primaquine 2.5mg , tab. primaquine 7.5mg , tab. ranitidine ( 150mg ) , tab. risperidone 2mg , tab. risperidone 4mg , tab. roxythromycine 150mg , tab. roxythromycine 300mg , tab. salbutamol 4mg , tab. sorbitrate ( 5 mg ) , tab. stemetil m.d , tab. telmisarten ( 20 mg ) , tab. telmisarten ( 40 mg ) , tab. terbinaffine 250mg , tab. thiamine , tab. tinidazole 500mg , tab. tranaxaemic acid + mefenamic acid , tab. tranexamic acid 250 mg , tab. tranexamic acid 500 mg , tab. trihexyphenidyl 2mg , tab. voglibose ( 2mg ) , tab. voglibose ( 3mg ) , tab. wysolone 10mg , tab. wysolone 20 mg , tab. wysolone 5 mg , tab. zinc sulfate 20mg , tab. zinc sulphate ( 20 mg ) , tab. aceclofenac ( 100 mg ) , tab. acetyl salicylic acid 300mg , tab. aciloc, 150mg. , tab. alprazolam 0.25 mg , tab. aluminium hydroxide+ magnesium hydroxide 400mg , tab. amitriptyline 25 mg , tab. amlodipine ( 10mg ) , tab. amlodipine ( 5mg ) , tab. amoxy 250 mg dt , tab. amoxycilline + clavulanic acid ( 325 mg ) , tab. amoxycilline + clavulanic acid ( 625 mg ) , tab. anaspas , tab. antacid , tab. anti cold , tab. artesunate 100mg , tab. artesunate 200 mg , tab. artesunate 25 mg , tab. artesunate 50 mg , tab. ascorbic acid 500 mg , tab. atenolol ( 50mg ) , tab. avil ( chalpheniramin ( 25 mg ) , tab. bisacodyl5mg , tab. buprenorphine , tab. calcium carbonate 500mg , tab. calcium d3 500mg. , tab. cefadroxyl 250mg , tab. cefadroxyl 500mg , tab. cefixime ( 100mg ) , tab. cefixime ( 200 mg ) , tab. cefixime ( 50 mg ) , tab. cefuroxime axetil250mg , tab. cefuroxime axetil500 mg , tab. cepodoxime proxetil , tab. cetrizine 10mg. , tab. chloroquine 300mg , tab. chloroquine phosphate 150 mg , tab. chromostat , tab. cipro 500mg + tz 600mg , tab. ciprofloxacin hydrochloride 250mg , tab. ciprofloxacin hydrochloride 500mg , tab. ciprofloxacine ( 250mg ) , tab. ciprofloxacine ( 500 mg ) , tab. clobazam , tab. clomipramine 25mg , tab. clonazepam 0.5 mg , tab. compose , tab. co trimoxazole ( trimethoprim 80mg + sulphamethoxazole 400mg ) , tab. co trimoxazole ds , tab. co trimoxazole ss , tab. deriphylline 150 mg , tab. deriphylline 300 mg , tab. diamox 250 mg , tab. diazepam ( 2 mg ) , tab. diazepam ( 5 mg ) , tab. diclofenac sodium 100 mg , tab. diclofenac sodium 50 mg , tab. dicolofenc + paracetamol , tab. dicyclomine , tab. dicyclomine + paracetamol , tab. dicyclomine hydrochloride 10 mg , tab. diethylcarbamazine citrate 100 mg , tab. dilantoin sodium ( 100 mg ) , tab. domperidone 10mg , tab. doxycycline ( 100 mg ) , tab. drotaverine ( 40 mg ) , tab. ecospirin ( 75 mg ) , tab. escitalopram 5 mg , tab. escitalopram 10 mg , tab. carbamezapine 25 mg , tab. etophylline + theophylline 100 mg ( 77+23 mg ) , tab. etophylline + theophylline 150 mg sr , tab. etophylline + theophylline 300 mg sr , tab. famotidine ( 40 mg ) , tab. famotidine 20 mg. , tab.hyoscinebutylbromide10 mg , tab. ascorbic acid ( vitamin c ) 100 mg , tab. calcium carbonate 500 mg , tab. cholecalciferol 30000 iu , tab. furosemide40 mg , tab. salbutamol 2 mg , tab. glimepiride 2 mg , tab. metformin 500 mg , tab. misoprostol 200 mcg ( should be use with caution ) , tab. dicyclomine hydrochloride 10 mg , tab. aluminium hydroxide+ magnesium hydroxide 400 , tab. ondansetron4 mg , tab.domperidone 10mg , tab. amlodipine 10 mg , tab.amlodipine 5 mg , tab.enalapril5 mg , tab.telmisartan 40 mg , tab.atorvastatin 10 mg , tab.alprazolam 0.25 mg , tab. paracetamol250 mg, , tab. levocetirizine 5 mg , tab. amitriptyline ( 10 mg ) , tab. amitriptyline ( 25 mg ) , tab. acyclovir ( 200 ) mg , tab. acyclovir ( 400 ) mg , tab. acyclovir ( 800 ) mg , tab. anticold , tab. albendazole ( 400mg ) , tab. amoxicillin dispersible tablet 250 mg , tab. diazepam5 mg , tab. clot , tab. digoxin . ( 0.25 mg ) , tab.ifa ( l ) , 100mg elemental iron + 500 mcg folic acid ( red & blue ) , tab.ifa tab. ( s ) , 30mg elemental iron + 250mcg , tab.folic acid ( 5 mg ) , tab.glyceryl trinitrate sublingual ( 0.5mg ) , tab.glimepride ( 1mg ) , tab.glimepride ( 2mg ) , tab.glimepride ( 3mg ) , tab.glimepride ( 4mg ) , tab.levofloxacin ( 500 mg ) , tab.montelucast + levocetrizine ( 10mg + 5 mg ) , inj. amikacine 20 mg , inj. amikacine 40 mg , inj. amikacine 80 mg , inj. amikacine 100mg , inj. b complex amp , inj. dicyclomine hydrochloride 10 mg 2ml , inj. ondasetron4mg , inj. vitamin k1 1mg / 0.5 ml , inj. tramadol , inj. certriaxone 1gm + sulbactum 500mg , inj. ceftriaxone 1gm , inj. ranitidine amp , inj. ondem , inj. oxytocin , inj. tranexa , inj. prostodin , inj. methergine , xylocaine 2% jelly , inj. xylocaine 2% , inj. vitamin k1 , inj. a.r.v multi dose , inj. antisnake venum , metron iv 100ml , n.s 500 ml , d.n.s500ml , 5% dextrose , 10% dextrose , mannitol 100ml , inj. fluphenazine decanate 25mg / 5ml , inj. haloperidol l.a , inj. lorazepam 2mg , inj. promethazine 25mg , inj. e mall , inj. clot , inj. ceftriaxone ( 125g ) , inj.ceftriaxone ( 250g ) , inj.ceftriaxone ( 500g ) , inj.ceftriaxone vial 1 g , inj.cefotaxime ( 125 g ) , inj.cefotaxime ( 250 g ) , inj.cefotaxime ( 500 g ) , inj.cefotaxime ( 1 g ) , inj.ceftriaxone + salbectum ( 375mg ) , inj.ceftriaxone + salbectum ( 750mg ) , inj.ceftriaxone + salbectum ( 1.5g ) , inj.cefoperazone + salbectum ( 500mg + 500mg ) , inj.cefoperazone + salbectum ( 1000mg + 500mg ) , inj.cefepime ( 1g ) , inj.calcium gluconate ( 10 ml ) , inj.dizepam inj. ( 2ml ) 5mg / ml , inj.t.t inj ( 0.5 ml ) , inj.t.t inj ( 5 ml ) , inj. netromycin 10 mg , inj. netromycin 25 mg , inj. norad 2mg , inj. ondansetron ( 4 mg ) , inj. ondansetron ( 8 mg ) , inj. ondem 2mg , inj. ondem 4mg , inj. ondensetron ampl , inj. oxytocin ampl , inj. pam , inj. pantoprazole with watervial ( 40 mg ) , inj. perinorm ampl , inj. phenargan ampl , inj. phenobarbitone , inj. phenraminemaleate ampl , inj. phenytoinampl , inj. pilocarpine , inj. propofol , inj. prostadin , inj. ranitidine ampl , inj. sensrocain ( 30 ml ) vial , inj. sodium bicarbonate ampl , inj. sodium chloride ampl , inj. termin , inj. tetvac ampl. , inj. tetvac vial , inj. theophyillin + ethophyillin ampl , inj. thiamine , inj. tramadol ampl / vial , inj. vitamin k1 1 mg / 0.5 ml ( phytonadione ) , inj. xylocaine 2% ( plain ) , inj. xylocard 2 % , inj anti d , inj. a.r.v. ( anti rabies ) single dose , inj. adrenaline ampl , inj. amikacin ( 250mg ) vial , inj. amikacin ( 500mg ) vial , inj. amikacine ( 100mg ) , inj. amino phylline ampl , inj. ampicilin 250mg vial , inj. ampicilin 75 mg vial , inj. ampicillin500mg vial , inj. anafortan 2ml , inj. anamin , inj. anaspas , inj. anawin heavy , inj. anawin plain , inj. antitetanus human immunoglobulin , inj. arteether 2ml 50mg , inj. artesunate 1ml 60 mg , inj. atropin ( ampoule ) ampl , inj. avil ampl , inj. b complex amp , inj. botropase , inj. butodol , inj. caffeine , inj. calcium gluconate amp , inj. cefoperazone ( 1 gm. ) with watervial , inj. cefotaxime with water ( 1 gram ) , inj. cefotaxime with water ( 125 mg ) , inj. cefotaxime with water ( 500 mg ) , inj. ceftriaxone + salbatum with water ( 1.5 gram ) , inj. ceftriaxone 250mg with water vial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone inj 1gram with watervial , inj. chlorpheniramine , inj. chromostat amp , inj. citicholine , inj. compose 2ml , inj. deriphylin , inj. dexamethasonevial , inj. dexamethasone sodium phosphate 2ml / 4mg , inj. diazepam ( 5 mg ) 2ml , inj. diclofenac aqua ( 1 ml ) , inj. diclofenacc sodium 2ml ampl , inj. dicyclomine ampl , inj. dilantin sodium100 mg , inj. dizepam , inj. dobutamine , inj. dopamine ampl , inj. drotaverine , inj. e mal , inj. efcorlin 50mg , inj. endpoprost inj , inj. epitrate , inj. etophylline + theophylline 220mg ( 169.4+50.6 mg ) , inj. fluconazole 100ml , inj. fortwin ampl , inj. furosemide 2ml , inj. fusemide vial , inj. gardinal , inj. gentamicin 10 mg , inj. gentamicin 40 mg , inj. gentamycine 20 mg. vial , inj. gentamycine 80 mg. vial , inj. glycopyrrolate , inj. haloperidol 5mg , inj. hemsyl , inj. hydro cortisone , inj. hydrocort 100mg , inj. hynidase , inj. hyprosol 5ml , inj. i.v. ciprofloxacine , inj. immunoglobin ampl , inj. insulin primixed ( 30 / 70 ) , inj. iron sucrose , inj. kcl , inj. ketamin ( 2ml ) ampl , inj. ketamin inj. ( 10ml vail ) , inj. ketorolac ( 1 ml ) , inj. k nate ( phytomenadione ) 1ml , inj. labatalol , inj. lasix ampl , inj. levipil , inj. levitiracetam , inj. lignocaine adrenaline , inj. magnesium sulphate ampl , inj. megazid xp , inj. mephentermine , inj. meropenam 1gm , inj. meropenam 250 mg , inj. meropenem 125 mg , inj. methergin , inj. methyl ergometrine ampl , inj. metochlopramide ampl , inj. metoclopramide 10mg , inj. midazolam , inj. moxifloxacin , inj. multivitamin ampl , inj. nacphin 10 mg , inj. naloxone , inj. neostigmine ampl , inj. vitamin k1 mg / .5ml , inj.hydrocortisone succinate 100 mg , inj. adrenaline1mg / ml , inj.atropine1 mg / ml , inj.magnesium sulphate ( 50% solution ) , 2 ml ampoule , inj. diclofenac 25 mg / ml , water for injection 5ml , cough syrup child , cough syrup adult , antacide syrup 200ml , phenergan syrup 100ml , normate syrup , meteronidazole syrup 30ml , paracetamol syrup 125 mg / 5 ml , cough syrup child , ofloxacin syp ( 30 ml ) , ofloxacin + metronidazolesyp ( 30 ml ) , paracetamol syp ( 60 ml ) , vitamin b – complex syp ( 100 ml ) , enzyme syp ( 100 ml ) , levocetrizine syp ( 30 ml ) , montelucast + levocetrizine syp ( 30 m1 ) , multivitamin syp ( 100 ml ) , ondastiron syp , levipil syrup , anticold syp ( 60ml ) , amoxicillin dry syrup ( 30 ml ) , amoxicillin dry syrup ( 60 ml ) , amoxixillin + clavulinic acid syp ( 30 ml ) , cefixime dry syp ( 30 ml ) , cetrizine syp ( 30 ml ) , cough expectorant ( 100 ml ) , cough expectorant ( 60 ml ) , vitamin a syp ( 100000iu / ml ) , ofloxacin syp 30 ml , vitamin a syp ( 100ml ) 2 mg / 5ml , vitamin b complex syp ( 100 ml ) , ofloxacin + ornidazole syp ( 30 ml ) , ofloxacin + metronidazolesyp ( 30 ml ) , paracetamol syp ( 60 ml ) 125mg / 5 ml , paracetamol syp ( 60 ml ) 250mg / 5 ml , phenobarbitone syp ( 100 ml ) , domperadone syp. 30 ml , levocetrizine syp. 30 ml ( 2.5 mg / 5ml ) , montelukast + levocetrizine syp ( 30 ml ) ( 4 mg + 2.5 mg / 5 ml ) , metronidazole syp ( 60 ml ) 100mg / 5ml , metronidazole syp ( 60 ml ) 200mg / 5ml , multivitamin syp 100ml , iron & folic acid syp 100 ml ( ferroussalt ) , ciprofloxacin eye drop ( 5ml ) , gentamicin eye drop ( 5 ml ) , moxyfloxacine + dexamethasone eye drop ( 10 ml ) , ciprofloxacine eye / ear drop 10ml , moxifloxacin eye drop , eye drop chloramphenicol 5ml 0.50% ( 5 ml ) , eye drop occumox – p ( moxifloxacin + prednesolone ) ( 5 ml ) , eye drop ofloxacin + dexamethasone , eye drop, flurbiprofen plus ( 5 ml ) , eye drop, ofloxacin / moxifloxacin ( 5 ml ) , eye drop, tropicacyl plus ( 5 ml ) , ciprofloxacin eye drop ( 5ml ) , clotrimazole and lidocain ear drop ( 10ml ) , domperadone drop 10ml , gentamicin eye drop 5 ml , moxyfloxacine + dexamethasone eye ( 10ml ) , eye drop , ofloxacin / moxifloxacin 5ml , ear drop ( ciproflaxacine ) , wax ear drop , ciprofloxacin eye / eardrops 10ml , ear wax solvent drops ( combination of benzocaine, chlorbutol, paradichlorobenzene and turpentine oil ) , methylcellulose eye drops , multivitamin drop ( 15 ml ) , vitamin d drop , noscapine drop1.83 mg / ml , ofloxacin + dexamethasone ear drops , multivitamin drop , nasal normal saline drop ( 10 ml ) , iron drop , anticol drop ( 10 ml ) , paracetamol drop ( 60 ml ) 100mg / ml , ondansetron drop 10 ml , multivitamin drop 15 ml , susp levosalbutamol ambroxol , susp. albendazole 400mg 10ml , susp. amoxycilline 60ml , susp. antacid 170 ml , susp. antacid 200 ml , susp. azithromycin ( 200 mg ) 30 ml , susp. bromhexine hydrochloride 4mg / 5ml , susp. calciumcarbonate +vitamin d3 calcium 250 mg+vit d3 125 iu / 5 ml , susp. cefixime 50mg 30ml , susp. cephalexin 125ml / 30ml , susp. cetrizine 30ml , susp. co trimoxazole ( trimethoprim 40mg+ sulphamethoxazole 200mg ) 100 ml , susp. co trimoxazole 50ml , susp. cough syrup child , susp. dexchlorpheniramine maleate 0.5 mg / 5ml , susp. digene , susp. domperidone ( 30ml ) , susp. ibuprofen 100mg / 5ml , susp. iron folic acid 200ml , susp. levitiracetam , susp. levocetrizine , susp. methadone , susp. metronidazole 30ml , susp. montelukast , susp. ofloxacin + metronidazole 30 ml , susp. paracetamol 125mg 60ml , susp. pheniramine maleate 15 mg / 5ml , susp. phenobarbitone , susp. salbutamol sulphate 100ml , susp. vitamin a 100000 iu / ml , syusp. clobazam , susp levosalbutamol ambroxol , albendazole suspension ( 10 ml ) , azithromycin suspension ( 15 ml ) , azithromycin suspension ( 15ml ) 200mg / 5ml , bendicts solution 500 ml , betadine oint. , betadine lotion , spirit 1000ml , spirit 500ml , plain slide , lancet , temophos , pyrethrum 2% extract , bti ( polluted & non polluted water ) , jsb i , jsb ii , malathion , savlon , anti fungel skin cream 20 gm , bleaching powder 25kg bag , g.v paint lotion400ml , antifungal medicated soap ( 75gm ) , antiseptic liquid ( 100ml ) , act kit ( adult ) , act kit ( 9 14 years ) , act kit ( 5 8 years ) , actkit ( 1 4 years ) , act kit ( lessthan 1 years ) , atrovastatin ( 5 mg ) , atrovastatin ( 10 mg ) , atrovastatin ( 20 mg ) , cefixime 200mg , paracetamol kid dt ( 125 mg ) , paracetamol ( 250 mg ) , vitamin b complex , vitamin d3 satchet ( 1 gms ) , vitamin b 12 , providine lodione gargle ( 100 ml ) , tooth paste sensodent k 100gm , tooth paste hydent k 100 gm , manitol 20% ( 350 ) , dextrose 5% iv ( 500 ml ) , dextrose10 % iv ( 500 ml ) , ringer lactate inj ( 500 ml ) as per ip , hemacil ( 500 ml ) , antifungal / anti bacterial cream , antifungal / anti bacterial powder , 0.5% bupivacain ( heavy ) , 1% gama benzene hexachloride lotion , 3% nacl 100 ml , 5% lysole , abo & rh ( anti ab&d ) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent cotton i.p 400gm / roll ( net weight ) , absorbent gauze than 18 m x 90 cm special , adenosine , analgesic cream ( 30 mg tube ) , anti ab sera 30 ml , antifungal skin cream 20 gm , antihuman globulin serum 5 ml , asthalin respules , betadine ointment , betamethasone dipropionate cream , capillary tube , carbolic acid ( 500 gm ) , chloramphenicol eye ointment , chlorhexidine , clindamycin gel 30 gm , clobetasol fusidic acid cream , clotrimazole ear drops , clotrimazole ointment 30 gm , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , isolyte p ( 500ml ) , itraconazole cream , iv ciprofloxacine ( 100 ml ) , iv mannitol ( 100ml ) , iv mannitol ( 300ml ) , iv metronidazole ( 100 ml ) , keratome 2.8mm disposable , lam / i gel 01234 , lancet ( 100 pcs ) , leclyete m ( 100 ml ) , leclyete p ( 100ml ) , leishmans stain ( 500 ml ) , lidfast jelly , loperamide , lotion. benzyl benzoate ( 1000 ml ) , lox 2%with adrenaline , luglos iodine solution ( 100 ml ) , luliconazole cream , m.c. lotion400ml , m.p pf / pv card antibody ( 100 pcs ) , m.p pf / pv card antigen ( 100 pcs ) , malaria pf / pv antibody card rapid test ( 50 kits ) , malaria pf / pv antigen card rapid test ( 30 kits ) , malecot catheter different sizes , maleria stain kit jsb ( i ) , maleria stain kit jsb ( il ) , memantine , miconazole ointment 10gm , miconazole ointment 30gm , morphine , n / 10 hydrochloric acid , n / 2 , n / 4 , thiopentone , thrombophob ointment , dextrose 25% ( 100 ml ) , diclofenac gel ( 30 gm ) , dicyclomine hydrochloride + activated semithicone drop 10 ml , diltiazem , edta powder 100gm , edta vial , formalin solution 500ml , fouchet reagent ( 500 ml ) , fradiomycin cream 15 gm , fusidic acid cream , galamantine , gentamicin dexamethasone ear drops , glacial acetic acid ( 500 ml ) , nasal prongs ( neonats ) ( cannula ) , neaomycineoint , neaomycinepowder , neomycin ( 5 mg + 500 iu / g ) 15gm , neospsrin powder 100gm , nitroglycerin , noscapine linct7mg / 5ml , ors adult 21 24 gm pack , ors ( pedartic pack ) , permethrin lotion 5% , phenylephrine , plasma volume expendore 500 ml , povidone iodine lotion 500ml , pregnancy kit ( b.p blaed, glups, corbolic shop, cuard clamp, parnncal sheet, cotton thread , pyromate , rivastigmine , salbutamol inhaler , silver sulfadiazine 1% cream 100gm , silver sulfadiazine 1% cream 20gm , silver sulfadiazine 1% cream 500gm , silverex ointmet ( burning ) ( 20gm ) , silverex ointmet ( burning ) ( 500gm ) , slide dying rack , sodium calcium hypochloride ( 5 litre ) , soframycin cream , sofratulle mesh , specimen collection bottle , spinal needle 25 g , stylet , sulphar powder 100 gm , tramadol , wbc diluting fluid , xylocain jelly 5% , xylocaine jelly2% , xylometazoline nasal drop adult , intravenous paracetamol , parafin liquid 1000 ml , syringe 50ml , t bact ointment , midazolam nasal spray* ( for emergency purpose ) , albendazole oral liquid 400 mg / 10ml , amoxicillin oral liquid 250 mg / 5 ml , norfloxacin 400+tinidazole600 , clotrimazole cream 1%30gm , clotrimazole vaginal tablet , miconazole ointment 30g , lactulose oral liquid 10 g / 15 ml , silver sulphadiazine cream 1% , calamine lotion , potassium permangnate ointment , lotion. benzyl benzoate ( 1000 ml , ethyl alcohol ( denatured ) solution 70% , hydrogen peroxide solution 6% , ear, nose and throat medicines , ispaghula granules / husk / powder ( herbal medicine ) , senna powder ( herbal medicine , budecort respules, , salbutamol respirator solution for use in nebulizer 0.5 mg / ml ( nebulizer essential ) , glucose powder 500 gm , glucose powder 1000 gm , activstart unobiotics with probiotic , enema...

Indian Army - Jharkhand

39395221 bids are invited for adhesive plaster zinc oxide , adhesive plaster microporous tape , adhesivee plaster microporous tape , bandage open woven compressed , lint absorbent cotton , suspensoryscrotal , diclofenac gel , framycetin tube total quantity : 2172...

Health Department - Jharkhand

39340908 rate contract for orthopedic implants , bio polar , bio polar (cemented) , dhs/dcs/osteotomy , cc screw 7mm/4mm with washer , herbert screw , lcp distal femur plating , lcp distal tibia plating , lcp proximal femur plating , lcp proximaltibia plating , distal febula plating , phiolos plating , short pfn & tfn , long pfn , interlockingtibia/ expert tibia nail , interlocking femur , dcp both bone plate , lcp both bone plate , lcp /dcpsmall t plate , s clavicle anterolateral/ with lateral extension , clavicle hook plate , dcp broad , lcp broad , dcp narrow , lcp narrow , lcp distal/ medial/ extra articular humerus , lcp medial extra articular humerus , lcp extra articular humerus , lcp lateral extra articular humerus , lcp distal humerus (two plate) , interlocking humerus , supra nailing , elasticnailing , k nail , one third tubulor plating , straight reconstruction plate , lcp olecranon plate , k wire & ss wire , external fixator , illizarov , jess fixator , rail fixator , charnley compression clamp , pelvic plating , modular bipolar cemented , modular bipolar uncemented , total hip replacement cemented , total hip replacement uncemented , modular shoulder replacement , elbow replacement , knee replacement , acl/pcl , endo button with fiber wire , loaded anchor suture , pedicle screw fixation(spine) , tlif /plif , ethibond , fiber wire/ tape , bone graft /ggb , stimulan 5cc/ 10cc , disposable gown , disposable g kit , ioban , disposable plain sheet , hip u drape , clinge drape , truplier , pulse lavage , skin grafting blade with handle , bholar stirrup with danham pin , giggly wire with handle , bone wax , esmarch bandage , screw /nail / plate removal , skin steplor disposal , remove drain 16 no. , remove drain 14 no , remove drain 12 no , remove drain 10 no. , screen view box , tourniquet with 3 size cuff...

Department of Animal Husbandry and Fisheries - Jharkhand

39320062 bids are invited for hospital medicine ceftriaxone , enrofloxacin 20 percent inj , enrofloxacin 1500 mg bolus , ceftriaoxone tazobactum inj , oxytetracycline 5 percent inj , chlorpheniramin maleate inj , meloxicam 5 mg paracetamol 150 mg inj , meloxicam 100 mg paracetamol 1500mg bolus , isoflupridone inj , mineral mixture , calcium supplement , heat inducer capsule , diminazene aceturate 70 mg phenazone 375 mg injection , fenbendazole 1 point 5 gm , wound spray , dog shampoo , ivermectin 10 mg injection , amikacin inj , povidine lodine solution , bandage 4 inch , fenbendazole tab 150 mg , oxytracycline 500mg bolus , liver tonic 250 ml , appetonic powder 100 gram , enrofloxacin tab 150 mg , antidiorrheal powder , antisepticoint tube , ivermectin tab 10 mg tab , vitamin b complex inj , sulfadimidine 5 mg bolus , phenyl , ivermectine 150 mg bolus total quantity : 32766...

Employees State Insurance Corporation - Jharkhand

39275745 bids are invited for disposable surgical items mse cloth adhesive tape 5 cm , bandage roller 2 inch , bandage roller 4 inch , bandage roller 6 inch , cotton roll 400gm , suction catheter 8fg , suction catheter 12fg , suction catheter 14fg , suction catheter 16fg , b p blade no 15 , b p blade no 22 , b p blade 23 , ecg electrode , intravenous canula size 20 g , intravenous canula22 g , intravenous canula 24 g , intravenous canula 16 g , intravenous canula size 26 g , mtp canula size 07 , mtp canula size 4 , mtp canula size 08 , mtp canula size 10 , oxygen mask adult , oxygen mask paed , nebulizer mask paed , nebulizer mask adult , needle disposablesize 18g , needle disposable size 24 g , gloves surgical size 7 , examination gloves plastic , nitrile examination gloves unsterile large , syringe disposable single use with needle 10ml 21g , syringe disposable single use with needle 2ml 24g , syringe disposable single use with needle 5ml 23g , blood set drip chamber with filter 18g needle , dispoable spinal needle size 23g , disposable spinal needle 25g , disposable spinal needle 26g , disposable spinal needle 27g , cotton crepe bandage 10cm x 4m , cotton crepe bandage 15cm x 4m , handloom cotton gauze 18m x 90cm , measured volume infusion set paed drip , abgel haemostatic sponge 1x5x8cm , two way folleys catheter 16fr , dyanplast 4 , knee brace m total quantity : 265965...

Department Of Defence - Jharkhand

39217297 bids are invited for medicine 1 34 paracetamol 500mg , pantaprazole 40mg , cetirizine 10mg , ibuprofen 400mg and paracetamol 325mg , ofloxacin 200mg , calcium and vitamin d3 , azithromycin 500mg , tab diclofenac 50 mg and serratiopeptidase 10mg , vitamin b12 15 mcg and ferrous fumarate 300mg and folic acid 15mg , cap ampicillin 250mg and dicloxacillin 250mg , gel diclofenac 1 percent gel , beclomethasone one fourth percent w by w and clotrimazole 1 percent w by w , paracetamol 125mg 60ml , cetirizine 5mg 30ml , ofloxacin 50mg 30ml , ondansetron 2mg 30ml , syrup milk of magnesia and liquid paraffin 11 point 25 170ml , cetrimide 0001 percent w by v and lindane 1 percent w by v , chlorpheniramine maleate and dextromethorphan hydrobromide cough syrup , chlorhexidine gluconate and cetrimide solution antiseptic disinfectant liquid 1 litre , ec lotion , hydrogen peroxide solution 500ml , povidone iodine half percent w by v solution 500ml , oxytocin 5iu amp , tetanus toxoid 5ml multi dose vail , cotton roll 450gram , gauze than , bandage 4 inch , bandage 2 inch , bandage 6 inch , crape bandage 4 inch , paper tape 4 inch , adhesive tape 4 inch , paper tape 2 inch , i v set , intra cath 22 no cannula , povidone iodine ointment 20gram , valethamate 8mg 1ml , ciprofloxacin eye ear drop , rl iv fluid 500ml , dextrose 5 percent iv fluid 500ml , gloves no 6 , malaria detection kit , hiv detection kit , hbs ag detection kit , typhoid detection fluid , plain urine vail , anti abd solution vail , sxp albendarole 10 ml , albendarole 400 mg , ors powder 21 gram , doxylamine 10mg and b6 pyridoxine folic acid 25mg total quantity : 115209...

Ministry Of Coal - Jharkhand

39211173 bids are invited for procurement of medicine and auxiliary items tablet aceclofenac 100mg paracetamol 500mg , tab amlodipine 5mg , cap amoxicillin 500mg , syrup albendazole 200mg 5ml , tab azithromycin 500mg , tab dicyclomine 20mg paracetamol 500mg , tab metformin sr 500mg , tab levocetrizine 5mg , tab metronidazol 400mg , tab ofloxacin 200mg ornidazole 500mg , tab pantoprazol 40mg , cap omeprazole 20mg domperidon 10mg , inj gentamycin 80mg 2ml , inj ranitidine 25mg ml 2ml amp , disposable syringe 10cc , povidone iodine 5 percentage lotion 500ml , ors 21gm sachet , roller bandage 7 point 5 cm , roller bandage 15 cm , tab calcium carb 500 mg vit d3 , absorbant cotton 500gm , crepe bandage cotton 4 by 8 cm total quantity : 54670...

South Eastern Railways - Jharkhand

39166523 supply of triangular bandages. size 130 cm x 90 cm x 90 cm. made of non elastic cotton material. tpi should be 50 60 nos. each pcs. should be wrap with plastic / paper having manufacturer name with full address, mfg. license no, batch no, mfg. date, expiry date. secondary packing ( with 10 20 pcs of triangular bandages ) should be of plastic or other material. => limited...

Rajendra Institute Of Medical Science - Jharkhand

38939699 running of mechanized laundry and cssd for running of mechanised laundry and cssd services operation and maintenance of unit rims, ranchi , list of linen and cssd items for washing and sterilising and cmc of complete system , bed sheet x 2000 nos. , blanket x 2000 nos. , small blanket x 500 nos. , screen curtain – 100 nos. , ot linen small ( 30 ) x 100 nos. , ot linen large ( >30 ) x 100 nos. , hand towel x 100 nos. , net ( mosquito net ) x 100 nos. , machine cover x 10 nos. , eye sheetx 20 nos. , ot gowns set x 100 nos. , pillows cover x 500 nos. , gauge / bandage / cotton rolls of upto 100 gms with packing material x 50 nos. , gauge / bandage / cotton rolls of upto 500 gms with packing material x 30 nos. , ot / ward / laboratories small hand instruments size below 6” with department wise / unit wise batch packing materials x 50 nos. , ot / ward / laboratories small hand instruments size above 6” with department wise / unit wise batch packing materials x 50 nos. , ot gowns / gloves / uniform set of one x 100 nos. , sophisticated reusable accessories of o.t.s like laparoscopic accessories / endoscopic accessories, oliathermy accessories etc will be packing materials x 10 nos. , cmc of complete laundry and cssd system ( labour, accessories, spares and all other consumables except fuel per year basis....

Rajendra Institute Of Medical Science - Jharkhand

38924336 supply of surgical consumables on rate contract basis at rims, ranchi , surgical consumable items , abdominal drainage kit ; size 16fg / 20fg / 24fg / 28fg / 32fg , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 20cm x 20cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 25cm x 25cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 30cm x 30cm , abdominal / gauze sponge with x ray thread , sterile , 12 ply , size 45cm x 45cm , abdominal / gauze sponge with x ray thread , 12 ply , size 20cm x 20cm , abdominal / gauze sponge with x ray thread , 12 ply , size 25cm x 25cm , abdominal / gauze sponge with x ray thread , 12 ply , size 30cm x 30cm , abdominal / gauze sponge with x ray thread , 12 ply , size 45cm x 45cm , absorbable gelatin powder (sterile) (such as gelfoam or similarproduct) , absorbable hemostat (oxidized regenerated cellulose) 4 in.x 8 in. (10cm x 20 cm ) , absorbable hemostat (oxidized regenerated cellulose) 2 in x 4 in(5.1cm x 10.2cm ) , absorbable hemostat (oxidized regenerated cellulose) 2 in. x 3in.(5.1cm x 7.6cm ) , absorbable hemostat (oxidized regenerated cellulose) 3 in x 4in. (7.6 cm x10.2 cm ) , absorbable hemostatic gelatin sponge (8cm x 5cm x 1cm) , absorbable hemostatic gelatin sponge (8cm x 3cm) anal , absorbent cotton roll net weight 400gm , accessoriesforprobesofmonitor(i)lncsdisposableprobes , accessoriesforprobesofmonitor(ii)ecgcable , accessoriesforprobesofmonitor(i)spo2extension , accessoriesforprobesofmonitor(i)etco2 sampleline , accessoriesforprobesofmonitor(i) eeg cup electrode , accessoriesforprobesofmonitor(i)temprature probe , accessoriesforprobesofmonitor(i)nibp hose , accessoriesforprobesofmonitor(i) nibp cuff , accessoriesforprobesofmonitor(i) battery , act cartridgesfor measurement of act , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 1 x 1 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 1 x 3 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 2 x 2 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 3 x 3 , adhesion barrier matrix for duraplast made from ultra pure collagen for dural regeneration. size : 4 x 5 , adhesive felt pad 5x5cm, , adhesive felt pad 10x10cm , adhesive remover with silicone polymers for easy removal of the base plate, alcohol free, sting free 50 ml , adhesive tape cloth 3 x 10mtr. ( adhesive plaster ) , adhesive microporous paper tape 1 x 9.1 mtr , adhesive microporous paper tape 2 x 9.1 mtr , adhesive microporous paper tape 3 x 9.1 mtr , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 1 x 9.1mtr. , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 2 x 9.1mtr. , adhesive mircoporous paper tape coated with broad spectrum anti mircobial agent for enhanced infection control size 3 x 9.1mtr. , adhesive silicon gel tape size 1 x 1mtr , adhesive silicon gel tape size 1 x 5mtr , administration set for feeding bag for enteral nutrition feeding pump, dehp and latex free, length minimum 250 cm , aerosol oxygen mask adult / paed , air mattress/airbed/inflatable mattress (plain) (anti decubitus bubble)disposable electrically operated , alken trocar cannula , all type of topical haemostatic agents including thrombin based agents biological glue etc. , ambu bag adult 100% silicon material only , ambu bag paediatric 100% silicon material only , ambu bag neo natal 100% silicon material only , amplantz sheath all sizes , anaesthesia circuit a coxial modification of the basic t piece system, developed to facilitate scavenging of waste gases. the process includes patient inspiring fresh gas from the outer reservior tube and expiring into reservior tube. convenient, lightweight anaesthesia delivery system ; should be based on mapleson d system provided with a corrugated tube , expiratory valve and antistatic bag ; compact and inexpensive with low dead space , anaesthesia masks (disposable, latex free, inflatable cuff, transparent)size 0, 1, 2, 3, 4, 5 , anaesthesia masks (re usable silicone, transparent) size 0, 1, 2, 3, 4, 5 , angled tip arterial cannula sized 8 fr 24 fr, should be beveled thin wall tips attached to tapered cannula bodies.should have kink resistant wire wound bodies. size 8 fr., 10fr., 12fr., 14fr., 16fr., 18fr., 20fr., 22fr., 24fr , annuloplasty flexible ring tricuspid flexible design, suitable for mics,open sternotomy and robotics sizes : 25,27,29,31,33 , annuloplasty rigid ring sizes 24,26,28,30,32,34 saddle shape, mitral ahcwr, titanium core maintains the anatomical shape, efficient distribution of leaflet stress and chordal tension , annuloplasty semi rigid ring sizes 24,26,28,30,32,34 semirigid, mitral 3 dimensional, promotes annular remodelling , antegrade cardioplegia cannulae 12/14/16 fr. with vent and without vent. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 10fr. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 12fr. , antegrade ostial cardioplegia cannula antegrade cardioplegia cannula should bemade of soft 100% silicone conduit with distal bulbous end & should have luer lock connector at the proximal end for administration of cardioplegia solution into the coronary ostia. sizes: 14fr. , anterior posterior nasal packing catheter (for epistaxis cases) , anterior vitrectomy pack infinity, for cataract surgery , anterior vitrectomy pack oertli for ophthalmic surgery , antiseptic skin cleaning wipes : key ingredients : alcohol free , ph balanced, chlorhexidine gluconate (chg) , vitamin e, aloe vera ; size 24cm x 30cm ; 10 wipes packed in resealable pouch per pack , antiseptic skin cleaning wipes for baby : key ingredients : alcohol free , ph balanced, neem extracts vitamin e, aloe vera ; size 15cm x 20cm ; 10 wipes packed in resealable pouch per pack , antiseptic skin cleaning wipes for neonatal : key ingredients : alcohol free , ph balanced, aqua fruit extracts, preservative ; size 15cm x 20cm ; 10 wipes packed in resealable pouch per pack , aortic punch blade should be able to float around the punch. punch should be available with tapered cutting blade to increase visibility.should be available in all functional sizes size 2.0mm ; 2.5mm ; 3.0mm ; 3.5mm ; 4.0mm ; 4.5mm , aortic root cannula should have radiopaque tips attached to clear pvc bodies.additional features: aortic root pressure monitoring and left heart venting.can be used to aspirate air emboli as well administer cardioplegia. sizes 4 fr ; 5fr ; 7fr ; 9fr ; 11fr , aortic root cannula with vent linesizes 5 fr 11 fr should have radiopaque tips attached to clear bodies with separate vent line. 5fr , 7fr , 9fr , 11fr , aortic root cannula pediatric neonatal sizes 4 fr should be able to aspirate air from aorta, should have radiopaque tip and standard 50.5 in length or a shortened 2.5 in. , arterial cannula for arch cannulation sizes 20fr. , 22fr , 24fr. should have elongated one piece wire wound body with radiopaque suture ring and dilator with depth markings. , arterial cannula angled with diffused flow tip sizes 18 fr 24fr, should be one piece wire wound body with integrated flutes for diffused flow. 18fr , 20fr, 22fr, 24fr , arterial perfusion cannulae pediatric sizes: 8fr, 10fr, 12fr,14fr and 16fr.non wire reinforced bevel tip.overall length 18cm with suture bump. , arterial cannula ; with on off switch to prevent backflow and exposure of blood to healthcare professional ; perforated wings to provide secure fixation, ventilation and to prevent skin maceration. size : 20g , arterial blood collection syringe ; reducing the burden on paramedical staff of manually preparing the abc syringes ; spray dried calcium balanced lithium heparin improves accuracy and consisstency ; tip cap on the syringe for safe transportation ; size : 3ml , artificial dural grafts all sizes , arteriotomy cannula should have polyurethane tube with a bulb shaped tip connected to winged female luer. sizes 2mm, 3mm, 4mm, 5mm, 6mm , arteriotomyshunts(intra coronary shunts) should be beveled tip. should have fully transparent body. sizes 1.0 mm. ; 1.25mm ; 1.5mm ; 1.75mm ; 2.0mm ; 2.5mm ; 2.75mm ; 3.0mm , av shunt (silicon) arm , av shunt adult , av shunt connector adult , axillary artery one piece cannula with central arterial pressure measurement should have elongated one piece wire wound body with radiopaque suture ring and dilator with depth markings.should have integrated pressure monitoring port at tipsize 18fr ; 20fr ; 22fr ; 24fr , baby drape : for all kind of surgeries n baby. translucent sof poly film size 1.2 x 1.2m ; incise area 25 x 20cm eto sterilisez. 5 yrs expiry self life. packing material 45gsm polypropylene one side and another side tyvek paper packing. , bain circuit with apl valve and bag (adult) , bain circuit with apl valve and bag (paed) , balloon inflation device/syringe , balloon maxillary sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , balloon frontal sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , balloon sphenoid sinus kits ( each kit consist of 1 balloon, 1 guide catheter , 1 atch, 1 illumination wire ) , bandage than (100cm x 20 mtr) as per schedule f ii , biopsy gun used for obtaining histological core samples from soft tissue and organs. should be fully automatic. it should have echogenic and atraumatic needle tip , ergonomic and light weight , cannula with depth marking , easy and one hand operated with two stage arming , available with / without coaxial needle ; size 14g 10 & 16 cm / 16g 10 , 16 & 20cm / 18g 10, 16, 20, 25cm / 20g 10, 16, 20cm , biopsy gun used for obtaining histological core samples from soft tissue and organs. should be semi automatic. it should have echogenic and atraumatic needle tip , ergonomic and light weight , cannula with depth marking , easy and one hand operated with two stage arming , available with coaxial needle ; size 14g 10 & 16 cm / 16g 10 , 16 & 20cm / 18g 10, 16, 20, 25cm / 20g 10, 16, 20cm , biological glue 15 gm , biological indicators , bipolar and monopolar cautery leads for laparoscopic surgery , bipolar and monopolar cautery leads for turp procedure , bipolarcautery forecepsallshapes(bayonetandstraight)andsizesforuseinadultandpediatricuse.tobe compatible for use with valleylab, megadyne and erbe surgical electro cautery machines , bis monitor universal electrodes , bite block with strap adult and paed , bladder evacuator device all type & all sizes , bloodtransfusionset : dehpfreeand eo sterile. conforms to iso 1135 4 standard, sharp non vented spike suitable for blood bags and all type of standard blood containers, — provided with a cylindrical drip chamber with 200? filter to prevent the passage of any clot in the chamber, flash ball type injection port for extra medication, comes with smooth 150 cm long, kink resistant tube, efficient roller controller for accurate adjustment of transfusion rate. sterile, individually packed. , blood tubing for dialysis adult , blood tubing for dialysis paed , blower mister handle , blower mister should have specialized nozzle utilizing a micro orifice for fluid delivery and a separate orifice for gas delivery.should have the malleable shaft and on/off control on the hand piece. , blower mister without tubing , bone cement all type , bone marrow aspiration needles (one time use) – pediatric & adult. all types & sizes , bone marrow aspiration needles(reusable, autoclavable)– pediatric & adult. all types & sizes , bone marrow biopsy needle one time use (adult+pediatric) , bone marrow biopsy needles (reusable, autoclavable) – pediatric & adult. all types & sizes , bone wax , bottom sheet with adhesive 135 x 200 1 ( impermeable waterproof soft fabric ) , bovine pericardial patch size: 4cmx4cm, 6cmx6cm, 8cmx8cm , bp blade all size ( size 10 24 ) , bp cuff (manual): all adult and pediatric sizes , buffant cap non woven disposable female crimp cap : • should be of good quality. • made from non woven breathable fabric of 15 gsm • well fitted with double elastic or string. • air permeable. • properly ultrasonically sealed for uniformity. , bulldog vascular clamps (steel) all types and sizes. (straight and curved, all lengths) , c section kit sterile consist of 1 foil polyglactin 910 with triclosan coated no. 1 0 & no 1 & 1foil fast absorbing pg 910 3 0 , c – arm cover disposable , c arm cover (two part and three part) , cardiac sump sucker , cardio vascular patch eptfesizes: 5cm x 15cm x 0.6mm , cardio vascular patch eptfesizes: 3cmx 6cm x 0.4mm , cardio vascular patch eptfesizes: 10cm x 15cm x 0.6mm , cardioplegia cannula for ostial cannulation convex tip 10 fr 45° , cardioplegia cannula for ostial cannulation convex tip 10 fr 90° , cardioplegia cannula for ostial cannulation convex tip 12 fr 45° , cardioplegia cannula for ostial cannulation convex tip 12 fr 90° , cardioplegia cannula size infant: cardioplegia cannula should be made of soft 100% silicone & should be tapered conduit with distal open tip having adjacent lateral eyes, followed by a flange for secure positioning. it should have proximal luer lock & a ss needle with hub. size: infant. , cardioplegia needle neonatal, pediatric and adult sizes. 5fr and 8 fr should have stainless steel tip with plastic depth stop, needle should be attached to flexible pvc tubingwhich should include a drape clamp and female luer. size 5 fr. , cardioplegia needle neonatal, pediatric and adult sizes. 5fr and 8 fr should have stainless steel tip with plastic depth stop, needle should be attached to flexible pvc tubingwhich should include a drape clamp and female luer. size 8 fr. , cardiotomy venous reservoir adult , cardiotomy venous reservoir pead. , cardiotomy venous reservoir neonatal , care stream dr film size 10 x 12 , care stream dr film size 14 x 17 , care stream dr film size 8 x 10 , carpentier bi caval femoral venous cannula, sizes : 24/29 fr, should have wire wound kink resistant two stage design. , carpentier bi caval femoral venous cannula,sizes : 30/33fr should have wire wound kink resistant two stage design. , catheter mount (smooth bore flexible corrugated tubing) with double swivel patient connector with suction port , catheter mount (extendable) 22m/15f patient connector, 22f machine side connector , catheter mounts with double swivel patient connector with two openings for bronchoscopy and suction , cautery knife cleaner (sterile) , cautery knife cleaner (unsterile) , cautery lead for monopolar (disposable) , cautery pad adult (split type) , cautery pad paed. (split type) , cautery pencil, ptfe coated with adjustable length. , cauterytipswithptfecoated/nonstickdisposableblade/disposableneedle/disposableballptfeinsulation , centera cath arterial line all size , central venous catheter set – (3 4 fr ; length 10 15 cm ; should have polyurathane double lumen kit with flexible distal tip fully radio opaque should have flexible distal tip fully radio opaque graduation each centimeter from 5cm to the distal tip , should have distal & proximal lumen 18 g each for rapid infusion, 1 introducer needles , 1 guiding syringe 5 ml, 1 guide wire with j tip nitinol , 1 dilator with stopper, 1 scalpel, 1 fixation device) , central venous catheter set – (4.5 fr ; length 6 & 12.5 cm ; should have polyurathane double lumen kit with flexible distal tip fully radio opaque should have flexible distal tip fully radio opaque graduation each centimeter from 5cm to the distal tip , should have distal & proximal lumen 18 g each for rapid infusion, 1 introducer needles , 1 guiding syringe 5 ml, 1 guide wire with j tip nitinol , 1 dilator with stopper, 1 scalpel, 1 fixation device) , central venous catheter set – size : double lumen : 7 fr, 16 cm, 14/18 g, 18/18g. ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen : 4.5fr, 5 fr 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen : : 7 fr, 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter set – size : triple lumen :8 fr, 8,5fr 12 to 20 cm, 16/18/ 18 g, 14/18/18g, 20/22/22g ; should be manufactured from specially formulated and biocompatible pu material ; should be soft tip catheter for easy and non traumatic insertion, based on seldinger technique ;kit should contain a) soft tip polyurethane catheter,“j” tip guide wire (0.035” – 30 80 cm) with guide advancer b) y” shaped introducer needle (18 g x 70 mm) c) tissue dilator ; d) suture wing and clamp fastener, scalpel, injection ports, extension line clamps,syringe 5ml ; e) injection site, hypodermic needle (17g to 21g) f) needle sponge ; should be sterile and individually packed in hard blister pack. , central venous catheter, peripherally inserted 3 fr containing 1 splitting introducer needle and one radiopaque catheter single lumen 10 to 20cm length, 1 3ml syringe 1 syringe adapter, 1 removable connector with integral extension tube 10 cm with secondary fixation unit please quote for all types of central venous catheters made of polyurethane and silicone , chemo procedure gowns sms & polyethylene coating as per astm f1671 & tested against chemo drugs , chest drain bag with underwater seal,capacity 500ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chest drain bag with underwater seal,capacity 1000ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chest drain bag with underwater seal,capacity 2000ml approx, with soft kink resistant pvc tube, with special hanger to carry bag, sterile , chiba needle (all sizes and gauge) to be used for fine aspiration for cytological study , closed suction system ( 24hr / 72 hr ) minimises the risk of vap incidences in ventilated patients, kit should have 3 easily replaceble catheter minimising the need to replace entire suction system every 24 to 72 hrs. , catheter with lateral eyes, smooth tip and depth marking for maximum patient comfort, mdi port to provide an effective, quick and convienent way of drug delivery, ittigation port with one way valve allows lavage and irrigation of the suction catheter, on and off valve allow suction catheter tip to be isolated and create an enclosed cleaning chamber, transparent connectors and durable sleeve facilitates catheter manipulation and prevents infiltration of blood and sputum, 360 degree swivel elbow enables rotation for enhanced patient comfort and reduces torque ; size 6fr, 8fr, 10fr, 12 fr, 14fr, 16fr. , closed wound suction unit 06fr.to 08fr , closed wound suction unit 10fr, 12fr, 14fr, 16fr, 18fr, , colostomy bag , colostomy pouch with softflex skin barrier *without tape border *without starter hole *without integrated filter * odour barrier film *soft wire closure * barrier opening up to 15 mm & pouch length 11.5 cm. , combined spinal epidural kit , consumable for cardiac output monitor flotrac cardiac output sensor for cardiac output monitor of make edwards , consumable for cardiac output monitor ibp/ cvp transducer for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor large for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor medium for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor small for cardiac output monitor of make edwards , consumable for cardiac output monitor cerebral oximetry sensor neonatal for cardiac output monitor of make edwards , consumable for cardiac output monitor acumen iq hpi sensor with ai for cardiac output monitor of make edwards , consumable for cardiac output monitor ibp cable for cardiac output monitor of make edwards , consumable for cardiac output monitor truclip or sensor holder for cardiac output monitor of make edwards , cord clamp, plastic individually packed , coreskintemperatureprobeswiththeprovisionoffreesupplyofinterfaceadaptors/cables(ifrequired)for comapatible with infant open care systems like dragger (an 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract , coreskintemperatureprobeswiththeprovisionoffreesupplyofinterfaceadaptors/cables(ifrequired)for comapatiblewith infantopen care systemslike fischerand paykel(presently installed inneonatalicu)(an 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract. , coronary artery retraction clips sizes 3mm and 5mm should be designed to improve exposure to a coronary anastomosis site.should be able to small prongs and gently hold tissues away from the vessel to improve vision. , corrugated drainage sheet , cpap infant nasal delivery circuit adaptor & sizing kit , cpap infant nasal prongs ;all sizes , cpap mask infant nasal interface all sizes , cr film 10 x 12 , cr film8 x 10 , craniotomy drape (50gm sms polypropylene fabric water repellent size: 1.6x3.2mm) ; adhesive area : 20cm dia. side channel & collecting funnel. olysheet lining 1.20 x 1.20m ; sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , crepe bandage 2 , crepe bandage 4 , crepe bandage 6 , ctg paper , cuff inflator/ pressure guage , cusa irrigation tubing suction compatible with soring machine for neuro surgery ot. , cvp manometer disposable : cvp measuring device suitable for continuous or intermittent monitoring of central venous pressure during infusion, particularly in icu, ccu, ots and casualty departments , manometer tube with graduation from 4 cm to +34 cm and attached to three way tap, provided with 120 cm long extension tube, fitted with female luer lock on one end and male luer lock on the other end for safe connection to the central venous catheter, latex free injection site is provided for extra medication, sliding indicator provided to record previous reading, moulded clamps with latex free rubber strings for easy fixation on the intravenous stand , sterile, individually packed in peelable pouch. , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 2” x 2”, inches , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 4 x4” inches , dacron marking patch (filamentous fabric) should be nominal thickness; around 0.6 mm, water permeability; approximately 1800ml, popularly known as ”marking patch” markings arrow should indicate, in which direction the patch is to be stitched. size 6x6 ‘ inches , delivery kit (sterile) consisting of the following: setup cover 100x195 cms; under buttock drape 75x125 cms; abdominal drape 100x150 cms; hand towel; cord cl baby blanket;vaginal sponge; maternity pad; placenta basin; abdominal sponge ( x ray opaque ) ; baby wipe ( 60 x 60 ) ; maternity mesh panty ; perineal sheet with legging ; underpad with collection bag ; waste bag ; id band ( paediatric ) ; id band ( adult ) , dialyser cellulose acetate – 0.5m2 , dialyser cellulose acetate – 1.0 m2 , dialyser cellulose acetate – 1.2 m2 , dialyser cellulose acetate – 1.5 m2 , dialysistenckhoffstraightcatheterkitscontaining16frpullapartsheath/dialator,18gaintroducerneedle,tunneling stylet, j/str, guidewire etc all sizes , dialyzers (multi use) polyphenylene membrane with polypropylene housing material. steam sterilized and bpa free all sizes , dialyzers (single use) polyphenylene membrane with polypropylene housing material. steam sterilized and bpa free all sizes , diapers (neonatal size (for babies weighing 1 to 3 kg) extra small size , diapers (neonatal size (for babies weighing 1 to 3 kg) small size , diapers adult (large) , diapers adult (medium) , diapers adult (small) , diapers adult (xtra) , diapers paed (large) , diapers paed (medium) , diapers paed (small) , digitalbp apparatus (formeasurementof blood pressure and pulse, should be able to detect systolic and diastolic bloodpressureandpulse,should bebased uponoscillometry principle,shouldgivedigitalresultsonlcddisplay. should have minimum 1 year warranty. , disposable connector all sizes; , disposable connector all sizes;y, without leur lock , disposable connector all sizes;y with leur lock , disposable connector all sizes;straight with leur lock , disposable connector all sizes;straight without leur lock , disposable enema nozzle , disposable eyepads (100%cottongauze,16 ply,ovalshaped, 75x95mm,pairpack),– individualunsterilepouch pack– individual sterile pouch pack , disposable e z clean 23/4 needle electrode , disposable fine tip marker pens for the identification and labeling drugs, radiology films, syringes, vials for individual patients (red, black, green) , disposable fine tip and bold tip skin marker pensforthe identification and labeling of individualpatients during surgery or other procedure (red, black, green) sterile water proof, indelible non toxic ink (with scale) , disposable full face cpap mask with standard 22m connection with 360° swivel connector, size 3, 4, 5, 6, and 7 , disposable hand control button switch cautery pencil with ez clean (ptfe coated) blade electrode , disposable hand control button switch pencil with ace blade electrode with holster , disposableindwellingbowelcathetersystemkitconsistingofonecatheter,two2000mlclosedodor barrier collection bags, two skin barriers, two lubricating jelly packets, one 1000 ml irrigation bag , disposable inner cannula for fenestrated tracheostomy tube size 7 & 8 mm , disposable kellys pad with automated measurement with collection pouch , disposable laryngoscope miller blades , disposable oxygen mask with silicon cuff & 2mtr star lumen tube (adult) , disposable oxygen mask with silicon cuff & 2mtr star lumen tube (paed / child ) , disposable pcnl drape sheet consisting of 1no. pcnl sheet, 4pcs drape sheet, 1pcs trolley cover(large), 1pcs trolley cover(small),1pcsmayotrolleycover,1pcsbedsheet,1pcsscreencoverwithadhesiveshouldbecustomised according to the requirement with additional components hydrohead 50cm, treated antistatic fabric static decay<1sec., weight 50gsm sms fabric, asorbent material near fenestration min 60gsm spun bond and polyethylene laminated and absorbency should be 4 times of its weight., manufactured in 100 000 class clean room , disposable single tubing all sizes (½,?,¼,3/16) , disposable single tubing sizes ? , disposable single tubing sizes ½ , disposable single tubing sizes 3/16 , disposable skin grafting blades , disposable sterile bed sheet – non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe, 160x260 cm (provide all details of gsm, type of fabric and method of sterilization) – white, green and blue – , disposablesterilefoley’scatheterinsertionkitconsistingof : 1. packed in csr overwrap (non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe )– 54x54 inch. 2. two pair gloves – size 7.0 and 6.5. 3. one waterproof underpad – size 3x4 feet. 4. one poly lined non woven fabric fenestrated drape – size 4x4 feet, fenestration size 15x15 cm. 5. outer plastic paper kidney/basin tray 1000 cc. 6. syringe 20 ml. 1 pc 7. syringe 5 ml. 1 pc 8. one povidine iodine ointment. 9.one lubricating jelly – 15 ml pouch/tube. 10. gauze sponges / pads (100% cotton woven, yarn:40s, mesh:, 26x18) 4x4 inch 08 ply with folded edges sterile peal open – four piece pack. , disposable sterile pillow cover non woven spunlace fabric 40 gsm, outer side laminated by 12 micron ldpe – 45x65 cm (provide all details of gsm, type of fabric and method of sterilization) – white, green, orange, yellow and blue , disposablesterilestretchersheetnonwovenfabric–singlepack(providealldetailsofgsm,typeoffabricand method of sterilization) –white, green and blue , disposable straps (head gear) for full face niv mask , disposable straps (head gear) for nasal niv mask , disposable tongue depressor wooden/plastic, individually packed (small/medium/large) , disposable, nasal prongs, neonatal , double lumen catheter to accommodate 2 guidewires , double lumen catheter to accommodate 2 guidewires 6.0/10.0 fr,50cm length , double lumen tube : robertshaw tube designed to fit patients anatomy for thoracic or pulmonary surgery and single lung long term ventilation. anatomically correct curvatures facilitate proper placement and intubation. high volume/low pressure tracheal cuff has a true barrel shape that minimizes pressure on the tracheal tissue and a uniquely shaped bronchial cuff helps prevent accidental upper lobe occlusion, tracheal cuff seperates the lung from the environment , bronchial cuff seperates the lungs from each other , colour coded pilot balloons with luer lock connector, marked with the name of the lumen (tracheal or bronchial) for easy identification , d shaped lumina provide maximum cross sectional area , minimising resistance to gas flows , provided with double swivel connections with double caps , sterile, individually packed. size 35/37/39/41fg (left) , double lumen tube : robertshaw tube designed to fit patients anatomy for thoracic or pulmonary surgery and single lung long term ventilation. anatomically correct curvatures facilitate proper placement and intubation. high volume/low pressure tracheal cuff has a true barrel shape that minimizes pressure on the tracheal tissue and a uniquely shaped bronchial cuff helps prevent accidental upper lobe occlusion, tracheal cuff seperates the lung from the environment , bronchial cuff seperates the lungs from each other , colour coded pilot balloons with luer lock connector, marked with the name of the lumen (tracheal or bronchial) for easy identification , d shaped lumina provide maximum cross sectional area , minimising resistance to gas flows , provided with double swivel connections with double caps , sterile, individually packed. size 37/39/41fg (right) , double lumen endotracheal tube (for olv) adult all sizes , double lumen endotracheal tube (for olv) paed all sizes , double lumen jugular catheter kit with laser cut side slots (all size) , double lumen jugular catheter with laser cut side slots (all sizes) , double lumen straight catheter kit with laser cut side slots (all sizes) , double lumen straight catheter with laser cut side slots (all size) , double prong needle for urethral sling , double stage venous cannula round and oval shape, should be two stage cannula with oval body in various sizes.should be two stage cannula with round body in various sizes.should have cannula body with thin walled with depth markings. different sizes 28/36fr. ; 32/40 fr ; 36/46fr;32/46fr ; 36/51fr , drape c.a.b.g. drape set : • made up of reinforced spun bond film composite material, blue laminate of polypropylene non woven fibers and polyethylene film. • highly absorbent yet impervious across entire drape. • low linting, non breathable, abrasion resistant, durable, strong tear resistant, conformable, with self adhesive containing hypoallergenic acrylate type adhesive with a silicone coated paper liner.• cabg pack:4 self adhesive cautery bags (30cmx35cm),3 op tapes(10cmx55cm),4 lint free hand towels (23.5cmx38cm),4 self adhesive towel drapes (91.5cmx100cm),1 self adhesive medium drape (183cmx183cm),1 self adhesive large drape(150cmx250cm),1 instrument table drape (150cmx200cm),1 large instrument table drape (183cmx240cm),1 self adhesive bilateral split drape (183cmx200cm),2 triangular drape (91.5cm x 91.5cm x 129cm). • sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , drape c arm drape 41 inch x 74inch , drape eye drapes (gsm polypropylene fabric 100x70cm with drainage pouch , drape universal extremity drape, sms fabric and dimension 90 x 131 in., fenestration one 2.5 in. conformable circular, fabric tube holders, control plus fabric reinforcement, ce certified, aami l 4 compliance , drape lamino spinal drapes all sizes , drape shunt drape , dressing paraffin gauze 10 x 10 cm in packs/ box of ten pieces , dressing paraffin gauze 15 cm x 2 m roll , dressing parafin gauze 10 x 30 , dressing silk protein & antimicrobial nanosilver based sterile soft, conformablesurgical pu foam dressing (non adhesive) 20 x 20cm , dressing silk protein & antimicrobial silver based bilaminated sterile surgical mesh wound dressing 20 x 25cm , dressing silk protein & antimicrobial silver based bilaminated sterile surgical mesh wound dressing 20 x 40cm , dressing silk protein & nanocrystalline silver based sterile, non adherent, antimicrobial gauze dressing 10x25cm , dressing silk protein based sterile non adherent gauze dressing to cover the wounds 10x25cm , dressing silk protein based sterile soft, conformable surgical pu foam dressing (non adhesive) 20x20cm , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 2in x 2in ( 5cm x 5cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 4in x 5in ( 10cm x 12.5cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 4in x 10in ( 10cm x 25cm ) , dermal regeneration template : bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate) and silicone layer ( bilayer ) ce certified size : 8in x 10in ( 20cm x 25cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 2in x 2in ( 5cm x 5cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 4in x 5in ( 10cm x 12.5cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 4in x 10in ( 10cm x 25cm ) , dermal regeneration template : single layer bovine collagen and glycosaminoglycan ( chondroitin 6 sulfate ) ce certified size : 8in x 10in ( 20cm x 25cm ) , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes1x1 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes2x2 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes1x3 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes 3x3 , duralregenerativematrixandadhesionbarriermatrixforduraplastyto be used in neurosurgery ot: sizes4x5 , dviu knife , ecg cable compatible with bpl and schiller ecg machine , e c g electrode adult (button type) , e c g electrode neonatal (button type) , e c g electrode paed.(button type) , e c g jelly (250ml) , e c g jelly (5 kgs jar) , ecg paper roll compatible with schiller machine , ecg paper roll compatible with bpl machine , ecg paper roll for 12 channel ecg machine , model : cardiomin 12b , echo jelly (250ml) , eeg paste 250gms , elastic adhesive bandage size 10cm 4/6 mtr. (stretched length) , electric jet nebulizers. compresseor based jet nebulizer, light weight < 2 3 kgs, power 220v 50 hz ac, treatment time < 10 min, nebulization quantity: 10 ml, mmad: 80% < 5 micron, compressor pressure 40 50 psi, maximum flow rate: 8 10 lpm, operating flow rate: 6 8 lpm @ 10 psi lmp/psi, sound level, 50db, , electrical breast pump with one year warranty , embolectomy catheter 2fr to 9 fr , embolectomy catheter with perfusion channel all types and all sizes , endo mechanical circular stapler (cutter & stapler) (all types and all sizes) for open and laparoscopic surgery , endo mechanical contour stapler (all types and all sizes) , endomechanical disposabledissectingandgraspingforcepssize5mm,30 35cmlength,withoutrachet, insulated with connector pin for unipolar coagulation , endo mechanical haemolock clip applicator – for open surgery , endo mechanical haemolock/weck locking clip applicator 10mm (all size clips)– for laparoscopic surgery , endo mechanical hand piece / shears all types (open surgery and laparoscopic) and all sizes for use with bipolar vessel sealing device ligasure. , endo mechanical hemorrhoid surgery stapler all types & all sizes , endo mechanical hemostatic titanium vascular clips all types & all sizes (such as liga clips) , endo mechanical laparoscopic disposable cannula without trocar, with sealing valve/cap.all sizes and all types (pediatric, adult and bariatric) 15, 12, 10, 5, 3 mm with various lengths , endo mechanical laparoscopic disposable trocar and cannula set with sealing valve/cap. all sizes and all types. (pediatric, adult and bariatric) 15, 12, 10, 5, 3 mm with various lengths , endo mechanical laparoscopic endo bags for specimen retrieval disposable all sizes , endo mechanical laparoscopic equipment cleaning and maintenance devices , endomechanical laparoscopicneedleholder:5mmstriaghthandlewithdisengagableratchet,straightjaw,size 5mm, length 30 35cm, for use of 0/0 to 7/ sutures , endo mechanical linear cutter & stapler (all types and all sizes) open and laparoscopic surgery , endo mechanical linear staplers (cutter and stapler) for use in laparoscopic bariatric surgery (all types and all sizes) , endo mechanical ultrasonic energy consumables (probes, shears and hand pieces) all types and all sizes , endo mechanical ultrasonic shears (laparoscopic&open)all typesand allsizes(handpiece& hand probes,all types and all sizes) , endo mechanical haemostatic locking clips (like haemolock clips) all types and all sizes, along with provision of free applicators , endo mechanical screw shaped 5 mm polyglycolic lactic acid absorbable tacker laparoscopic mesh fixation devices, all lengths and capacity , endo mechical complete range of probes to be used in laparoscopic & open surgery cases using energy device compitable for ligasure (ls 10) vessel sealing system , endo mechnical anchor shaped 5 mm absorbable tacker laparoscopic mesh fixation device, all length and capacity , endo mechnical laparoscopic hand instruments reusable, indian make. 5mm. such as graspers and dissectors of variouskinds:maryland,fenestrated,atraumatic,toothed,etc.withrachetandwithoutrachet;scissorsofvarious kinds, needle holders, retractor, suction irrigation system. 30 35 cm length. , endo mechnical ligature clips in all sizes compatible with existing aesculap clip applicators. , endo mechnical linear stapler (all types and all sizes) open and laparoscopic surgery , endomechnical reloads(cartridges)fordisposablestaplers(foropenandlaparoscopicsurgery)(alltypes& sizes) , endo mechnical reloads (cartridges) for re usable (steel) linear staplers (all types & sizes) , endo mechnical reusable endo loop applicator (2300 mm length) , endo mechnical reusable linear cutter & stapler (all types & sizes) , endo mechnical titanium (liga) haemostatic clip applicators – for open surgery all sizes , endo mechnical titanium (liga) haemostatic clip applicators – for laparoscopic surgery all sizes 5mm and 10mm , endotracheal tube (north polar) – preformed et tube plain sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (north polar) – preformed et tube cuffed sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (south polar) – preformed et tube plain sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube (south polar) – preformed et tube cuffed sizes 3.0 , 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0 , endotracheal tube plain, pvc , size 2.00mm 5.00mm ;manufactured from thermo sensitive material readily conforming to body contours at body temperature. kink resistant and transparent material to reduce any possiblity of occlusion in the tube bore, nasoral tip suitable for nasal/oral intubation, murphy eye with smooth edges and tip to reduce any trauma to the patient during procedure, provided with radio opaque line throughout the length for x ray detection and assistance in placement, proximal end is fitted with standard 15 mm connector which can snugly fit with other commonly used connectors, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed, pvc ,size 2.00mm 5.00mm : manufactured from thermo sensitive material readily conforming to body contours at body temperature. kink resistant and transparent material to reduce any possiblity of occlusion in the tube bore, nasoral tip suitable for nasal/oral intubation, murphy eye with smooth edges and tip to reduce any trauma to the patient during procedure, provided with radio opaque line throughout the length for x ray detection and assistance in placement, proximal end is fitted with standard 15 mm connector which can snugly fit with other commonly used connectors, sterile, individually packed in peelable blister pack. , endotracheal tube plain , size 5.00mm 10.00mm : thermo sensitive tube conforms to the tract anatomy , kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , size 5.00mm 10.00mm : thermo sensitive tube conforms to the tract anatomy , kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector, sterile, individually packed in peelable blister pack. , endotracheal tube plain, silicon and pvc blend , size 2.00 mm to 5.00 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , silicon and pvc blend : size 2.0 mm to 5.0 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , silicon and pvc blend : size 5.5 mm to 10.0 mm : made from non toxic silicon and pvc blend, dehp free, extra smooth, non adherent inside/outside surface for ease intubation, extubation and suctioning, kink resistant, thin walled, thermo sensative tube, softens at body temperature, smooth polished murphy eye distal end and tapered balloon end for atraumatic intubation and extubation, kink resistant inflation tube to ensure patient safety during cuff inflation and deflation, radio opaque line and markings provided to facilitate identification of tube position, universal 15mm connector at proximal end, sterile, individually packed in peelable blister pack. , endotracheal tube cuffed , with subglottic suction line : thermo sensitive tube conforms to the tract anatomy, should have special suction port for removal of subglottic secreretions using syringe / suction minimize the risk of vap, kink resistant tube ensures patient safety , strong tube walls to ensure proper ventilation , murphy eye has a polished smoothness ensuring atraumatic intubation and extubation, features a high volume, low presssure cuff , soft cuff allows air tight fit between the tube and trachea, wide black ring above cuff gives visual indication of tube passing the vocal cords to aid in placement, radio opaque line determines exact location , standard 15 mm connector at proximal end ,sterile, individually packed in peelable blister pack. , endotracheal tube holder adult & paed , endotracheal tube t piece , endotracheal tube with cuff pressure monitoring all sizes , endotrachealtubewithsecondarylumenfortrachealirrigation(fordeliveryofsurfactant/orothermedications) pvc/silicone based, sizes internal diameter 1,2.0,2.5,3.0,3.5,4.0,4.5 mm , ent pediatric airway balloon catheter 5mm x 24mm / 7mm x 24mm / 9mm x 24mm , ent adult airway balloon catheter 10mm x 40mm / 12mm x 40mm / 14mm x 40mm / 16mm x 40mm , ent balloon inflation device , epidural catheter : soft tip epidural is specially designed for continuous anaesthesia and pain relief therapy ; catheter should be made from unique plasticizer free polymer with excellent bio compatibility ; flexible and atraumatic soft tip with three lateral eyes ; catheter should be printed to determine the depth of insertion and accurate placement in the epidural space ; luer lock twist commector ; crystal clear catheter with radio opaque line. , epiduralanaesthesiakitwithg18/16epiduraltouhyneedle,doublelayeredepiduralcatheterg20/g19. with crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter and lor syringe with parabolic graduation markings , epiduralanaesthesiakit latex freewithg18/16epiduraltouhyneedle,doublelayeredepiduralcatheterg20/g19 length 100cm.with crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter and lor syringe with parabolic graduation markings , epidural anaesthesia tray latex free withg20 epiduraltouhyneedle of length 5cm,doublelayeredepiduralcatheterg24 length 72 cmswith crocodile catheterconnectorand 3 pairsof laser drilled holes fordrug distribution, 0.2 micron epidural filter attachable to pin pad present in kitand lor syringe with parabolic graduation markings , esmarch bandage 3 , esmarch bandage 4 , esmarch bandage 5 , extension line 100cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , extension line 150cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , extension line 200cm ; small bore high pressure extension line. — made of clear, non toxic medical grade pvc material, suitable for high pressure monitoring and for connection between syringe infusion pump and patient, multi purpose extension line provided with male luer lock at one end and female luer lock at other end and fits all standard equipment, luer lock connectors provide secure fitting, can sustain a pressure upto 10 kg/cm² or 140 psi size 100 cm , external collecting urinary device , external defibrillating patches (all sizes) compatible for philips/ medtronic/mindray , face mask n 95 without respirator niosh certified , face mask with tie on : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm.tie string: 90 cm. , face mask with smooth elastic ear loops : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm. , face mask with eye shield (disposable) for full protection against any spurt/splash with tie on : • three layermask, which should offer excellent (99%) bacterial filtration efficiency. • non woven breathable fabric, each layer of 25 gsm. • should be super smooth, soft and ultrasonically welded air permeable for comfortable use. • should have flexible nose clip (rust free pvc coated) for proper positioning on the nose bridge. • size: 17.5 x 9.6 cm.tie string: 90 cm. , facial oxygen tent mask adult / paed , femoral arterial cannulae; wire reinforced overall length should be 19.5.2 cm with ¼ vented connector sizes: 8fr ; 10fr ; 12fr ; 14fr. , femoral arterial cannulae; wire reinforced overall length should be approx. 24cm with 3/8 vented connector sizes: 16fr, 18fr and 20fr. , femoral catheter double lumen , femoral catheter single lumen paed , femoral catheter single lumen adult , femoral catheter straight 11.5f * 16 cm , femoral multistage venous cannulasizes: 29/29/29 fr should be one piece wire wound multiple side holes body with percutaneous kit. , femoral multistage venous cannula sizes: 29/46/37 fr should be one piece wire wound multiple side holes body with percutaneous kit. , femoral venous cannulae; wire reinforced overall length should be approx. 24cm with ¼ non vented connector.sizes 8fr, 10fr, 12fr and 14fr.. , femoral venous cannulae; wire reinforced overall lengthshould be 752 cm with 3/8 non vented connector sizes 18fr. ; 20fr ; 22fr ; 24fr ; 28fr , fibrin glue for ophthalmic surgery , fine suction tip for ent , fistula canula for hemodialysis with anti reflective valves and safety needle, length 30mm/38 mm (all sizes) , fistula needle , flexo metallic endotracheal tube plain : size : 3.00mm to 5.00mm flexo metallic endotracheal tube for airway management intended for use in surgeries demanding flexible head or neck position , specially designed suitable to laryngeo tracheal anatomy , tubes are fitted with a reinforced stainless steel spiral core to overcome any possiblity of the bore occlusion due to kinking or collapse of the tube , flexo metallic feature provides 100% kink resistance and anti crushing strength to the endotracheal tube , completely flexible tube with a thin,strong wall. high volume, low pressure cuff provides effective seal between tube and trachea and minimizes the risk of folds. radio opaque line with precise graduation marking guarantees proper placement of the tube , murphy eye ensures clear airway and no mucus blockage, sterile, individually packed. , flexo metallic endotracheal tube cuffed : size : 5.00mm to 10.00mm flexo metallic endotracheal tube for airway management intended for use in surgeries demanding flexible head or neck position , specially designed suitable to laryngeo tracheal anatomy , tubes are fitted with a reinforced stainless steel spiral core to overcome any possiblity of the bore occlusion due to kinking or collapse of the tube , flexo metallic feature provides 100% kink resistance and anti crushing strength to the endotracheal tube , completely flexible tube with a thin,strong wall. high volume, low pressure cuff provides effective seal between tube and trachea and minimizes the risk of folds. radio opaque line with precise graduation marking guarantees proper placement of the tube , murphy eye ensures clear airway and no mucus blockage, sterile, individually packed. , foley catheter 2way latex 6fr, 8fr, 10fr,silicon coated , foley catheter 2way latex 12fr,14fr, 16fr,18fr,20fr,22fr,24fr silicon coated , foley catheter 2way made of 100% silicon material 6fr, 8fr, 10fr , foley catheter 2way made of 100% silicon material 12fr,14fr, 16fr,18fr,20fr,22fr,24fr , foley catheter 3way latex 18f,20fr,22fr,24fr,26frsilicon coated , foley catheter 3way made of 100% medical grade silicon, the foley should have an inbuilt flow control stopper to regulate the urine flow, enable ease of mobility for patient and maintain bladder health,vballoon should be made of tear resistance silicon rubber size 18fr,20fr,22fr,24fr, 26fr , fourlumen centralvenouscatheter 8 f (cathertermaterial polyurethane certon with polyhexanide methacrylate withadditionalhydromercoating,fourlumen14/16/18g/18gwithlength15cm,catheterkitcontainingavalve needle 18 g, novlon material dilator, scalpel, guidewire made up of nitinol, an egg lead for and a safesite connetor , fuji dry laser film 10 x 12 , fuji dry laser film 8 x 10 , fuji dry laser film 14 x 17 , full gown material 50gsm(nw sms) front stichless,fluid barrier cuff (not knitted cuff) 1 nos.disposable bag 1 nos, plain sheet large(25 micron thick pe hygine fil of size 120x210 cm) 2 nos, water proof leggings (cover upto knee) 1 pair, cap 1 nos, mask 1 nos, paper hand towel 2nos, nitrite gloves (latex powder free double layer on finger tip) pair, googles (wearing on the any type of spectcle) 1nos, note: all the product should be in single sterilized pack.packet material 35gsm polypropylene one side and another side half part tyvek paper 35 gsm packing , gauge than(18mtr x 90cm) as per schedule f ii , gloves latex examination light powdered non sterile pack size 100/pk) , gloves latex non powdered for microsurgery all sizes , gloves sterile latex surgical gloves powder free(polymer coated) powder free gloves coated with unique blend of polymer to provide excellent donning capability, should conforms to is 13422:1992, astm d3577:2019, en 455 1:2020, en 455 2:2009+a2:2013, en 455 3:2006 & en 455 4:2009 standards specification, the physical properties, dimension & tensile strength of the material should be as per european ce/usfda standards, anatomically ahaped with micro rough surface in inner palm and in inner part of the finger area which provides good grip at wrist and in curved fingers. product should have shelf life of 5 years, sterilized by validated process cycle (iso 11135:2014), shouldpass viral penetration test as per astm f 1671, biologically compatible as per iso 10993 part 5, 7, 10 & 11 non toxic & non irritant.size 6 ; 6.5 ; 7.0 , 7.5 , 8.0 , 8.5 , 9.0 (in pair) , gloves sterile latex surgical gloves pre powdered, product should conforms to is 13422:1992, astm d 3577:2019, en 455 1:2000, en 455 2:2009+a2:2013, en 455 3:2006 & en 455 4:2009 standards specifications, lightly powdered with modified absorbable corn starch usp, sterilized by validated process cycle (iso 11135:2014), shouldpass viral penetration test as per astm f 1671, biologically compatible as per iso 10993 part 5, 7, 10 & 11 non toxic, non irritant & non pyrogenic. size in pair : 6 / 6.5 / 7.0 / 7.5 / 8.0 / 8.5 / 9.0 , gloves nitrile examination non sterile , gloves polyethylene (sterile) (in pair) , gloves polyethylene (non sterile) , glucometer test strip. each 1000 strip should be accompanied by a glucometer on free of cost basis. glucometer should not require code ( code free glucometer ) , should be able to use fresh capillary, venous, neonatal blood. accuracy should be as per international standard iso 15197 requirement for blood glucose monitoring system. should be capable of being stored continuously in ambient temperature of 0° to 50° celsius , should have capillary, venous, blood testing, all software update shall be provided free of cost . glucometer should be usfda approved or ce mark from notified body (eu) , goggles (disposable) for full protection against any spurt / splash , graft woven trifurcate 12mm x 6mm x 6mm, 40 50 cm in length, gelatin coated. , graft woven trifurcate 14 mm x 7mm x 7mm, 40 50 cm in length, gelatin coated. , graft woven trifurcate 16mm x 8mm x 8mm, 40 50 cm in length, gelatin coated. , graft : regular & small beadings (rings) ptfe graft all sizes and length. , graft dacron bifurcated woven grafts 12mmx6 mm with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 14mmx7mm, with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 16mmx8mm, with 40 50 cms length,collagen coated. , graft dacron bifurcated woven grafts 18mm x9mm with 40 50 cms length,collagen coated. , graft knitted dacron straight graft 6mm to 16 mm with 30 35 cm length,collagen coated. , graft knitted dacron straight graft 18mm to 24 mm with 30 35 cm length,collagen coated. , graft knitted dacron straight graft 6mm to 16 mm with 60 70 cm length,collagen coated. , graft knitted dacron straight graft 18mm to 24 mm with 60 70 cm length,collagen coated. , graft dacron knitted axillo bifemoral bifurcated graft with extended support, gelatin coated. , graft dacron knitted axillo bifemoral graft 90 degrees angle with 60 cm side branch 8mm and 0 mm, gelatin coated. , graft e ptfe stretchre in forced removable ringed thin wall pre configured axillo bi femoral vascular graft. size: 8mm diameter x 70cm/40cm length , graft e ptfe stretchre in forced removable ringed thin wall pre configured axillo bi femoral vascular graft. size: 8mm diameter x 90cm/40cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 6mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 7mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced low profile integrated radially supported thin wall vascular graft. size 8mm diameter 40cm / 60cm / 80cm length , graft e ptfe stretch re in forced removable ringed thin wall vascular graft.size: 6mm diameter x 50cm/70cm/80cm length. , graft e ptfe stretch re in forced removable ringed thin wall vascular graft.size: 8mm diameter x 50cm/70cm/80cm length. , graft ascendingaortic reconstruction graft : one piece design collagen coated valsalva graft for repair or reconstruction of the ascending aorta. one piece design collagen coated valsalva graft for repair or reconstruction of the ascending aorta.unique un crimped section that does not stretch should allow easy sewing of valve remnants or prosthetic valve should facilitate estimation of the length required for optimal placement of valve remnants or prosthetic valve to ensure optimal clinical outcomes. should have the ability to be precisely trimmed and shaped in case of remodeling technique procedures. at least 3 references line should act as a guide for prosthetic valve. coated polyester fabric cross linked type i bovine collagen water permeability < 5m * cm 2 min 1 @ 120mmhg , graft dacron straight woven grafts 6mm to 16 mm, 30 35 cm long, collagen coated. , graft dacron straight woven grafts 18mm to 28 mm, 30 35 cm long,collagen coated. , graft dacron straight woven grafts 30mm to 38 mm, 30 35 cm long,collagen coated. , graft dacron straight woven grafts 6mm to 16 mm, 60 70 cm long,collagen coated. , graft dacron straight woven grafts 18mm to 28 mm, 60 70 cm long,collagen coated. , graft dacron straight woven grafts 30mm to 38 mm, 60 cm 70 long,collagen coated. , graft dacron bifurcated knitted grafts 12mmx6 mm, with 40 50 cms length , graft dacron bifurcated knitted grafts 14mmx7mm with 40 50 cms length , graft dacron bifurcated knitted grafts 16mmx 8mm, with 40 50 cms length , graft dacron bifurcated knitted grafts 18mm x 9mm with 40 50 cms length , graft dacron woven 3 branch arch grafts 20mm to 34 mm,collagen coated. , graft dacron woven 4 branch arch grafts 20mm to 34 mm,collagen coated. , graft dacron woven thoraco abdominal grafts 20mm to 30mm, gelatin coated. , graft dacron woven graft 20 to 34mm with 8mm and 10 mm perfusion side branch, 40 50 cmlength, gelatin coated. , graft dacron woven extra length graft with offset branch graft 22 to 32 mm with 8mm perfusion side branch, gelatin coated. , graft dacron woven pre curved graft 22 mm to 32 mm with 8mm perfusion side branch, gelatin coated. , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 3mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 3.5mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 4mm diameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 5mmdiameter , graft e ptfe stretch reinforced thin wall heparin bonded vascular graft 10cms length size: 6mm diameter , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 2/6x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 14/7 x 40cm / 50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 16/8x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 18 / 9 x50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 20 / 10 x 50cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size :22/12 x40cm , graft e ptfe stretch reinforced thin wall limbed bifurcated vascular graft size : 24/12x40cm , graft e ptfestretch large diameter reinforced aortic vascular graft of all diameters and length , graft large diameters e ptfe grafts all sizes and length , graft : regular & thin wall e ptfe graft all sizes and length , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 6 mm diameter , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 7mm diameter , graft e ptfe stretch reinforced removable ringed thin wall heparin bonded vascular graft 50/70/80cm length size: 8mm diameter , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 6 mm diameter. , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 7mm diameter. , graft e ptfe stretch reinforced thin wall non ringed heparin bonded vascular graft 40/80cms length size: 8 mm diameter. , guide wire 80 cm fixed core straight (for dialysis) , guide wire 80 cm j tip (for dialysis) , guide wire amplatz extra stiff wire guide 0.035” 300cm , guide wire amplatz ultra stiff wire guide 0.035” 180cm , guide wire amplatz ultra stiff wire guide 0.035” 260cm , guide wire hydrophilic in all dia sizes 150/180 cm (straight) , guide wire hydrophilic in all dia sizes 150/180 cm (j tip) , guide wire hydrophilic in all dia sizes 150/180 cm (straight) , guide wire hydrophilic in all dia sizes exchange length 260/300 cm (j tip) , guide wire hydrophilic in all dia sizes exchange length 260/300 cm (straight) , guide wire hydrophilic in all dia sizes exchange length stiff shaft 260/300 cm (straight) , guidewire 0.015 x 40 45 cm j and straight tip (neonatal) , guidewire 418 0.018x40 45 cm j and straight tip (neonatal) , guidewire hydrophilic ni ti alloy, kink resistance j tip 0.018, 0.032,0.035,0.038 inch x 150cm , guidewirehydrophilicni tialloy,kinkresistance,floppyandstraighttip(comparabletoterumo) 0.18, 0.032,0.035,0.038 inch x 150cm , guidewire hydrophilic stiff with floppy tip 0.032,0.035,0.038 inch x 150cm , guidewires0.018 straight tip an all length , half gown : material 25 micron thick made up of microporous hygiene breathable polyethylene films ; size 750 mm width x 1500mm length ; should be water proof , light weight , blood pathogen proof , latex free ; disposable , single use , eto sterile ; packing material : 45g polypropylene film one side and another side 25gsm tyvek paper with 5 years expiry life. , heart positioner for minimally invasive beating heart surgery should be a positioner with detachable shaft for mics via thoracotomy. , heart valve : aortic valved graftwith conduit hemashield technology with collagen impregnation provides uniform tissue ingrowth, biocompatability, low porosity no preclotting required wooven duble velour hemashield composite graft sizes : 19,21,23,25,27,29,31, , heart valve : bioprosthetic heart valve latest generation with racheting system, mitral, suitable for future viv, opens at 8 atm pressure, low profile height 9mm, less lvot obstruction, facilitates mics, innovative flexifit racheting system, improved radio opaque markers on the stent posts, c shaped steel wire wrapped for better flouroscopy visualisation, 1 cut release, porcine, double valour polyester, flexible copolymer, ptatented linx ac, sizes : 25,27,29,31,33 , heart valve : bioprosthetic heart valvelatest generation, aortic, suitable for future viv,opens at 8 atm pressure, improved radio opaque markers on the stent posts, c shaped steel wire wrapped aroundfor better flouroscopy visualisation, 1 cut release, porcine double valour polyester, flexible copolymer, linx ac, size ; 19,21,23,25,27 , hemodialyzers single use bpa free (all sizes) , high flow humidification system disposable , high flow infusion catheter2.5f,2.8f,3.0f , high flow nasal cannulae system (neonatal size),flexible,kink free tubing with adhesive pads to secure on skin, compatible with use with heated humdifier, sizes preterm neonate , term neonate, infant and paediatric applications , hiv universal protection kit full gown material 50gsm(nw sms) front stichless,fluid barrier cuff (not knitted cuff) 1 nos.disposable bag 1 nos, plain sheet large(25 micron thick pe hygine fil of size 120x210 cm) 2 nos, water proof leggings (cover upto knee) 1 pair, cap 1 nos, mask 1 nos, paper hand towel 2nos, nitrite gloves (latex powder free double layer on finger tip) pair, googles (wearing on the any type of spectcle) 1nos, note: all the product should be in single sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper , hme filter , hot water bottle (made of good quality of rubber). , hub cutter ( manual ) , hub cutter ( with electricity ) , hydrocepahlus shunt high pressure , hydrocepahlus shunt low pressure , hydrocepahlus shunt medium pressure , hydrophillic guide wire .032 x 260 cm and .025x260 cm length , hypodermic disposable needles: smaller gauge (like 26g,24g,22g) 1.5 inch , iabp balloon (various sizes) compatible with data scope (macquet)iabp machine. , icd drainage bag , incentive spirometer ( breathing exerciser ) , infantcpapnasalprongs,3.0mmnarediameter/2.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,3.5mmnarediameter/2.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,4.5mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,4mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.0mmnarediameter/4.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.5mmnarediameter/5.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,5.5mmnarediameter/6.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.0mmnarediameter/6.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.0mmnarediameter/7.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infantcpapnasalprongs,6.5mmnarediameter/7.0mmseptalwidthwithoneinfantbonnet,oneinspiratoryand expiratory elbow connector, 2 adapters, with velcro securing tape , infant feeding tubes with markings sizes 4fg / 5fg / 6fg / 7fg / 8fg / 9fg / 10fg , intra aortic balloon catheter 7.5fr. , intra aortic balloon catheter 8fr. , intra aortic balloon catheter 9.5fr. , introducer needle, 1fr, 18mm length , intubationstyletreusable(malleablealuminiumwithsmoothhighdensitypolyethyleneoutersleeve) size : 6fr , 10fr, 14fr , iodinate drape : small ; size 15 x 10 cm ; adhesive area : 10 x 10 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : medium ; size 50 x 25 cm ; adhesive area : 30 x 25 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : large ; size 50 x 35 cm ; adhesive area : 35 x 35 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , iodinate drape : extra large ; size 90 x 45 cm ; adhesive area : 60 x 45 cm ; for covering incesion area in all kind of surgeries ; povidine iodine 5% adhesive coated ( 45gsm approx ) pu film ; eto sterlised ; 5 yrs expiry self life , irrigation and suction tube 5mm size 5mm, length 43cm, suction and irrigation tubewith lateral holes with 2 way stopclock for single hand use , i gel laryngeal mask all size , iui cannula (curved) , ivadministrationsetfor photosensitive drugs (photosensitiveivset). should have uv resistant tubing, and priming filter. should be latex free and dehp free. , iv cannnula with wing without port 26g , iv cannnula with wing without port 28g , iv cannula with port with wing 14g , iv cannula with port with wing 16g , iv cannula with port with wing 18g , 20g , 22g , iv cannula with port with wing 24g , iv cannula with port with wing 26g , iv cannula with port with wing 28g , iv cannula with port with wing with safety from needle prick 14g , iv cannula with port with wing with safety from needle prick 16g , iv cannula with port with wing with safety from needle prick 18g , iv cannula with port with wing with safety from needle prick 20g , iv cannula with port with wing with safety from needle prick 22g , iv cannula with port with wing with safety from needle prick 24g , iv cannnula with port with wing with safety from needle prick 26g , iv cannula with wing without port 16g , iv cannula with wing without port 18g , iv cannula with wing without port 20g , iv cannula with wing without port 22g , iv cannula with wing without port 24g , i.v. cannula fixator crepe material , i.v. cannula fixator with semi premeable transparent film with pad , iv extension line 10cm with three way , iv extension line 100cm with three way , iv line filter with injection port , iv micro drip infusion set with drop size reduced to 60 drops per ml for paediatric and critical therapy, manufactured from non toxic , clear and transparent p.v.c material, sharp piercing spike for easy insertion in fluid container along with built in preventive bacterial air vent, infusion set has a cylindrical collapsible drip chamber for proper visulization od the drop rate, provided with disc type fluid filter to filter any particulate matter in the i.v fluid, long super smooth kink resistant tubing with efficient roller controller for accurate and unrestricted flow,y type injection port made up of silicone provided for extra medication, luer lock connector for secure fitment to all standard devices, sterile and individually ribbon packed. , iv microdrip set with burrette : measured volume set : 100ml ; 100% latex free provided with y type injection port made up of silicone for additional medication and luer slip connector, equipped with a micro drip with reduced drop size of 60 drops per ml, provided with a burette type chamber of 100 ml capacity with 10 ml overflow limit, burette chamber is made of bio compatible medical grade transparent styrene polymer, suitable for infusing all types of fluids, unique floating auto shut valve acts as a floating indicator and automatically shuts off the drain path to prevent the passage of air in the line, no kink device prevents kinking of tube during transportation and transfers, separate plugs for extra medication and change over, sterile, individually packed. , iv microdrip set with burrette : measured volume set : 150ml 100% latex free provided with y type injection port made up of silicone for additional medication and luer slip connector, equipped with a micro drip with reduced drop size of 60 drops per ml, provided with a burette type chamber of 150 ml capacity, burette chamber is made of bio compatible medical grade transparent styrene polymer, transparent , cylindrical & calibrated measured volume chamber with bold scale, bacteria retentive ait inlet on spike, microdrip with 60ml drops per ml, 15micron fluid filter in the drip chamber, tube length : 150cm, soft and kink resistant pvc tubing. , iv needle 16g/18g/20g in 1/2, 1 & 1.5 length , iv needle 21g/22g/23g/24g in 1/2, 1,1.5 length , iv needle 26g in 1/2, 1,1.5 length , iv set with airvent, dehp free, sharp and easy piercing air vented spike, bacteria retention air inlet with snap cap, approx 20 drops/ml, , iv set , safety infusion set, dehp free , vented spike fits tightly, ensuring easy insertion and removal, comes with unique air stop feature which is a hydrophilic filter membrane present at the bottom of the drip chamber which prevents the ingress of air in case of emptied fluid container, provided with an innovative prime stop, which is a hydrophobic membrane placed on the luer lock fitting that stops fluid leaking and dripping on the floor, longer drip chamber fits firmly in the users hand, ensuring abetter grip, specially designed y type injection port made up of silicone havin resealing property is provided for additional medication, soft, see through, clear 180 cm long dehp free pvc tubing, which is kink resistant for uninterrupted and smooth flow, advance, handy roller clamp for efficient control, sterile and individually blister packed. , ivseteo sterileanddehpfree(vented)20drops/ml,rollerclamp,0.2micronaireliminatingfilter,priming filter, should be latex free, pvc free. , precision infusion set : i.v set with dial flow controller specially designed for controlling the flow rates of fluid, eliminates the need of expensive electronic i.v pumps, provided with soft and kink resistant clear pvc tubing for uninterrupted flow, gentle gravity drive is self correcting, wide dial operates as thumb wheel like roller clamp, security door prevents the accidental change of flow rate, low cost disposable set provides maximum safety, traditional grip, reliable flow control, and ergonomic shape, provided with specialised y type injection port made up of silicone for additional medication, dehp free, sterile , individually packed. , kit for angiography ( radial) : kit should contain 1.) radial sheath (should be usfda approved) 1pc 2.) diagnostic catheter (should be usfda approved) 1 pc 3.) guidewire 0.035 x 150 1 pc 4.) pressure line m/f 1 pc 5.) manifold 2 port 1 pc 6.) luer lock syringe 10ml 1pc , kit for angiography ( femoral) : kit should contain 1.) femoral sheath ( should be usfda approved ) 1pc 2.) diagnostic catheter jl (should be usfda approved ) 1 pc 3.) diagnostic catheter jr ( should be usfda appoved) 1 pc 4.) guidewire 0.035 x 150 1 pc 5.) pressure line m/f 1 pc 6.) manifold 2 port 1 pc 7.) luer lock syringe 10ml 1pc , knee drape : material : 50 gsm sms polypropylene water repellent. overall size 240 x 340cm ; elastic aperture 5cm dia. polysheet lining. 120 x 120 funnel. polysheet lining 1.20 x 1.20m. sterlized pack. 5 years expory life. packing material 45gsm polypropylene one side and another side tyvek paper 25gsm , lamino spinal drape ; material : 50gsm sms polypropylene fabric water repellent ; sheet siz size: 1.5x3.0m ; incise sheet : 15 x 35cm : polysheet lining 1.20 x 1.20cm ; sterlised pack ; 5 yrs expiry life ; packing material : 45 gsm polypropylene one side and another side 25gsm tyvek paper m) ; , lancet device (pricker), hold the lancet for finger prick blood sugar , lancet needle 30 gauge / 31 gauge single use compatible with all type of pricker , lancet safety lancet single use safety device that cannot be used after activation, minimising the risk of needle stick injury and cross contamination between different people. , laryngeal mask airway pvc (disposable) size 1 to 5 , laryngeal mask airway silicon size 1 to 5 , laryngeal mask airway intubating (disposable) all sizes , laryngeal mask airway intubating (reusable) all sizes , laryngeal mask airway standard (disposable) all sizes , laryngeal mask airway standard (reusable) all sizes , laryngeal mask airway with port for naso gastric tube with preformed curve (disposable) all sizes , laryngeal mask airway with port for naso gastric tube with preformed curve (reusable) all sizes , laryngeal mask airway with port naso gastric tube, flexible and no curve (reusable) all sizes , laryngeal mask airway with preformed curve (disposable) all sizes , laryngeal mask airway with preformed curve (reusable) all sizes , leadercath arterial line all size , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 2 x 2 , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 4”x4’ , low porosity felts of ptfe; should have thickness 1.5 to 1.8mm. should have low porosity to control bleeding and for buttress for sutures. size : 6”x6’ , makintosh sheet ( rubber sheet ) roll size : 90cm x 10mtrs , male cath (silicon) all sizes , male urinary incontinence device , malecot catheter 6f to 24f all sizes & length , malecot catheter soft : 6,8,10,12 f (usfda/ce approved) , masimo rd sedlline eeg sensor , masimo rd set , masimo o3 sensor rso2 , mayo trolley cover (75x90cms.) – 1 (exclusion coated heavy duty (imperable waterproff) , measuring jug for urine and other liquid material , metallic telescope dialators for pcnl indian & imported , mettalic tracheo bronchial stent straight all sizes , mettalic tracheo bronchial stent y shaped all sizes , micro suction tubes sizes 9 fr should have a vacuum control port, malleable shaft, should equipped with a length of tubing and clamp terminating with a ¼ in (0.64cm) connector. , mini tracheostomy non seldinger kit , mini tracheostomy seldinger kit , minimally invasive aortic root cannula with length more than 30 cm should have more than 30 cm long body to allow insertion during mics , minimally invasive retrograde cardioplegia cannula with deflecting tipsizes 13 and 15 fr should have tip deflecting models for sinus placement through thoracotomy should be able to allow minimum 10mm sweep.should be auto/ manual inflatable. , mucus extractor, sterile, disposable , multi lumen extension sets (v set) three lines , multi lumen extension sets (v set) two lines , multichannel cardioplegia cannula , multifunctionalmaskdesignedtoadministerhighoxygen&toreducetheriskofco2rebreathing.maskhasa provision of attaching nebulizing chamber to administer nebulization medication. double oxygen tubing available with mask allows for nebulization without interupting oxygen therapy. special opening on sides to accommodate ng and og tubes. accessforhydration,oral suction or oral medicine without interrupting oxygen therapy.fda approved. (mask, adapter, two 7 oxygen tubing & nebulizing chamber) , multiple use injection port for syringes , multiple stage venous cannula should have polyurethane wire wound body with radiopaque markers and multiple holes at distal end. sizes 23fr. , multiple stage venous cannula should have polyurethane wire wound body with radiopaque markers and multiple holes at distal end. sizes 29fr. , mva kit ( manual vaccum aspiration kit ) one pack of double valve kit must contain 1 pc double valve syringe , connectors, lubricating oil , and 1 pc cannula of each size 4,5,6,7,8,9,10,12mm , napkin absorbant all sizes , nasal cannula, infant , nasal cannula, neonate , nasal cannula, premature neonate , nasal cpap 10cm h20 , nasal pack 4.5 cm , nasal pack 8.0 cm , nasal pack with airway 8.0 cm , nasal prongs (disposable) for neonates , nasal tampoone polymethylene 8cm , nasogastric (ryles) tube ( pvc) with connector size : 6fg / 8fg / 10fg , nasogastric (ryles) tube ( pvc) with connector size : 12fg / 14 fg / 16fg / 18fg / 20fg , nasogastric (ryles) tube ( pvc with silicon elastomer coating) with connector size : 6fg / 8fg / 10fg , nasogastric (ryles) tube ( pvc with silicon elastomer coating) with connector size : 12fg / 14 fg / 16fg / 18fg / 20fg , nasopharyngeal airway : suitable for suctioning in i.c.us and provide an alternative way when oro pharyngeal airway is occluded, design of the tube conforms to the nasopharyngeal anatomy, flexible for maximum patient comfort, tube manufactured in medical grade pvc is soft, flexible and kink resistant, soft material for enhanced nasal passage comfort, atraumatic soft rounded edges and smooth surface, specially designed bevel tip reduces mucosal trauma during insertion, tube marked with the internal diameter for easier size identification, thin wall construction provides maximum inner diameter, interior walls with channel grooves facilitate easy insertion of catheter, removal 15 mm connector to allow connection to ventilation systems, individually packed in peelable pack. size : 3.0mm 8.5mm , nebuliser kits (jet/venturi type) – specialty specific , nebuliser kit with ‘t’ piece for ventilator circuit with oxygen tubing , nebuliser kit with adult mask and oxygen tubing , nebuliser kit with neonatal mask and oxygen tubing , nebuliser kit with paed. mask and oxygen tubing , nebulizer mask with double moulded (soft seal) pvc free aerosol mask with 2.0 mtr. tube, metal nose clip should mri compatible sizes: adult, child , needle cutter: stainless steel alloy adjustable blade,safe,hygiene,easy to use, no maintenance cost,compact & practical dimension , needle for – sacrospinal puncture in pelvic floor mesh repair , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore ext set , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore bi ext set , needless iv system with closed luer access having self sealing silicone split septum with 15 cm extension set bi & tri (not reverse septum) and transparent housing, size : plain, 15cm macro bore tri ext set , needle less syringe 10ml , needle less syringe 2ml , needle less syringe 3ml , needle less syringe 5ml , nelatonurinarycatheter size 6fr 20 fr , neontal weighing machine up to 5 kg , neuro patch 1.5cm x 3cm , neuro patch 2cm x 10cm , neuro patch 4cm x 5cm , newborn kit (consisting of neonatal front open clothes, bib, cloth diapers, baby towel, wet wipes , nibp cuff (all sizes for neonates) compatible with mindray multipara (neonatal) monitors. , noninvasivepositiveairwaypressuredevicewithamouthpiece,walloxygenport&manometerport&can accommodate nebulizer for aerosol therapy , non vented niv masks. disposable, full face mask, for use with niv module of invasive mechanical ventilators, should be completely air tight, no vent should be present over surface of mask, there should be facility to increase or decrese the mask tightness. , one piece pediatric aortic cannula size 6fr 16 fr vented, should be beveled with thin wall tips and should be elongated one piece. size 6fr. / 8fr. / 10fr. / 12fr. /16fr. / 18fr. , ophthalmology hydrophilic acrylic foldable lense optic diameter 6.00mm, overall length 12.50mm, a constsnt 118.00 , ophthalmology hydrophilic acrylic foldable lense optic diameter 6.00mm, overall length 12.50mm, a constsnt 118.00, fully aspheric optics with 360 degree squareedge , ophthalmology hydrophobic foldable single piece intraocular lense , ophthalmology hydrophobic foldable acrylic lens with preloaded injecting system diameter 6.00mm, overall length 13.00mm, a constant 118.4, fully aspheric optics. , ophthalmology hydrophobic foldable acrylic lens semi preloaded, natural yellow, chromophore, 360 degree, square edge, fullr aspheric optics diameter 6.00mm, overall length 13.00mm, a constant 118.4 , ophthalmology hydrophobic acrylic foldable lens diameter 6.00mm, overall length 13.00mm, a constant 118.40 , ophthalmology pmma , ophthalmology amniotic membrane , ophthalmology balanced salt solution with and without glutathian bss plus & bss plain , ophthalmology c3f8 gas for intraocular use , ophthalmology side port blade , ophthalmology cresent blade , ophthalmology keratome blade , ophthalmology implant blade , ophthalmology mvr virectomy blade , ophthalmology glaucoma valve implant / drainage devices , ophthalmology intraocular lens implant (multipiece) foldable , ophthalmology intraocular lens implant (single piece) foldable (firm should quote their higher version/medium and lower version lenses. , ophthalmology laser probe (curved) 23g, 25g , ophthalmology ologen collagen matrix implant , ophthalmology phaco pack for infiniti vision system , ophthalmology sterile eye drape and pad , ophthalmology viscous fliud injector pack , ophthalmology vitrectomy total plus pack valveless in 23 g and 25 g , oro pharyngeal airway : disposable guedel airway 0 no, 00 no, 000 no, 0000 no. , oro pharyngeal airway : disposable guedel airway 1, 2, 3, 4, 5, 6 no. , ostial perfusion cannula with basket tip and soft convex tip sizes 10 fr, 12 fr and 14 fr. should have flanged, radiopaque basket tips/soft tips attached to malleable stainless steel shafts. size 10 fr./ 12 fr. / 14fr. , oxygen mask high concentration with reservior bag , oxygen mask with non rebreathing reservoir bag with 2 3 meter long oxygen tubing , oxygen mask with bacteria filter , oxygen mask with capnography port adult , oxygen mask with co2 monitoring line, adult , oxygen twin bore nasal cannula soft tip curved with tubing adult paed, neon , oygen mask double moulded (soft seal), pvc free oxygen mask sizes adult, child , oxygenator without integrated filter ( adult ) , oxygenator without integrated filter ( paediatric ) , packed red cell & whole blood leucocyte reduction filters. bedside filtration of one & two unit of packed red blood cells or whole blood should have universal spike with microbiological recovery vent, should be with attached straight administration set/automatic self leveling drip chamber performance shouldconsistently average less than 2x105 residual leukocytes per unit, red cell recovery should average greater than 90%. filter housing hold up volume should be <25ml for one unit filter and <35ml for two unit filter it should be single use should be latex free , patient identification band along with logo of rims for mother & baby (combined) , patient identification band along with logo of rims for adult & pediatric , pauls tracheal culture bottle simplifies procedure for sampling of tracheal fluids, secure sterile bottle ensures accuracy of culture tests, vaccum coltrol connector allows easy and quick sampling procedures , graduated suction tubes allows a reading for depth of intubation , pa vent cannula should have a soft, pliable tip with female luer end; should have movable depth marker and an introducer needle should be included. , pcn dilators 6 14 fr , pcn set 10fr , pcn fascial dilator 6fr onwards (indian & imported) , peadritic closed suction with y adapter with colored coded silicon catheter, blunt tip, size 5fr, 6fr, 7fr, 8fr, 10fr , pediatric and adult intraosseous needle , pediatric central venous catheter (femoral) 16/18 and 18/20 gauze , pencil ( all types of electrode tips) , penile cateter large/medium/small , permanent double lumen dialysis curved catheter with split tip,cuff and airguard valve introducer size 14.5f length 19cm, 23cm, 24cm , pigtail stents 7fr/5cm,7fr/10cm, 7fr/15cm, 10fr/15cm, 10fr/5cm, 10fr/10cm, 10fr/15cm , plain sheet large for ot table. 25 micron thick pe hygine film , size 120 x 210cm, note: product should be in sterilized pack.packet material 45 gsm polypropylene one side and another side 25gsm tyvek paper with 5 years expiry life. , plain sheet for instrument table 25 micron thick pe hygine film , size 120 x 150cm, note: product should be packed in sterilized pack.packet material 45 gsm polypropylene film one side and another side 25 gsm tyvek paper with 5 yrs expiry life , plasma exchange kit , plasma exchange kit for multifiltrate , plasma filter 0.2m2 , plasma filter 0.5m2 , plastic apron (above knee length), disposable (sterile, packed individually) , plastic apron (long below knee length) , disposable (sterile, packed individually) , pop bandage different sizes 10cm x 2.7mtrs , pop bandage different sizes 15cm x 2.7mtrs , posterior vitrectomy pack constellation, for retinal surgery 23g and 25g , postrier vitrectomy pack oertli for retinal surgery 23g and 25g , pre filled sterile normal saline flush device (3ml) , pre filled sterile normal saline flush device (5ml) , pre filled sterile normal saline flush device (10ml) , pre filled terminally sterile flush syringes of normal saline in 3 sizes:3ml , pre filled terminally sterile flush syringes of normal saline in 3 sizes:5ml , pre filled terminally sterile flush syringes of normal saline in 3 sizes:10ml , premature soft tip nasal cannula should have soft tip nasal cannula with tubing. ce marked. , pressure domes compatible with maquet heart lung unit , pressure dressing all types , pressure infusion bag disposable 0.5 ltr , pressure infusion bag disposable 0.5 ltr with manometer , pressure infusion bag disposable 1.0 ltr. , pressure infusion bag disposable 1.0 ltr. with manometer , pressure infusion bag reusable 0.5 ltr with manometer , pressure infusion bag reusable 1.0 ltr. with manometer , pressure extension line low pressure large bore extension line madeup of pvc 10cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line low pressure large bore extension line madeup of pvc 150cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line low pressure large bore extension line madeup of pvc 200cm ; used primarily to connect the transcducer system to the indwelling catheter ; male leur lock at one end and 3 way stop cock at other enabling the user to run 2 lines simultaneously. 3 way stop cock may be used for blood sampling and extra medication. can sustain a pressure upto 7kg/ cm² or 100 psi. sterile individually packed in blister pack. , pressure extension line 100cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line 150cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line 200cm : small bore high pressure extension line ; made of clear non toxic medcal grade pvc material ; suitable for high pressure monitoring and for connection between syringe, infusion pump and the patient ; multipurpose extension line provided with male leur lock at one end and female leur lock at other end and fits all standard equipment ; leur lock connector provides secure fittings ; can sustain a pressure upto 10 kg/cm² or 140 psi ; sterile and individually packed in blister pack , pressure extension line high pressure monitoring line100cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure extension line high pressure monitoring line150cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure extension line high pressure monitoring line200cm :dehp free polyethylene high pressure monitoring extension line, non reactive and highly compatible to all the commonly infused fluids, small bore high pressure extension line suitable for high pressure applications, for example as connection between syringe, infusion pump and the patient, provided with male and female luer lock at either ends, which facilitates secure fitting to all standard euipment, luer lock connectors provide secure fitting, can sustain a pressure upto 40 kg/cm² or 560 psi , pressure transducers single dome disposable with the provision of free supply of interface adaptors/cables for all monitors like philips viridia, philips transport, datex, mindray, ge and dash monitors (and 20% extra, total approx. 300) that would be in use in rims for the entire period of rate contract , pressure transducers double dome disposable with the provision of free supply of interface adaptors/cables for all monitors like philips viridia, philips transport, datex, mindray, ge and dash monitors (and 20% extra, total approx. 300) that would be in use in rims for the entire period of rate contract , promethus system – consists of prometh 1 adsorber, prometh 02 adsorber, albuflow afo 1, blood line primary and secondary set, f 60 dialyser, y – adapter, spike adapter and dialyser exchange set , pulse oximter hand held finger . oxygen saturation range: 0 100%, pulse rate range: 15 320, measurement wavelengths and output power* 1. red: 6 0 nanometers @ 0.8 mw maximum average, 2. infrared: 910 nanometers @ 1.2 mw maximum average, %spo2 accuracy: 70 to 100% ± 2 digits, pulse rate accuracy (20 250bpm): ± 3 digits, internal power:battery: two 1.5 volt aaa batteries, operating life: 600 spot checks (30 secs/spot check) in a 6 month period, storage life: 12 months, weight < 75 gms, iec certifitied with respect to operating temperature, humidity and altitiude, 5 year warranty , puncture needle y shape (extra port) 18 g, 20 g 4cm, 7cm , puncture needle 18 g puncture needle, 90 mm length, 1.20 mm diameter, sharp beveled tip, hub of needle should admit 0.038”aus guide wire, e.g. vygon type , respiratory face mask (n 99), filters 99% of particles, folded mask dimension 240 x 85 mm, thickness 3.6 mm, green colour, duckbill shape, ear loop (elastic bands), ce, iso, en , retrograde cardioplegia cannula with auto inflate sizes 13 fr and 15 fr should have silicon/ pvc bodies with auto inflatable cuff and pressure monitoring lines; should have multiport tip/ integral stopcock. sizes 13 fr , retrograde cardioplegia cannula with auto inflate sizes 13 fr and 15 fr should have silicon/ pvc bodies with auto inflatable cuff and pressure monitoring lines; should have multiport tip/ integral stopcock. sizes 15 fr , reusable cautery pad, whole body size. pediatric, adult, neonatal (gel pad type) , reusablepulseoximetrysensorneonate(masimosettechnology)(withtheprovisionfofreesupplyofinterface adaptors /cables for allmonitors like radical masimo, mindray etc (and 20% extra, total approx. 100) that would be in use in rims for the entire period of rate contract , reusable silicon bipolar cable , reusable spo2 (pulse oxymeter) sensor with lead (forall monitors like philips viridia, philips transport, ge, datex, mindray and das monitors) pulse oxymeter machine , scalp vein set all sizes , shoe cover (in pair) disposable : • should be of good quality (thick) • made from non toxic non woven, thick fabric. • well stitched in universal regular size. • skid resistant & dust proof. • hard elasticated for better grip and easy to wear. • should cover the ankles. • size: assorted (std. size of shoe from 7 to 12) & blue color. , silicon ostial cannula for continuous perfusion sizes 15 fr,17fr and 20 fr should have a silicon body with soft bulb shaped tips, should have a female luer connection site. , single stage venous cannula with metal tip sizes 12 31 fr , should have kink resistant wire wound taper body with beveled metal tip. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr. , single stage venous cannula with right angle, should have kink resistant wire wound taper body with tapered multiport tips. should be right angled with plastic tip. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr./30fr. / 32fr. / 34 fr. / 36fr. / 38fr. / 40fr. , single stage straight venous cannula malleable, should have kink resistant malleable wire wound taper body with tapered multiport tips. sizes 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. / 26fr./ 28fr./30fr. / 32fr. / 34 fr. / 36fr. / 38fr. / 40fr. , skin punch biopsy needle , skin stapler with multiple pins preloaded (all type & all sizes) , skin staples remover all types and all sizes , snake suture organizer , spinal needle for interventional pain procedures in painot ; size 16g to 27g , spinal puncture needle. all sizes (gauge & lengths) , spinal needle with pencil point having 1mm side hole opening, having clear transparent groved hub and colour coded stylet, instoducer needle 20g x 13/8. size 25g x 3 1/2 (0.53 x 88mm) and 27g x 3 1/2 ( 0.73 x 88mm) , stent metallic ureteral stent for temporary stenting of the ureter, coil design, 6f, length 26 cm , stent soft ureteral stent set with monofilament tether stent with graduation marks to aid in placement along with monofilament tether for repositioning and ease of removal, pigtail straightener, stent positioner with radiopaque tip, and wire guide , sterile gauze swab 12ply sizes 5cm x 5cm , sterile gauze swab 12ply sizes 7.5cm x 7.5cm , sterile gauze swab 12ply sizes 10cm x 10cm , sterile surgical pad / combine dressing ( absorbant cotton pad with non woven fabric ) size 10cm x 10cm , sterile surgical pad / combine dressing ( absorbant cotton pad with non woven fabric ) size 10cm x 20cm , sterilization reel medical grade paper reel for sterilization, compatible to eto size 5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 7.5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 10cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 12.5cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 15cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 20cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 25cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 30cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 35cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 40cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 45cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 50cm with 200m length , sterilization reel medical grade paper reel for sterilization, compatible to eto size 60cm with 200m length , stethoscope , stone basket 3f 4w , stone basket 4f 4w , stone basket 5f 4w , stone basket zero tip 3fr 1.9 , stone basket/nitilon 3fr 1.9 , stone extraction balloon (above injection port) , stone extraction balloon (below injection port) , stone extractor tipless 4.5 , straight tip arch cannula vented and non vented; pediatric and adult, should be beveled thin wall tips attached to tapered cannula bodies. should be available in pediatric and adult sizes. size 8 fr./ 10fr. / 12fr. / 14fr. / 16fr. / 18fr. / 20fr. / 22fr. / 24fr. , streaming microwire , suction catheter plain – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter thumb control sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter flower tip – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction catheter atraumatic tip – sizes 5fr , 6fr, 8fr, 10fr, 12fr, 14fr, 16fr , 18 fr , suction machine electrical driven , suprapubic drainage catheter for cystostomy and supra pubic drainage size : 12frto 22 fr , surgeons cap disposable: • should be of good quality • made from non woven breathable fabric of 35 gsm • well fitting with back elastic or string. • air permeable. • properly ultrasonically sealed for uniformity. • different sizes & color. , surgical blade with plastic handle disposable (individual sterile pack) all sizes , surgical blades , carbonated steel all types and sizes. high quality, sterile, individually packed. , surgicalbladeswithsafetyhandles&disposablelock,highperformancescalpelblades,sterilizedbygamma radiation,available in varioussizes,in both highcarbon& stainlesssteel,each bladeispacked in aluminium,carbon steel blades are vpi paper protected,blade no. 10,11,12 & 15 fit on all no. 3 fitment handle,blade no. 18,19,20,21,22,23,24,25,36 fit on all no. 4 fitment handle , surgical blades without handle, all sizes disposable (individual sterile pack) , surgicalblades,carbonated/steelalltypesandsizes.highquality,sterile,individuallypacked.conformingto usfda , surgical disposable gown for use in the o.t., icu, cath lab etc. as a protective covering, for operating, impervious to transferofmicroorganisms,bodyfluidsandparticulatematter.thegowncomprisedofasinglelayerofsms (spunbond/meltblown/spunbond)polypropylenefabricmanualclosurewith2waterabsorbantpapertowels,size (small, medium, large, extra large) aami , surgical eye drape , surgical gown sterile breathable impervious to water / blood / bacteria. should be lint resistance / flame resistance. fabricshouldbereinforcedinkey areasforhighfluidcontact.shouldbeavailableindifferentsizes,wrappedin smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670 / 1671.prefered standard is en13795 , surgical gown sterile breathable impervious to water / blood / bacteria. should be lint resistance / flame resistance. fabric should be reinforced in key areas for moderate fluid contact. should be available in different sizes,wrapped in smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670 / 1671.prefered standard is en13795 , surgical gown sterile breathable impervious to water/blood/bacteria, should be lint resistance/flame resistance. fabric should be non reinforced for low fluid contact. should be available in different sizes,wrapped in smmms fabric with 2 lint free towels, all information such as standard,manufacturer name, contents, should be printed on package. desired standard is astm f1670/1671. prefered standard is en13795 , surgical gowns large, xtra large, l xtra long, breathable performance fabric, raglan sleeves, colour coded neck binding red, adjustable hook & loop neckline, low linting fabric, book fold, ce certified & aami level 3/en 13795 high performance , surgical hoods protective 3 layer sms fabric, tie neck, universal size & aami l 4 compliant , surgical mask fog free, flat pleated shape, blue colour, ear ties, anti fog layer, dimention finished: 177 x 95 mm, thickness 45 mm ce, en, iso , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 3ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 5ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 10ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 20ml (with needle) , syringe : luer lok disposable syringes , syringe made of polypropylene plastic (pvc free plastic) syringe nozzle design: luerlok , packing: blister with medical grade paper sterilized with eto , polyisoprene used as stopper (latex free syringe) silicone oil used as lubricant , sizes 50ml (with needle) , syringe toomy , syringe sterile disposable hypodermic syringe for single use with needle , 1ml , syringe sterile disposable hypodermic syringe for single use with needle , 2ml , syringe sterile disposable hypodermic syringe for single use with needle , 3ml , syringe sterile disposable hypodermic syringe for single use with needle , 5ml , syringe sterile disposable hypodermic syringe for single use with needle , 10ml , syringe sterile disposable hypodermic syringe for single use with needle , 20ml , syringe sterile disposable hypodermic syringe for single use with needle , 50ml , syringe sterile disposable hypodermic syringe for single use without needle , 1ml , syringe sterile disposable hypodermic syringe for single use without needle , 2ml , syringe sterile disposable hypodermic syringe for single use without needle , 3ml , syringe sterile disposable hypodermic syringe for single use without needle , 5ml , syringe sterile disposable hypodermic syringe for single use without needle , 10ml , syringe sterile disposable hypodermic syringe for single use without needle , 20ml , syringe sterile disposable hypodermic syringe for single use without needle , 50ml , syringe sterile disposable hypodermic syringe for single use without needle , 0.5ml , syringe sterile single use , reuse prevention syringe with detachable needle , 2ml , syringe sterile single use , reuse prevention syringe with detachable needle , 3ml , syringe sterile single use , reuse prevention syringe with detachable needle , 5ml , syringe sterile single use , reuse prevention syringe with detachable needle , 10ml , syringe bulb irrigation 50ml , syringe insulin 1ml , t piece connector for ventilator circuit (all male female combinations) , t piece connector with expandable tubing and oxygen tubing of 3 meter. , t piece in line self sealing , t piece resuscitator circuit, disposable,1.6 metres long, for use with mechanical infant resuscitator during resuscitation of newborns , temporary pigtail pacing wireshould include unipolar atrial and ventricular pacing, pediatric unipolar pacing, and the bipolar pacing lead. , thermometer digital (should be 100% mercury free, should have dual display of body temperature (°c & °f), should be ce marked , thermometer disposable tympanic , thermometer rectal & infrared , thoracic drainage catheter size : 12fg/ 14fg / 16fg / 20fg / 24fg / 28fg / 32fg , thoracic drainage catheter with trocar size : 8fg / 10fg / 12fg / 14fg/ 16fg / 20fg / 24fg / 28fg / 32fg / 36fg , three stage venous cannula, should be three stage venous cannula for vacuum assisted venous drainage(vavd) / kinetic assisted venous drainage(kavd) sizes 29/29/29 fr , three stage venous cannula, should be three stage venous cannula for vacuum assisted venous drainage(vavd) / kinetic assisted venous drainage(kavd) sizes 29/46/37 fr , three way stop cock , three way stop cock without any dead space (placenta system) , titanium clips, all sizes and all types alogwith provision of free applicators , tmt paper 215x280mm compatible with shiller tmt machine , tracheal tube introducer (bougie) : should provide rigidity to endotracheal tube to facilitate et intubation , should habe iltra smooth surface for low friction , should have a traumatic angled tip, should have marking provided all along tube to facilitate identification of tube position , should have vented lumen for oxygen feed size 6fr, 10fr, 15fr , tracheostomy button / decannulation plug , tracheostomy cover bib , tracheostomy mask adult , tracheostomy mask paed , tracheostomy speaking valve , tracheostomy tube – cuffed , sizes 3.5mm, 4mm, 4,5mm, 5mm, 5.5mm, 6.0mm, 6.5mm, 7.0mm, 7.5mm, 8.0mm, 8.5mm, 9.0mm, 9.5mm, 10mm, , tracheostomy tube – uncuffed , sizes 3.5mm, 4mm, 4,5mm, 5mm, 5.5mm, 6.0mm, 6.5mm, 7.0mm, 7.5mm, 8.0mm, 8.5mm, 9.0mm, 9.5mm, 10mm , tracheostomy tube (pvc siliconised) cuffed with disposable inner cannula, all sizes , tracheostomy tube (pvc siliconised) cuffed with integrated subglottic suction port, all sizes , tracheostomy tube (pvc siliconised) cuffed with single cannula (without inner cannula), all sizes , tracheostomy tube (pvc siliconised) cuffed with tapered distal tip and inverted cuff shoulder, all sizes , tracheostomy tube (pvc siliconised) uncuffed with disposable inner cannula, all sizes , tracheostomy tube pvc – siliconised, uncuffed with single cannula (without inner cannula), all sizes , tracheostomy tube pvc siliconised with adjustable length/flange, all sizes , tracheostomy tube reinforced with adjustable flanges all sizes , tracheostomy tube silicon cuffed with cuff volume maintenance device, obturator, tracheostomy tube tie and 15 mm disconnect wedge. – sizes 5,6,7,8 , tracheostomy tube with fenestration, all sizes , tracheostomy tube (pvc siliconised) cuffed with reusable inner cannula, all sizes , tracheostomy tube, neonatal, uncuffed, size 2.5mm , tracheostomy tube, neonatal, uncuffed, size 3.5mm , tracheostomy tube, neonatal, uncuffed, size 3mm , tracheostomy tube, neonatal, uncuffed, size 4mm , tracheostomy tubes reinforced with cuff pressure monitoring all sizes , tracheostomy tubes silicon cuffed (air cuff) adult sizes 5, 6, 7, 8, 9 , tracheostomy tubes silicon uncuffed adult sizes 5, 6, 7, 8 , tracheostomy tubes silicon uncuffed neonatal sizes 2.5, 3, 3.5, 4 , tracheostomy tubes silicon uncuffed pediatric sizes 4.5, 5 , tracheostomy tubes with cuff pressure monitoring all sizes , tur set , tur loop cutting , u bag standard (made of medical grade non toxic,biocompatible p.v.c. sheets,two layered,laminated pvc sheet to avoid any leakage/seapage,providing hanging & carrying systems) , ubarpack /ubarpackvi oneouterwrap35x 35,onesuture bag,oneu drapewith controlreinforcement 75x124, one bar drape with control reinforcement 70x98 & ce certified, aami l 4 compliance , ultrasound jelly ( 250 gms tube ) , ultrasound jelly ( 5kgs jar ) , ultrasound transducers water balloon , umbilicalcatheter,radio opaqueandtransparentpvc,distancemarkingseverycentimeterfrom5 25cm,flexible thermo sensitive material with open and rounded distal tip, fr 03,04,05,06,07,08 , umbilical cvc no plain, fr 04/fr 05/fr 06 , umbilical double lumen catheter, polyurethane size: fr 2.5, length 30cm , umbilical single lumen catheter, polyurethane all size & all length for neonates , under buttock drape with fluid collection pouch 101.5cmx112cm, control plus absorbent pad , under pad sheet size 60 x 90cm , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 500ml ( single chamber ) , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 1000ml ( single chamber ) , under water seal drainage system used to remove air or fluid or pus (empyema) from the intrathoracic space ; should be made of non tosix medical grade pvc ; bottle should be with graduation marking to determine precise drain volume ; should have cleare initial level marking for easy and correct usage ; should have suction port to connect bottle with suction ; universal connector and kink resistant tubing for smooth unrestricted flow ; hangers should be available for ease of use ; capacity 2000ml ( double chamber ) , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe 60x60 cm – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 120x150 cm – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe 40x60 cm, – individual unsterile pouch pack , underpad/underlay/protective sheet with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 80x175 cm – individual unsterile pouch pack , underpad/underlay/protective sheet, with cushion made up of non woven spunlac fabric of 40gsm laminated with 12 micron ldpe, 60x90 cm,– individual unsterile pouch pack , universal pack major, 1 back table cover, zone reinforced, 44x90, 112cm x 229cm, 1 mayo stand cover,reinforced,23x54,58cmx 137cm,1 suture bag,1 absorbenttowel,15x22,38cm x 56cm, utility drapes,25x15,63.5cmx55.5cm,withtape,1suturebag,1bottomdrapewithcontrol*plus,76x76,193cmx 193cm, 1 top drape with control*plus, 108 x 50, 274 cm x 127cm, 2 side drapes with control*plus, 44x76, 112 cm x 193cm , universal pack minor, 1 back table cover, zone reinforced, 44x88, 112cm x 224cm, 1 mayo stand cover, reinforced, 23x54, 58cm x 137cm, 1 suture bag, 1 bottom drape with surround, 65x76, 165cm x 193cm, 1 top drape withsurround, 109 x 59, 277 cm x 150cm, 2 side drapes with surround, 45x33, 114 cm x 84cm , urchin heart positioner , ureteral access sheath all sizes and types (8, 10,12,14 fr) , ureteric catheter 3,4, 5,6 fr , ureteric dialation set – teflon (indian) , uretheral catheter open end + closed end different sizes 3, 4, 5 6, 7, 8 , uretheral dialator (teflon) all sizes indian , uretheral stent siliastic 6f, 8f & 10f without balloon catheter used in padiatric urethroplasty , uretheral stents double j stent different sizes , uretheral stents mono j stent different sizes , uretheral stents triple j stent different sizes , urethral dilation set 5f to 20 f , urethral splint : 6,8,10,12,14 f , urine collection bag, graduated in ml with measured volume meter for accurate measurement of urine, also available with needle free sampling port , inlet tube length 120cm, capacity of urine collection bag 2000ml, soft, frosted and kink resistant pvc tubing with t type bottom outlet, available with molded hanger for easy handling. , urinal – autoclavable , urine pot with measure plastic (female) , urine bag with t type bottom outlet for single hand operation and efficient emptying of the bag, capacity 2000ml, tube length 100cm , urine bag for paediatrics , urine bag leg bag set , urine collecting bag, neonatal size , urine pot with measure plastic (male) , urine sample collection bag with sticker (paed) , uro dynamic catheter double lumen 5f , uro dynamic catheter double lumen 7f , uro dynamic catheter triple lumen 7.4f 30cm , urosticks , urostomy one pc pouch * urostomy pouch * cut to fit * softlex skin barrier * without starter hole * without tape border * odour barrier rustle free film * with comfortwear panels boy side only * barrier opeing up to 38 mm & pouch length 22 cm. , urostomy pouch , urostomy pouch with accuseal tap, standard opaque with flange 38,45,57 cm , urostomy/vesicostomy bag (pediatric) , urovac bladder evacuator material latex , uternie evacuation kit double valve aspirators to generate a vacuum equivalent to that of eva, should be steam auto clavable at121 degreecelsius(250degreef)for30minutes,itshould be 610 660 mm(24 26 in)hg vacuumis comparable to eva, usfda approved. , venous cannulae single stage. (neonate) thin flexible wire reinforced straight open light house tip. overall lengthapprox.28cm with ¼ acceptance size 12fr, 14fr and 16fr , vented niv masks s, m, l. disposable full face masks forcpap/bipap machines, should be compatible with all available machines, cushioning technology to maximize comfort, sealing technology to minimize leakage,harness should be easy to remove and reattach. , ventilator/breathingcircuitwith‘y’connector–paediatric.(smoothboretubingwiththesmoothinnerlumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector – adult (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector– neonate. (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator /breathing circuit with ‘y’ with mdi port connector – paediatric. (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator tubings for neonates , ventilator/breathing circuit with ‘y’ connector – adult (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventilator/breathing circuit with ‘y’ connector –neonate (smooth bore tubing with the smooth inner lumen surrounded by the kink resistant spiral bound casing, with an additional protective outer smooth cover) , ventricular catheter , ventricular catheter passer , ventricularexternalcsfdrainagesystem(containingonebag,oneventricularcatheterwithstylet,connector, trocar, catheter anchoring collar, connecting tube) , ventricular part of hydrocephalus shunt , ventricular peritonial shunt (paed) system like ceredrain system , venturi mask adult , venturi mask paediatric , veres needle all types and all sizes , vertical isolation drape for dhs, drape size 90x126, 229cm x 320cm, clear film, adhesive incise area 16x30, 41cm x 76cm, tube holders, centralrelease tape strip forhorizontal rod attachment, fluid collection pouch with suction port, ce certified, aami l 4 compliance , vertical tube attachment device all type & all sizes , vessel cannula with and without valve should have clear and radiopaque bodies.these should terminate with a female luer.should have tips in various sizes and shapes. sizes 2mm,3mm, 4mm , vessel dilator 10f,12f,14f coons type , vessel tip 16g /17 g , voice prosthesis system like provox trachphone , vp shunt (adult) with high pressure , vp shunt (adult) with low pressure , vp shunt (adult) with medium pressure , waterproof sterile ostomy cover , waterproof sterile wound cover , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 10cm , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 20cm , waterproof wound dressing with non adherent absorbant pad , transparent p.u. film dressing with hypoallergenic adhesive, non woven absorbent pad, silicon paper release liner, size 10cm x 25cm , waterproof silk protein and nanocrystalline silver based sterile transparent pu film surgical wound dressing with adhesive border and center non adherent pu foam high absorbent layer 15x15cm , waterproof silk protein and nanocrystalline silver based steriletransparent pu film surgical wound dressing with adhesive border and center non adherent absorbent layer 10x25cm , water repellant silk protein and nanocrystalline silver based sterile antimicrobial non woven surgical wound dressing with adhesive border and center non adherent absorbent layer 10x25cm , water repellant silk protein and nanocrystalline silver based sterile antimicrobial non woven surgical wound dressing with adhesive border and center non adherent absorbent layer 10x30cm , weighing machine digital up to 150 kg , wide area fixation dressing stretchable and wash proof , winged infusion set non coring needles with injection site to access ports, various sizes 20g x 1.00, 22g x 1.00, 19g x 1.00, 22g x 0.5, 20g x 0.75, 22g x 0.75, 20g x 1.5 & 22g x 1.5 , wire enforced arterial cannula (6 fr to 20 fr) , wrapping sheet cotton (dosuti) 1.5 mtrs x 2.5 mtrs for dead body , wristbands(strechable,waterresistant)allsizes adults,pediatricandneonates;differentcoloursforpatient identification , y connector for biventricular shunt , y connector with ultra long ventricular catheter , y connector with xi ventricular catheter , y set for endoscopic irrigation during turp procedure , yankaur suction vacuum control handle with flexible kink resistant tube, sterile, disposable , single pack (all sizes) , zine paste bandage , polypropylene mesh size 6cm x 11cm , polypropylene mesh size 7.6cm x 15.2cm , polypropylene mesh size 15cm x 15cm , polypropylene mesh size 30cm x 30cm , bidirectional & unidirectional tissue control device of various strenght and various size ; unidirectional 20cm, 3.0, 17mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; unidirectional 20cm, 4.0, 17mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; unidirectional 45cm, 3.0, 19mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ;unidirectional 45cm, 4.0, 19mm , bidirectional & unidirectional tissue control device of vaarious strenght and various size ; bidirectional 7x7, 5.0, 19mm , chromic gut suture, with needle, size 1 0, 152cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 1, 152cm, 1/2 circle rb heavy 40mm , chromic gut suture, with needle, size 2, 152cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 1, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 2, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 1 0, 100cm, 1/2 circle rb mayo 45mm , chromic gut suture, with needle, size 3 0, 76cm, 1/2 circle rb 20mm , chromic gut suture, with needle, size 2 0, 76cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 1 0, 76cm, 1/2 circle rb 30mm , chromic gut suture, with needle, size 2 0, 76cm, 1/2 circle rb 40mm , chromic gut suture, with needle, size 1 0, 76cm, 1/2 circle rb 40mm , chromic gut suture, with needle, size 1, 100cm, 1/2 circle rb heavy 50mm , chromic gut suture, with needle, size 1, 76cm, 1/2 circle rb heavy 40mm , triclosan coated polyglactin 910 antibacterial 45 cm , 1/2 circle oval round body, needle 16 mm, size 5 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 70 cm , 1/2 circleround body, needle 20 mm, size 4 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 1/2 circleround body, needle 30 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 1/2 circleround body, needle 30 mm, size 0, box of 12 foils , triclosan coated polyglactin 910 antibacterial 90 cm , 3/8 circle cutting, needle 25 mm, size 3 0, box of 12 foils , triclosan coated polyglactin 910 70 cm , 1/2 circleround body, needle 30 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body, needle 40 mm, size 2 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body, needle 40 mm, size 0, box of 12 foils , triclosan coated polyglactin 910 90 cm , 1/2 circleround body (heavy), needle 40 mm, size 1, box of 12 foils , triclosan coated polyglactin 910 70 cm,1/2 circle round body (heavy),needle 40 mm,size 1, box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle reverse cutting needle 40mm,size 2 0,box of 12 foils , triclosan coated polyglactin 910 45 cm,3/8 circle cutting needle 22 mm, size3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm,3/8 circle cutting needle 26 mm,size 2 0,box of 12 foils , triclosan coated polyglactin 910 90 cm, 1/2 circle reverse cutting os,needle 40 mm,size 1, box of 12 foils , triclosan coated polyglactin 910 70 cm, 1/2 circle round body,needle 20 mm size 3 0, box of 12 foils , triclosan coated polyglactin 910 45 cm,5/8 circle cutting needle 16 mm,size 4 0, box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circlecutting needle 22 mm,size 3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm, 1/2 circle reverse cutting os,needle 40 mm size 2,box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle tapercut, needle 36 mm, size 3 0,box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle tapercut,needle 40mm size 0.box of 12 foils , triclosan coated polyglactin 910 90 cm,1/2 circle reverse cutting os, needle 36 mm size 0,box of 12 foils , triclosan coated polyglactin 910 35 cm,1/2 circle reverse cutting (heavy) port, needle 23 mm size 1.box of 12 foils , triclosan coated polyglactin 910 70 cm, 1/2 circle reverse cutting (heavy)port. needle 23 mm size 1.box of 12 foils , triclosan coated polyglactin 910 45 cm, 1/2 circle reverse cutting os 8 needle 40 mm size 2,box of 24 foils , poliglecaprone 25 , 70 cm,3/8 circle reverse cutting ps 1needle 24 mm,size 3 0,box of 36 foils , poliglecaprone 25 ,70 cm,3/8 circle cutting ,needle 25 mm,size 3 0,box of 12 foils , poliglecaprone 25, 70 cm,5/8 circle round body ur 6 uro,needle 26 mm,size 2 0,box of 12 foils , poliglecaprone 25 , 70 cm,1/2 circle round body,needle 30mm,size 2 0,box of 12 foils , poliglecaprone 25, 70 cm,1/2 circle round body needle 30 mm size 0,box of 12 foils , poliglecaprone 25 , 70 cm,straight cutting, needle 60 mm size 3 0,box of 12 foils , poliglecaprone 25, 70 cm, 1/2 circle round body ,needle 20 mm.size 3 0 box of 12 foils , poliglecaprone 25 , 70 cm, 1/2 circle round body, needle 30 mm.size 2 0 box of 12 foils , poliglecaprone 25 , 70 cm, 1/2 circle round body, needle 30 mm.size 0 box of 12 foils , poliglecaprone 25 , 70 cm,3/8 circle reverse cutting, needle 26 mm,size 3 0,box of 12 foils , nylon suture 70 cm,3/8 circle cutting ,needle 16 mm,size 3 0,box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 26 mm, size 3 0, box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 45 mm, size 2 0, box of 12 foils , nylon suture 70 cm 3/8 circle reverse cutting needle 45 mm size 0,box of 12 foils , nylon suture 100 cm.1/2 circle reverse cutting (heavy), needle 45 mm,size 1, box of 12 foils , nylon suture 150 cm loop,1/2 circle round body,needle 40 mm,size 0,box of 12 foils , nylon suture 100 cm,1/2 circle round body (heavy),needle 40 mm,size 0,box of 12 foils , nylon suture 100 cm,1/2 circle round body (heavy),needle 40 mm,size 1,box of 12 foils , nylon suture 150 cm loop.1/2 circle round body (heavy),needle 48 mm.size: 1,box of 12 foils , nylon suture 100 cm,1/2 circle reverse cutting (heavy),needle 50 mm size 1, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 3 0, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 0, box of 12 foils , nylon suture 70 cm, straight cutting,needle 60 cm , size 2 0, box of 12 foils , nylon suture 70 cm, 3/8 circle cutting,needle 90 cm , size 1, box of 12 foils , nylon suture 70 cm, 3/8 circle cutting,needle 90 cm , size 2, box of 12 foils , black braided silk 90 cm,3/8 circle cutting , needle 16 mm,size 4 0, box of 12 foils , black braided silk 90 cm,3/8 circle cutting , needle 16 mm,size 3 0, box of 12 foils , black braided silk 76 cm,3/8 circle round body, needle 30 mm,size 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 26 mm,size 3 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 45 mm,size 2 0, box of 12 foils , black braided silk 76 cm,3/8 circle reverse cutting, needle 45 mm,size 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 16 mm,size 4 0, box of 12 foils , black braided silk 76 cm,1/2 circle reverse cutting, needle 50 mm,size 2 0, box of 12 foils , black braided silk 76 cm,3/8 circle cutting, needle 60 mm,size 1, box of 12 foils , black braided silk 76 cm,3/8 circle round body, needle 16 mm,size 4 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 25 mm,size 3 0, box of 12 foils , black braided silk 76 cm,1/2 circle round body, needle 20 mm,size 4 0, box of 12 foils , black braided silk 76 cm,1/2 circle round body, needle 20 mm,size 3 0, box of 12 foils , black braided silk 76 cm,1/2 circle tapercut, needle 17 mm,size 4 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 35 mm,size 3 0, box of 12 foils , black braided silk 76 cm,straight round body, needle 50 mm,size 2 0, box of 12 foils , black braided silk 76 cm,straight cutting, needle 60 mm,size 2 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 30 mm,size 2 0, box of 12 foils , black braided silk 90 cm,1/2 circle round body, needle 30 mm,size 0, box of 12 foils , black braided silk 90 cm,1/2 circle tapercut, needle 17 mm,size 2 0, box of 12 foils , black braided silk 76 cm,1/2 circle tapercut, needle 25 mm,size 2 0, box of 12 foils , polypropylene suture monofilament 70 cm , 3/8 circle cutting , needle 22 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 90 cm , 3/8 circle cutting, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut, needle 25 mm, size 0,box of 12 foils , polypropylene suture monofilament 90 cm , 1/2 circle tapercut, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle tapercut double needle, needle 25 mm, size 2 0,box of 12 foils , polypropylene suture monofilament 60 cm , 3/8 circle cutting , needle 16 mm, size 4 0,box of 12 foils , polypropylene suture monofilament 70 cm , 3/8 circle cutting , needle 13 mm, size 6 0,box of 12 foils , polypropylene suture 45 cm, 3/8 circle cutting , needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body double needle, needle 26 mm, size 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body , needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 70 cm, 3/8 circle round body double needle, needle 12 mm, size 5 0, box of 12 foils , polypropylene suture 70 cm, 3/8 circle round body double needle, needle 13 mm, size 6 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle round body(heavy), needle 30 mm, size 0, box of 12 foils , polypropylene suture 150 cm loop , 1/2 circle round body, needle 40 mm, size 0, box of 12 foils , polypropylene suture 150 cm loop , 1/2 circle round body(heavy), needle 48 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm , 1/2 circle round body, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body(heavy), needle 30 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body(heavy), needle 40 mm, size 1, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle round body, needle 30 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle round body, needle 30 mm, size 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body, needle 16 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut, needle 36 mm, size 2 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle round body double needle, needle 25 mm, size 3 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle tapercut double needle, needle 17 mm, size 4 0, box of 12 foils , polypropylene suture 90 cm, 1/2 circle tapercut , needle 17 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle reverse cutting, needle 45 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut double needle , needle 25 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle cutting , needle 16 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut double needle, needle 25 mm, size 2 0, box of 12 foils , polypropylene suture monofilament 45 cm, 3/8 circle reverse cutting, needle 12 mm, size 4 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body, needle 16 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body double needle, needle 16 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 100 cm, 1/2 circle reverse cutting(heavy), needle 45 mm, size 1, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle round body, needle 20 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, straight cutting, needle 60 mm, size 3 0, box of 12 foils , polypropylene suture monofilament 70 cm, 3/8 circle round body double needle, needle 20 mm, size 5 0, box of 12 foils , polypropylene suture monofilament 90 cm, 1/2 circle tapercut(heavy), needle 30 mm, size 0, box of 12 foils , polypropylene suture monofilament 70 cm, 1/2 circle tapercut double needle, needle 17 mm, size 3 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle tapercut double needle, needle 17 mm, size 2 0, box of 12 foils , polypropylene suture 70 cm, 1/2 circle tapercut , needle 17 mm, size 4 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle reverse cutting os, needle 40 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body, needle 20 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 45 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body (heavy), needle 30 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 150 cm loop,1/2 circle round body (heavy), needle 40 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 150 cm loop,1/2 circle round body (heavy), needle 50 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body , needle 20 mm, size 4 0, box of 12 foils , polydioxanone voilet monofilament 70 cm,1/2 circle round body , double needle, needle 30 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 75 cm,1/2 circle round body , double needle, needle 20 mm, size 3 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 40 mm, size 1, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle round body (heavy), needle 40 mm, size 0, box of 12 foils , polydioxanone voilet monofilament 90 cm,1/2 circle reverse cutting (heavy), needle 50 mm, size 1, box of 12 foils , polyester suture 90cm , 1/2 circle tapercutdouble needle, needle 17mm, size 2 0, box of 12 foils , polyester suture 90cm , 1/2 circle tapercutdouble needle, needle 17mm, size 2 0, box of 12 foils , polyester suture 100cm , 1/2 circle tapercut (heavy),needle 45mm, size 2, box of 12 foils , polyester suture 100cm , 1/2 circle round bodyneedle 25mm, size 3 0, box of 12 foils , polyester suture 76cm , 1/2 circle tapercut ,needle 17mm, size 2 0, box of 12 foils , polyester suture 100cm , 1/2 circle reverse cutting,needle 50mm, size 0, box of 12 foils , metal skin stapler extractor , titanium clip engulfs tissue tip to tip closure, blue small 6 clips, size 100 , titanium clip engulfs tissue tip to tip closure, white medium 6 clips, size 200 , titanium clip engulfs tissue tip to tip closure, green medium large 6 clips, size 300 , titanium clip engulfs tissue tip to tip closure, yellow large 6 clips, size 400 , open applicator small 20cm length for 100 clips , open applicator small 20cm length for 200 clips , open applicator small 20cm length for 300 clips , open applicator small 20cm length for 400 clips , laproscopic applicator for 300 clips , laproscopic applicator for 400 clips , bladeless trocars with tissue seperating flap 5mm contain two 05mm*100mm sleeve/ cannula and one 05mm obturator , bladeless trocars with tissue seperating flap 10mm contain two 10mm*100mm sleeve/ cannula and one 10mm obturator , bladeless trocars with tissue seperating flap 12mm contain two 12mm*100mm sleeve/ cannula and one 12mm obturator , disposable curved circular stapler 29mm row 3 , disposable curved circular stapler 32mm row 3 , 60mm disposable linear cutter stapler , 80mm disposable linear cutter stapler , disposable linear cutter reload 60 3.8 blue, cut line 60mm, staple line 64mm , disposable linear cutter reload 60 4.8 green, cut line 60mm, staple line 64mm , disposable linear cutter reload 80 3.8 blue, cut line 80mm, staple line 84mm , disposable linear cutter reload 80 3.8 green, cut line 80mm, staple line 84mm , laproscopic powder endocutter stapler 60mm medium. mec60 340 , powder endocutter reload used with endoscopic linear cutter, 60mm blue, articulation 60 degree both side and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm green, articulation 60 degree both side and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm white, articulation 60 degree both side and rotation 360 degree , disposable shear 36mm for ultrasonic generator , tissue seperating dual layer mesh with plcl barrier 20*25 oval , tissue seperating dual layer mesh with plcl barrier 15*20 oval , tissue seperating dual layer mesh with plcl barrier 15*15 square , mesh fixation device non absorbable 15 spikes , mesh fixation device non absorbable 30 spikes , mesh fixation device absorbable 30 spikes , mesh fixation device absorbable 15 spikes , bladeless trocars with tissue separating flap 10mm contain: two 10mm*100mm sleeve/ cannula and one 10mm obturator , bladeless trocars with tissue separating flap 12mm contain: two 12mm 100mm sleeve/ cannula and one 12mm obturator , disposable curved circular stapler 29mm row 3 , disposable curved circular stapler 32mm row 3 , 60mm disposable linear cutter stapler , 80mm disposable linear cutter stapler , disposable linear cutter reload 60 3.8 blue, cut line 60mm, staple line 64mm , disposable linear cutter reload 60 4,8 green, cut line 60mm, staple line 64mm , disposable linear cutter reload 80 3.8 blue, cut line 80mm, staple line 84mm , disposable linear cutter reload 80 3.8 green, cut line 80mm, staple line 84mm , laproscopic powder endocutter stapler 60mm medium. mec60 340 , powder endocutter reload used with endoscopic linear cutter, 60mm blue, articulation 60 degree both sides and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm green, articulation 60 degree both sides and rotation 360 degree , powder endocutter reload used with endoscopic linear cutter, 60mm white, articulation 60 degree both sides and rotation 360 degree , disposable shear 36mm for ultrasonic generator , tissue separating dual layer mesh with plcl barrier 20 25 oval , tissue separating dual layer mesh with plcl barrier 15 20 oval , tissue separating dual layer mesh with plcl barrier 1515 square , mesh fixation device non absorbable 15 spikes , mesh fixation device non absorbable 30 spikes , mesh fixation device absorbable 30 spikes , mesh fixation device absorbable 15 spikes , eye drape , 26 g disposable needle , 23 g disposable needle , crescent , keratome , site port , lens foldable 16 no. , lens foldable 17 no. , lens foldable 18 no. , lens foldable 19 no. , lens foldable 24 no. , lens foldable 26 no. , lens foldable 26 no. , consumables for dvt pumps and enteral feeding pump – make cardinal health , 73011 sml scd express sleeve t/l intx5 , 73012 med t/l scd express sleeve intx5 , 73013 lge scd express sleeve t/l intx3 , 673656 epump 1000ml non sterile x30 , consumables for crrt and bcm machines,make fresenius medical , ultra flux av600 , av cassette blood lines adults + filtrate line(a/v 143 ml) , multifiltrate substituate line 1heater bags , multifiltrate dialysate line (158ml) , hf female spike adapter , filtrate bag 10l , plasma filter (p1 dry) , plasma filter (p2 dry) , skin electrode , multibic solution , consumables for aerogen solo ultrasonic nebulisers , aerogen solo nebulisers (pack of 10) , aerogen solo convenience pack (pkt of 10) (includes 10 x solo nebulisers, adult tees) , aerogen solo adult tee pieces (pack of 10) , aerogen solo paediatric tee pieces (pack of 10) , continuous neb tube set, tubing assembly only (pack of 5) , continuous neb tube set, syringe & cap only (pack of 5) , continuous neb tube set, syringe & cap only (pack of 50) , aerogen solo single patient use mask kit intl (pack of 5) , aerogen solo single patient use vented elbow (pack of 5) , aerogen pro x controller only , ultra only (pack of 10) adult , ultra only (pack of 10) paediatric , ultra and solo (pack of 10) , aerogen pro control module kit international , aerogen pro usb controller starter kit , aerogen pro nebuliser assembly , aerogen pro filler cap (pkt 5) , aerogen pro adult tee with silicone plug (autoclavable) (pkt 5) , aerogen pro paediatric tee with silicone plug (autoclavable) (pkt 5) , aerogen pro mask kit intl (inc. vented elbow & 22 mm f/22 mm m elbow) (autoclavable) (pkt 5) , battery replacement kit , ultra starter kit (pack of 10) adult mask &solo , ultra starter kit (pack of 10) paed mask & solo , consumables for aerogen solo ultrasonic nebulisers , fx 8 single use dialyser cat no. 5004731 , blood tubing 5008 cat no. f00000384 , peadiatric blood tubing 5008cat no. f00001068 , av fistula needle set (bain avf)16 g cat no. apavf005 , av fistula needle set 17 g cat no. apavf003 , bibag 900 gramm cat no. f00006672 , citrosteril 5 ltrs cat no. ap0005158 , puristerial 340 cat no. 5085621 , diasafe plus cat no. 5008201 , double lumen juglar catheter curved 11.5 f cat no. 817009 , double lumen juglar catheter straight 11.5 fr cat no. 817005 , tripple lumen catheter,std , tripple lumen catheter,std , chlorine test kit cat no. 6316881 , hardness test kit cat no. 6350911 , regeneration salt tablets cat no. 5085531 , compatible part a with bibag , filter cartridge 20 20?m big blue cat no. 6349711 , water inlet filter cat no. m395061 , fx 8 single use dialyser cat no. 5004731 , consumables for hotline fluid warmers , hotline warming set disp 30/ca, l 70 , consumables for patient warmers , snuggle warm, adult full body convective warming blanket 10/bx , snuggle warm, pediatric full body convective warming blanket 10/bx , snuggle warm, upper body convective warming blanket 10/bx , snuggle warm, pediatric underbody convective warming blanket 10/bx , consumables for masimo monitors , pediatric for regional oximetry , sensor disposable for regional oximetery (20/box) , sensor disposable for brain function monitoring (25/box) , sensor disposable for continuous hemoglobin, ori, pvi, spo2, pi (10/box) , disposable neonatal spo2 adhesive sensor (20/box) , clip sensor , rad 97 patient cable , adult bp cuff , hose pipe , filters pod for bed air , pediatric for regional oximetry , disposables and modules for cardiac monitor, make edwards , flotrac cardiac output sensor for hemosphere monitor , cvp transducer with pm line and iv set a. it should be able to give a pressure & waveform on minimally invasive continuous cardiac out put monitor. b.it should be able to give a pressure & waveform on any multipara monitor with ibp module. c.it must have 3±1 ml/hr flow rate across flush device with iv bag pressurized to 300 mm hg. d.it must have moisture resistance connector sheath without pin. e.it should have gold/copper/aluminium plated connector wires. f.it must have an operating pressure range of 50 to 300mmhg, with overpressure tolerance range of 500 to +5000mm hg. g. it must have a provision to put arm strap. h.it should have an integrated flush device which can be operated from any direction for easy accessibility. i.it should have a test port that can be used to check the performance of the transducer when used along with a simulator device for the purpose. , acumen iq sensor a. it must be compatible with hemosphere monitor. b. it must able to provide co,ci,svv,ppv,sv,svi,svri,svr, hypotension prediction index, dp/dt, eadyn. , hypotension prediction index module/software for hemosphere monitor , nirs/ cerebral oximetry module for hemosphere monitor. nirs/ cerebral oximetry sensors – large ,medium, small, neonatal , consumables for high flow, make fisher & paykel , 900pt561heated breathing tube (circuit) + mr290, airspiral™, for airvo 2 (box 10 , opt942nasal interface, optiflow™+, adult, small, for mr850 & airvo (pack 20) , opt944nasal interface, optiflow™+, adult, med., for mr850 & airvo (pack 20) , opt946nasal interface, optiflow™+, adult, large for mr850 & airvo (pack 20) , opt970tracheostomy direct connection, mr850 & airvo (pack 20) , 900pt913filter for airvo 2, pack of 2 , 900mr869probe, airway temp & flow, for use with 1.5m circuits . with right angle connector, , mr850 , 900mr805electrical adaptor dual heated, rt circuits , rt380adult ventilator circuit dual heated + rt019 filter + mr290 chamber (box 10) dual heated , disposables forportable deployable isolation system with negative flow make bed air , filter pod , canopy , negative flow attachment...

Department Of Animal Husbandary And Fisheries - Jharkhand

38664244 bids are invited for meloxicam 5 mg+ paracetamol 150 mg inj (q3) , enrofloxacin 1500 mg bolus (q3) , ceftriaxone inj (q3) , enrofloxacin 10% inj (q3) , ceftriaxone tazobactum inj (q3) , oxytetracycline 5% inj (q3) , oxytetracycline 500 mg bolus (q3) , chlorpheniramin maleate inj (q3) , meloxicam 100 mg+ paracetamol 1500 mg bolus (q3) , isoflupredone inj (q3) , multivitamin syrup (q3) , mineral mixture (q3) , calcium suspension (q3) , heat inducer capsule (q3) , antidiarrhoel powder (q3) , liver tonic with vitamins (q3) , diaminazine aceturate inj (q3) , fenbendazole 3 gm+ ivermectin 100 mg bolus (q3) , amoxycillin dicloxacillin inj (q3) , melonex inj (q3) , xylazine inj (q3) , ketamine inj (q3) , wound spray (q3) , dog shampoo (q3) , dog dewormer (fenbendazole+ praziquentel+ pyrantel pamoate) tab (q3) , ivermectin inj (q3) , amikacin inj (q3) , povidine iodine solution (q3) , bandage 4 inch (q3) total quantity : 21170...

Health Department - Jharkhand

38614118 rate contract for supply of medicine,chemical and consumable item for sbmch,hazraibagh , drugs items : , tab. albendazole (400mg) , tab. anti cold , tab. amlodipine (5mg) , tab. atenolol (50mg) , tab. avil (chalpheniramin (25mg) , tab. azithromycine 250mg , tab. azithromycine 500mg , tab. cefadroxyl 250mg , tab. cefadroxyl 500mg , tab. calcium d3 500mg , tab. cefixime (100mg) , tab. cefixime(500mg) (200mg) , tab. cetrizine 10mg , tab. cipro 500mg + tz 600mg , tab. ciprofloxacine (500mg) , tab. ciprofloxacine (250mg) , tab. amlodipine (10mg) , tab. amlodipine + telmistarn 5+40 , tab. dicolofenae sodium (50mg) , tab. dicolofenc + paracetamol , tab. dicyclomine 20mg , tab. dicyclomine 20 mg + paracetamol 325mg , tab. domperidon (10mg) , tab. fluconazole 150mg , tab. folic acid 5 mg large , tab. ibuprofen 400mg+ paracetamole 325mg , tab. levofloxacin (500mg) , tab. ketrolac (50mg) , tab. cefixime (200mg) , tab. diazepam (2mg) , tab. diazepam (5mg) , tab. chromostat 500 mg , tab. fursemide 40mg , tab. lanoxin 0.25mg , tab. metformin (500mg) sr , tab. astrovastin 40 mg+ fenofibrate 150mg , tab. voglibose (2mg) , tab. voglibose (3mg) , tab. prochlorperazine , tab. p.c.m.d.t. (250mg) , tab. p.c.m.d.t. (500mg) , tab. p.c.m.d.t. (600mg)/ (650mg) , tab. antacid , tab. dilantoin sodium (100mg) , tab. drotaverine (40mg) , tab. nitrocontin (2.6 mg) , tab. nitroglycerin , tab. ecospirin (75mg) , tab. telmisarten (20mg) , tab. telmisarten (40mg) , tab. aceclofenac (100mg) , tab. ondansetron (8mg) , tab. ondansetron (4mg) , tab. chloroquine 300mg , tab. zinc sulphate (20mg) , tab. levofloxacin (250mg) , tab. metoclopramide 10mg , tab. metronidazole (200mg) , tab. metronidazole (400mg) , tab. nefedipine 10/20 mg , tab.norfloxacin 400mg +tinidazole 600mg , tab. ofloxacin 100mg , tab. ofloxacin 200mg , tab. ofloxacin 200mg+ orindazole 500mg , tab. pantoprazole 40mg , tab. paracetamol 500mg , tab. rantidine 150mg , tab. roxythromycine 150mg , tab. roxythromycine 300mg , tab. salbutamol 4mg , tab. tranaxaemic acid + mefenamic acid , tab. vitamin b complex , tab. losartan potassium 50mg , tab. amoxicillin 250 mg , tab. amoxycilline + clavulanuic acid (625mg) , tab. amoxycilline + clavulanuic acid (325mg) , tab. ascorbic acid 500mg , tab. levocetrizine 5mg , tab. erythromoycin 250mg , tab.cepodoxime proxetil , tab. cefuroxime axetil 250mg , tab. cefuroxime axetil 500mg , cap. omeprazole (20mg) , cap. doxycycline (100mg) , cap. cefalexine (250mg) , cap. cefalexine (500mg) , cap. ampicilline 500mg , cap. ampicilline 250mg+ cloxacilline 250mg , cap. amoxycilline (250mg) , cap. amoxycilline (250mg)+cloxacilline 250mg , cap. amoxycilline (500mg) , cap. nifediepin (5mg) , cap. cefalamine (500mg) , cap. cefalamine (250mg) , inj. drotaverin 2 ml , inj. theophyillin + ethophyillin ampl. , inj. metochlopramide ampl 2 ml , inj. tramadol ampl/vail 2ml , inj. l.b artether , inj. cefotaxime with water (500mg) , inj. cefotaxime with water (1gram) , inj. cefotaxime + salbatum with water (1.5gram) , inj. hydro corstisone , inj. pralidoxim , inj. trenexamic acid , inj. ketorolac (1ml) , inj. pantoprazole with water vial (40mg) , inj. pentazocin , inj. citicholine , inj. neostigmine ampl , inj. antitetanus human immunoglobullin , inj. haloperidol , inj. fursemide , inj. dilantin sodium 100mg , inj. labatalol , inj. diclofenac sodium(3ml) , inj. dicyclomine (2ml) , inj. insulin primixed (30/70) , inj. xylocaine 2% (plain) , inj. multiviatmin ampl , inj. chlorpheniramine , inj. tetvac ampl , inj. tetvac vial 10 ml , inj. sodium chloride ampl , inj. sodium bicarbonatne ampl , inj. sensrocain (30ml) vial , inj. ranitidine ampl , inj. b complex amp , inj. promethazina , inj. metoclopramide ampl , inj. oxytocin ampl , inj. ondensetron ampl , inj. methyl erometrine ampl , inj. megnesium sulphate ampl , inj. phenraminemaleate ampl , inj. ketamin (10vial) , inj. ketamin (2ml) ampl , inj. immunoglobin ampl , inj. gentamycine 80mg vail , inj. gentamycine 20mg vail , inj. phenytoin sodium , inj. dopamine ampl , inj. dicyclomine ampl , inj. diclophenac sodium 2ml ampl , inj. fusemide vial , inj. dexamethasone vial , inj. ethamsylate , inj. ceftriaxone inj. 1gram with water vial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone 250mg with water vial , inj. cefoperazone (1gm) with water vial , inj. dizepam2 ml , inj. atropin (ampolue) ampl , inj. ampicillin 500mg vial , inj. ampicillin 250mg vial , inj. amino phylie ampl , inj. amikacin (100mg) , inj. amikacin (500mg) vial , inj. amikacin (250mg) vial , inj. adrenaline ampl , inj. anti sanke venus serum , inj. a.r.v. (anti rabies) single dose , inj. a.r.v. (anti rabies) multi dose , inj. calcium gluconate amp , susp. salbutamol sulphate 100ml , susp. paracetamol 125mg 60ml , susp. ofloxacin + metronidazole 60ml , susp. metronidazole 60ml , susp. iron folic acid 200ml , susp. domperidone (30ml) , susp. cough syrup adult 100ml/110 ml , susp.cough syrupchild/60ml , susp.co trimoxazole 50ml , susp. cetirizine 30ml , susp. cefixime 50mg 30ml , susp. albendazole 10mg 15ml , susp.azithromycin (200mg) 30ml , susp. antacid 100ml , susp. amoxycilline 60ml , susp. levocetrizine 60ml , spirit 100ml , silver salphadazin , neospsrin powder 60mg , scalp vein set (18 nos.) , scalp vein set (22 nos.) , scalp vein set (24 nos.)(all size) , salvon 1lt. , saline set , saline rl (500ml) , saline ns (500ml) , saline dextrose 5% (500ml) , saline dextrose 10% (500ml) , saline d.n.s. (500ml) , oxygen mask adult , urine albumin & sugar test kit , phenyl 5lt. , needle straight , needle curved , mucus sucker , m.c. lotion 400ml , lysol 500ml , lotion. benzyl benzoate (1000ml) , leucoplast with zinc oxide 4 x 5 mt , leucoplast with zinc oxide 4 x 9 mt , leucoplast 3 , leucoplast with zinc oxide 7.5 cm x 5 mt , leucoplast with zinc oxide 7.5 cm x 9 mt , lecopore 3 , lecopore with zinc oxide 7.5cm x 5 mt , lecopore with zinc oxide 7.5cm x 9 mt , leclyete p(100 ml) , leclyete m(100 ml) , iv metronidazole 100ml , iv mannitol (300ml) , iv mannitol (100ml) , iv ciprofloxacine (100ml) , isolyte p(500ml) , intracath 22g , intracath 22g needle, kink resistant tube dia 3.00mm length 1500mm , intracath 22g dial flow regulator with extra big injection moulded drip chamber, fluid filter, y connector, luer lock adapter, 22g needle, kink resistant tube dia 3.00mm length 1500mm , intracath 20g , intracath 20g needle, kink resistant tube dia 3.00mm length 1500mm , intracath 20g dial flow regulator with extra big injection moulded drip chamber, fluid filter, y connector, luer lock adapter, 22g needle, kink resistant tube dia 3.00mm length 1500mm , inestinal catgut 2 0 , instetinal catgut 1 0 , betamathson ditrotionate oint , water for injection , handiplast 100 pcs. per box , gloves 7.5 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , gloves 6 surgical pair sterlised made of natural latex finish for better grip, packed in plastic pouch , examination gloves all sizes , gauge than (18m x 90cm) , absorbent gauze than 18m x 90cm special , absorbent gauze than 18m x 90cm sch f ii delux quality , g.v.paint lotion 400ml (agarwal) , fradiomycin cream 15gm , formalinsolution 500ml , follys catheter 20 two way , follys catheter 18 two way , follys catheter 16 two way , follys catheter 10 two way , ec (700 ml) (agarwal) , disposable syring5ml , disposable syring10ml , disposable syring3ml , disposable syring2ml , disposable syring1ml , dextrose 25% , chromic catgut plain 2 , chromic catgut with needle 1 , cotton thread , cotton roll 400gm nett , absorbent cotton i.p 400gm/roll (net weight) , absorbent cotton i.p 400gm 500 gross , cord clamp , cord clamp with rebban pack , ciprofloxacine eye / ear drop 10ml , cannula (18 12)/jelco , cannula (18 12)/jelco (johson) , butterfly scalp vein set (24 no.) , butterfly scalp vein set (23 no.) all sizes , povidine iodine lotion 500ml , neaomycine powder , neaomycine oint , bandage than (18m x 90cm) , absorbent bandage than 18m x 90cm special , absorbent bandage than 18m x 90cm sch f ii delux quality , b.p. blade no. 20(all sizes) , b.p. blade no. 15 , b.p. blade no. 12 , analgesic cream (30mg tube) , adhesive micropore 2 , adhesive micropore 1/2 , adhesive micropore 1 , bleaching powder 25kg , diclofenac gel 30gm , antifungal skin cream , ors , ors ( pedartic pack) , ord adult 21 24 gm pack , plaster of paris 5kg , plasama volume expendore 500ml , uro bag , uro bag with hanger for adult/child , rhyles tube 16 no. , mersyl 2 0with curved needle , mersyl 2 0 with straight needle , xylocaine jelly 2% , lidfast jelly , salbutamol inhaler , b.t. set , burn patti , crep bandage 6 , crep bandage 4 , budecort respules , asthalin respules , duolinrespules , plaster of paris (50kg)/ jar , inj. compose 2ml , tab. compose , inj. methergin , inj. deriphylin , either 500ml , inj. k nate (phytomenadione) 1ml , spinal needle 25g , 0.5% bupivacain (heavy) , inj. gardinal , inj. artemether , inj. artisunate , inj. i.v. ciprofloxacine , sus ibrufen 60ml , tab. terniafine , oxiconazole cream , terbinafine cream and lotion , moisturing cream/ lotion , kojic acid , hydroxyquinone cream , tertinoin 0.025%/0.04%/0.05% ointment , cap. isotretinoin 10mg/ 20mg , clindamycin gel , mometasone , desonide , tab. prednisolone 5mg/ 10mg/20mg , tab. methotrexate , coal tar + salicylic acid cream and lotion , tab. hydroxychloruquine 200mg , nadofloxacin ointment , sunscreem spf 30/ spf 50 , lancet , gluco meter strip (contour) , glacial acetic acid , r b c diluting fluid , cleansole , urine pot , w b c diluting fluid , tissue paper , tourniquet , n/10 hcl solution , 3.8% sodium citrate solution , lugnlos iodine solution , fouchet reagent , sulphar powder , barium chloride , methleine blue , edta vial , fluoride vial , plain vial , hb% tube , cpr (latex) , abo & rh(anti ab&d) , fluoride powder , blood bag , anithuman globulin serum , anti ab sera , antih , anti a1 (lactin) serum , bovine albumin 22% , vdrl rapid latex , vdrl rapid card , vdrl (syphills) card rapid test , hiv tridot , hiv retroquik , hiv card rapid kit , hiv elisa kit , trapin oil , sanitary napkin , digital x ray 8x10 konica flim , digital x ray 8x10 fusi flim , povodine iodine scrub 10% , povodine iodine scrub 7.5% , desnet 5liter , inj. meropenam 125 mg , inj. dobutamine , sus. montelukast , levipil syrup , inj. midazolam , inj. hemsyl , caffeine oral capnea , inj. caffeine , inj. hydrocort 100mg , thrombophob ointment , xylocain jelly , nasal prongs (neonats) , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , inj. megazid + salbactum , vitamin d drop , inj. levetiracetam 100 mg , multivitamin drop , iron drop , inj. kcl , %% lysole , 3% phenyl , suction tube 6fr , suction tube 8fr , chlohexidine , micropore 1 inch , new born diaper , syringe 50ml , baby cap , baby socks , cannula 26 no , cannula 24 no , paedia set , inj. phenpres ls , inj. termin , inj. levobuapivacaine 0.5%with dextrose 4ml , inj. ropivacine hydrochlioride in dextrose 0.75 % 4ml , inj. phrnylephrine 50 mcg per ml 10 ml vial , pregnancy kit , oxygen mask chlid , fetal doppler , ultrasound jelly/ecg jelly 250ml , tab. intraconazole 100mg , inj. prostaglardin , inj. endpoprost , tab. misoprost 1x4 , nebulizer set , inj. phenobarbitone , susp. levosalbutamol ambroxol , disposable niddle 18fr , disposable niddle 22fr , glucometer strip ozocheck , 3% nacl 100ml , nasal normal saline drop , betadine ointment , t bact ointment , cidexopa solution 5 lit , moxifloxacin eye drop , chloramphenicol eye ointment , permethrin lotion 5% , tacrolimus ointment 0.1% , 1% gaba benzene hexachloride lotion , betamethasone dipropionate neomycine cream , clobetasol fusidic acid cream , soframycin cream , luliconazole cream , itraconazole cream , tab. wysolone 5 mg , inj. prostodin , inj. tranexamic acid , tab . labetalol 100mg , inj. dilona 25mg , inj. glycopyrrolate , inj. noradadrenaline 2mg , inj. ondensatron 4mg , inj. efcorlin 50mg , inj. botropase , botrociot 10ml , inj. propofol , inj. anawin heavy , inj. amawin plain , lignocaine2% with adrenaline , lignocaine 2 % , inj. mephentermine , inj. butodol , inj. nacphin 10mg , xylometazoline nasal drop adult , xylometazoline nasal drop pedia , ofloxacin + dexamethasone ear drops , wax ear drop , gentamicin dexamethasone ear drops , clotrimazole ear drops , inj. netromycin 10mg , inj. netromycin 25mg , mersilk (1no) cutting body , mersilk (1 no)cutting body , mersilk (1 0)cutting body , mersilk (2 0) cutting body , mersilk (8 0)cutting body , endotracheal tube 2.5no , endotracheal tube 3no , endotracheal tube 3.5no , plian ctagut 1 no , plain catgut 3 0 , plain catgut (1 0) , mersilk (3 0) cutting body , mersilk (4 0) cutting body , prolin 0 , prolene (1 no) , prolene (2 0) , prolene (3 0) , plain catgut (2 0) , vicryl 1no 45cm , vicryl 1no 70cm , vicryl 1no 90cm , vicryl 1no 140cm , vicryl (1 0) , vicryl (2 0) , prolene mesh 7.5x10cm , prolene mesh 7.5x5cm , underwater 1c drain for chest tube , malecot catheter different sizes , softratulle mesh , paraffin mesh , phenylephrine , thiopentone , inj. lignocaine adrenaline , inj. xylocard 2% , tab epipress , inj. nitroglycerin , inj.adenosine , inj.morphine , inj.diltiazem , inj.pyronate , inj.enoxaparin (l.m.w.h) , ambu bag adult , epidural catheter , suction catheter , magills forceps large , magills forceps small , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , trece ostomy tube set , airway 01234 , lam/i gel 01234 , stylet , inj. iron surcose , inj. meropenam 250mg , inj. meropenam 1g , inj. moxifloxacin , ecg roll 3 channel , ecg roll 6 channel , ecg roll 12 channel , centraline 7.15 fr , centraline 4.5 fr , centraline 7 fr , dialysis line adult , nibulizer , nibulizer mask adult , nibulizer mask child , tab iron & folic acid large , tab. rebeprazole + domperidome , pcm + diclophenic + serrisopeprtidaze , pcm + acyclofenic + serrisopeprtidaze , glimepridie & metfformin hydrochloride (er) , glipizide & metfformin hydrochloride 5/500mg , tab. glipizide 5mg , tab.glipizide 500mg , tab.linezolid 300mg , tab.linezolid 600mg , tab.torsemide 10 , tab.warfarin 10 , tab.warfarin 5 , tab.warfarin 1 , tab.warfarin 2 , tab.carvedilol 3.125 , tab.carvedilol 6.25 , betahistine 16mg , inj. pipracilline + tazobactum 4.5 gm , inj. meropenum 1g , inj. methylcobalamin 500mg , inj. methylcobalamin100mg , inj. mvi , inj. methylcobalamin , tab.methylcobalamin od , tab. deferasirox dispersible 500mg (desirox) , tab. deferasirox dispersible 250mg (desirox) , tab. iron & folic acid large , ipratropium bromide & levosalbetamol , budesomide , inj. levofloxacin 100mg , inj. paracetamol 100mg , inj. recombinant anti rho d immunoglobulin (anti d) , lantus insulin , tab. calcium carbonate 500mg , diapper , insulin regular vial , insulin mixtard vial , inj.nahco3 25ml (sodium bi carbonate) , tab. ecosprin 75mg , tab. metoprolo 25mg , tab. metoprolo 50mg , tab. atorvastatin40mg , tab. rampiril 25mg , tab. rampiril 50mg , inj. kcl 100mg , inj. nacl 3% 100mg , dynaplast , inj. arv single dose vial , inj .arv multi dose vial , inj. asvs , inj. h. albumin 20% , zinconia syrup , inj. l ornithine , inj. iron sucrose , injcholcifefurol , tab.aceclofenec + pcm+ serisopeptize , silver nitrate gel , megaheal ointment , s liv syrup , abdominal belt (s, m, l,xl ,xxl) , multivitamin tab , tab metoprolol extended , tab. torsemide + spironolactone , tab. prefabalin & nortriptyline hydrochlordie , betadin 10% , betadin scrub 7.5% , ramovac 16 no. , ramo adk 28 , ramo adk 32 , ramo adk 24 , cotri plate , cotri pencil , cotri machine , hemodialysis catheter double lumen , tab tenovir disoproxil fumarate 300mg , 3 way cannula , inj. levetiracetam , pedia drip (measured volume iv set) , l.p. needle 20 no. , tab panteprazole + domperidom , bupivacaine hydrochloride inj. (amawin) , hyaluroridage inj. 1500 iv (hynedage) , hypromrllose opthalmic solution usp(hyprosol) , adrenaline acid tartrate inj. (epitrate) , pilocaprine nitrate inj. (carpinol) , proparacaine hcl eyedrop (paracain) , moxifloxacin eyedrop , bromofanac eyedrop , tropicamide and phenylephrine eyedrop , moxifloxacin plus prednisolone eyedrop , trypan blue solution 0.06% (auroblue) , tab acetazolamide 250 (dimox 250) , tab pheniramine maleate 25mg (avil 25mg) , isopropye alcohol solution (surgical sprit) , non absorbable surgical suture 10 0 , micropore 1 , needle 26 g , black goggles , side port (disposal) blade , kereatome 2.8mm blade (disposable) , crescent blade (disposable) , b.p blade (all size) , sodium chloride opthalmic aolution 5% eyedrop (hypersol 5) , sodium chlorode oint (hypersol 6) , lens +18.00,+19.00,+ 20.00, +21.00, +22.00, 23.00, +24.00, +25.00, +26.00, +27.00 , inj. sucol , glycopyrolate amp. , atropin sulphate amp. , pantazocine amp. , ketamin amp. , dizepam amp. , thiopentone sodium vial 1/2gm 1gm , isoflurane bot 100ml , dexedetomidine hcl vial 50 micro gr. , medazolam vial , ondansetron amp. , tramadol amp. , diclofenec sodium amp. , lignocaine vail 2% 30ml , bupivacain 5% 4ml , ropivacain amp. 75% 20ml , lignocaine 2% with adrenaline , bupivacain 5% 20ml , vecronium bromide amp. , succinylcholine chloride vial , recuronium bromide vial , nestogime + gycopyrolate amp. , noradranilne amp. , adrenaline amp. , mephenterimine vial , magnesium sulphate amp. , nitroglycerine amp. , promethazine amp. 2ml , dexamethasone vial , hydrocortisone succinate vial , fursemide amp. , chlorphenaramin meleatr amp. , esmolol amp. , dopamine hydrochloride amp. , fentanyl inj. , sufentanyl inj. , xylocaine 5% heavy amp. , ligoncaine heavy amp. 5% 2ml , ligoncaine jelly tibe 2% , paracetamol inj. amp. , prochloreperazine amp. , promethazine amp. , chloropromazine amp. , deriphyllin amp. , epidural set withepidural catheter , halothanb.p. , butorphanol tartrate amp. , succinyl choline chloride vial (inlipolised powder form) , phenylepherine amp. , epinephrine amp. , xylocaine spray 5% , 10% , 6% hydroxy ethyl starch sol.bot. , 3% hydroxy ethyl strach sol.bot. , azithromycin 250mg , azithromycin 500mg , amoxycillin 500mg + clavulanic acid 125mg , livocitrizine 5mg , livocitrizine 5mg +10mg , chplecalciferol 60000 iu , aceclofenac 100mg +paracetamol 325mg , ofloxacin 200mg + ornidazole 500mg , ofloxacin 200mg , cefuroxime 500mg + clavulanic 125mg , 20% gealin infusion bot. , 3% 100ml nacl sodium chloride soln. bot. , verapamil 5ml amp. , orcyprenaline 10gm tab , flumezenil 2ml amp. , naloxone hydrochloride amp. , terbutaline amp. nebuliser , nitroglycrine sublingual tab , nitroglycrine sublingual spray , torsamide 2ml amp. , propofol vial , 1% & 2% , atracurium besylate amp. , budacort , endotracheal tube 6,6.5, 7,7.5,8,8.5 , nitroglycrine amp. 5cc , acetylcystine amp. , betaloc (metaprolol) , lenoxin tab. / amp. , methyl predinisolone inj. , bain circiut (paediatrics) , endotracheal tube 0.2,5,3,3.5,4,5.5 , laryngoscope adult , air way no. 3,4 paediatric size , spinal needle (all size) , tab telmisartan 40 , cholecalciferol schet , ursodeoxycholic 300 mg , tab itraconazole 200 mg , tab fluoxetine 20 mg , tab trihexphenidyl 2 mg , tab lorzaepam 2 mg , tabsodium valproate 300 mg , tab sodium valproate 500 mg , tab olanzapine 10 mg , multiple elec. and dextrose (p) 500 ml , multiple elec. and dextrose (m) 500 ml , dextrose 5% 50 ml , sodium chloride 500 ml , metronidazole 100 ml iv , ciprofloxacin inj. ip 100 ml , infusion set , 3.5 colloidal infusion 500 ml , surgical paper tape 2.50 cm x 9.1 cm , surgical paper tape 5.00 cm x 9.1 cm , ceftriaxone 1gm inj. , ceftriaxone 1gm + sulbactum 500 mg inj. , ceftriaxone 1gm + tezobactum 125 mg inj. , ceftazidime 1gm , cefuroxime sodium 1.5 gm , methylcobalamin + pyridoxine hcl + nicotinamide inj. , nandrolone decanoate 50 mg inj. , iron sucrose inj. , dexamethasone 30 ml inj. , gentamicin 10 ml inj. , crystaline amino acid 200 ml , blood administration set (bt set) , urin bag , cannula fixator bandage , vasopressor , inj. isoprenaline , inj. vasopressin , inj. milirenole , inj. adenosime , iv paracetamol (100 ml. bottle) , inj. ketamine 50mg/ml , inj. termine 30mg/ml (mephentermine sulphate) , inj. anawin heavy (bupivacaine hydrochloride in dextrose inj. ) , tab. olanzapine 5 mg , tab. olanzapine 10 mg , tab. risperidone 2 mg , tab. risperidone 3 mg , tab. trihexyphenidyl 2 mg , tab. clonazepam 0.5 mg , tab. lithium carbonate 300 mg , tab. sodium valporate 500 mg , tab. amitryptyline 25 mg , tab. sertraline 100 mg , tab. clobazam 5 mg , tab. clobazam 10 mg , inj. serenace (haloperidol) 5 mg , inj. lorazepam 4 mg , inj. promethazine 50 mg , tab. sodium valporate 300 mg , tab. carbamazepine 200 mg , cap. fluoxetine 20 , tab. lorazepam 2 mg , inj. thiamine 100 mg , sodium valporate syurp , inj. dopamine , soluble asprin 325 mg , enteric coated asprin 75 mg , t.clopidogrel 75 mg , t.isosorbide dinitrate 65mg/10mg , t.isosoribde mononitrate 10mg , t.isosorbide mononitrate 20mg , t.metoprolol 25mg , t.rampiril 2.5mg , inj. frusmide , t.aldactone 25mg , t.atorvastatin 40mg , inj. lignocaine , inj. amidarone , t.amiodarone 200mg , inj.pheniramine meleate , inj. hydrocortisone , inj. pantoprazole , inj. streptokinase 1500000iu , inj. adrenaline , inj. nor adrenaline , inj. amiodarone , inj. tenecteplast , inj. reteplase , inj.morphine , tab. atorvastatine (40) , tab. ecosprin (75 ) , tab. clopidogril (75) , tab. cardac 12.5 , inj. elaxim (tenectoplase) , inj. nahco3 , 50 cc syringe , p.m.o line , inj. dobutamine , abg machine , inj. adenosine , inj. amidarone , central line , endotracheal tube 6 no. , endotracheal tube 6.5 no. , air way adult size 6 , air way adult size 6.5 , air way adult size 3 , air way adult size 4 , suction tube 14 , suction tube 16 , suction tube 18 , sodium bicarbonate 25 ml , inj. meropenum 1gm , inj. netromax 10 mg , inj. cefotaxime 125 mg , inj. midazolam , inj. amplicillin 100 mg , inj. vancomycin 100 mg , inj. pipracillin + tazobactum 4.5gm , inj. capnea , ivf. isolet p , inj. d5% , inj. heparin , formalin vaporize (5lit) , vit d3 drop , syp. levipil , hmf sachet , drop capnea , inj. gardenal , syp. gardenal , syringe pump , washable slipper , room thermameter , weight machine (baby) , oxygen nasal prongs , dispo syringe 1 ml , dispo syringe 3 ml , dispo syringe 5 ml , dispo syringe 10 ml , dispo syringe 20 ml , dispo syringe 50 ml , ett 2.5, 3, 3.5 , cannula 26 fr , cannula 24 fr , sprit 5 liter , leucoplast 1 , leucoplast 2 , micropor 1 , hand wash , hand sanitizer , pmo line , losse gloves , pedia set , formoline (5lit ) , sterlization indicator tst control spot , baby diapper , disposable cap , disposable mask , dispo niddle 18 fr three way connector , baby blanket , dispo needle 22 fr , betadin solution , suction tube 10 fr , suction tube 12 fr , glucometer strip , d.w respule , neonate b.p cuff , gelonet , lignocane gel , muprocin ointment , inj. enoxaparin 0.6 mg , inj. terectepluse 30 mg , inj. erythropoetin , inj. iron ferron fumarate amp. , central venom cannula for dialysis , inj. tobramycin , nebulizer solution respules salbutamol , nebulizer solution respules budetcrol. , adult b.p cuff , tab. vitamin c 500 mg , tab. vitamin d 60 k , inj. remdesivir , tocillizumab , amphotericin b deoxycho latf , posaconazole , tab. ivermctin 12 mg , for cbc (complete blood count) machine , diluent 20l for (ad3200 plus) , lyse 500ml for (ad3200 plus) , probe cleaner for (ad3200 plus) , k3 edta single cap tube , fluoride single cap tube , plane clot activator single cap tube , k3 edta double cap tube , fluoride double cap tube , plane clot activator double cap tube , forbiochemistry semi auto analyser , amylase , lipase , alkaline phosphatase , alt( gpt) , ast (got) , bilirubin total , bilirubin direct , calcium , creatinine , creatine kinase nac , cretine kinase mb , total cholesterol , ldl cholesterol , hdl cholesterol , chloride , triglyceride , g glutamyl transferase , glucose , lacathedehydrogenase (ldh) , magnesium , phosphorus , microprotein reagents , uric acid , urea , micro albumin , crp. latex , crp (turbidometric) , albumin , total protein , d dimer , ferritin , bionorm quality control , biopath quality control , bio cal calibrator , for fully automatic biochemistry analyser. (merilyzer autoquant 200 excelus) , amylase , lipase , alkaline phosphatse , alt (gpt) , ast (got) , bilirubin total , bilirubin direct , total protein , albumin , creatinine , urea , uric acid , total cholesterol , ldl cholesterol(direct) , hdl cholesterol (direct) , triglyceride , g glutamyl transferase , glucose , lacatedehydrogenase (ldh) , creatine kinase nac , cretine kinase mb , d dimer , ferritin , bionorm quality control , biopath quality control , bio cal calibrator , bio cal calibrator , other reagents required , t3 , t4 , tsh , double cap edta vial (liqiud) , double cap plain clot actvator , double cap fluoride vial , r a latex , aso latex , hbsag kit , capillary tube , filter paper , d/ water , bendicts solution , test tube (6) , e s r stand (6group) westergrens mehtod , westergrens tube , haemometer (haemocytometer) set (top up) , hb% pipette , leishmans stain (500 ml) , widal kit (span) , lancet , blood group & rh typing (each) , glacial acetic acid (500ml) , cover glass , hypchloride (5 litres) , vdrl (strip) , micro pipette (10 100 ul) , micro pipette (100 1000 ul) , micro pipette (10 100 ul tips) , micro pipette (100 1000 ul tips) , crp latex , sprit (99.9%) (01jar = 5 litres) , cleansole , urine pot , tourniquet , n/10 hcl solution (each 500ml) , 3.8% sodium citrate solution (each 500ml) , lugols iodine solution , fouchet reagent , earlichs aldehyde reagent , sulphar powder , braium chloride (each 500ml) , metheline blue (each 500ml) , edta vial , flouride vial , plain vial , hb% tube (top up) , rbc diluting fluid (each 500ml) , wbc diluting fluid (each 500ml) , platelats diluting fluid (each 500ml) , semen diluting fluid (each 500ml) , disposable syringe with needle 5ml , urine strips ( two parameter ) , for hb% (cyna.) drabkin solution , test tube rack , westergren pipette , sodium / calcium hydrochloride 500ml , fluroide powder 25gm , edta powder 25gm , antihuman globulin serum , anti ab sera 10 ml , anti h 5ml , anti a1 (lactin) serum 5ml , bovin albumin 22% 10ml , vdrl rapid latex , m.p pf/pv card antibody , maleria pf/ pv antibody , hiv tridot , hiv reteroquik , tarpin oil , trop. t , r.a test , k3 edta single cap tube , fluoride single cap tube , plain clot activator single cap tube , k3 edta double cap tube , fluoride double cap tube , plain clot activator double cap tube...

Health Medical Education And Family Welfare Department - Jharkhand

38154244 bids are invited for gauze than (q3) , foleys catheter 18 no (q3) , vicryl double needle 1 no (q3) , abjel (q3) , suction pipe (q3) , sidex (q3) , bandage 6 (q3) , gloves 6.5 no (q3) , gloves 7.0 no (q3) , alice forcep (q3) , curved pointed scissor (q3) , tetra (q3) , muccure succure (q3) , syringes 5ml (q3) , chronic catgut 1 no (q3) mse total quantity : 6981...

Hindustan Copper Limited - Jharkhand

38093405 bids are invited for surgical items water for injection 5 m , dextrose 5per inj 500ml , dextrose saline inj 500 ml , ringerlactate inj 500 ml , intra flon iv cannula , scalp vein , scalp vein , absorbent cotton 300 gm net , gauge than 16 mtr x 90 cm, schedule f ii , p.o.p. bandage 15 cm x 2.7 mtrs , p.o.p. bandage 10 cm x 2.7 mtrs , iv set , disposable syringe 2 ml , disposable syringe 3 ml , disposable syringe 5 ml , disposable syringe 10 ml , rolled bandage 15 cm x 4 mtr, schedule f ii , i.v. sodium chloride 0.9percent 500 ml , urine collecting bag 2000ml , foleys catheter no.14 , foleys catheter no.16 , foleys catheter no.18 , disposable surgical gloves sterile no. 6 and half , disposable surgical gloves sterile no. 7 , disposable examination gloves no.7 medium 1 x 100 , sanitiser ethyl alcohol 70 , n 95 nose mask , cetrimide, chlorhexidine gluconate liquid, 1 l pack , povidone iodine solution 1 litre pack , disposable needle no.26 , disposable needle no.23 , disposable needle no.22 , iv dextrose 25 100 ml , disposable needle no.24 , adhesive tape 10 cm x 9 mtrs for medical use , microporous paper tape 3 inch , acid carbolic phenol 450 gms , hydrogen peroxide solution 400 ml, 6.5 w v , merbromin lotion 20 ml , ecg jelly 5 kg pack , sodium phosphate enema procto clysis 100 ml total quantity : 38393...

Health Department - Jharkhand

37890680 rate contract for medicine at sadar hospital deoghar , items : , tab. albendazole (400 mg) 10x10 , tab. anti cold 10x10 , tab amlodipine (5mg) 10x10 , tab. atenolol (50mg) 10x10 , tab. avil (chalpheniramin( 25 mg) 10x10 , tab. azithromycine250 mg 10x10 , tab. azithromycine 500mg 10x10 , tab cefadroxyl 250mg 10x10 , tab cefadroxyl 500mg 10x10 , tab. calcium d3 500mg. 10×10 , tab. cefixime (50 mg) 10×10 , tab. cefixime (100mg) 10x10 , tab. cefixime (200mg) 10x10 , tab. cetrizine 10mg. 10x10 , tab. cipro 500mg + tz 600mg 10x10 , tab. ciprofloxacine (500 mg) 10x10 , tab. ciproifloxacine (250mg) 10x10 , tab. co trimoxazole ds 10x10 , tab. co trimoxazole ss 10x10 , tab. dicolofenae sodium (50mg) 10x10 , tab. dicolofenc + paracetamol 10x10 , tab. dicyclomine10x10 , tab. dicyclomine + paracetamol 10x10 , tab. domperidon (10mg) 10x10 , tab. famotidine(40 mg) 10x10 , tab. famotidine 20 mg. 10x10 , tab. fluconazole 150 mg. 10x10 , tab. folic acid large10x10 , tab. ibuprofen 400mg + paracetamole 325mg10x10 , tab. levofloxacine 250mg 10x10 , tab. levofloxacin (500mg) 10x10 , tab. katrolac ( 50 mg) 10×10 , tab. diazepam (2 mg) 10 ×10 , tab. diazepam (5 mg) 10 ×10 , tab. chromostat10 ×10 , tab. lasix10 ×10 , tab. lanoxin 10 ×10 , tab. metformin(500 mg) sr 10×10 , tab. glimepride ( 2 mg) 10 ×10 , tab. voglibosevo (0.2mg) 10 ×10 , tab. stemetil10×10 , tab. p.c.m.d.t.( 250 mg) 10×10 , tab. paracetamol (500mg) 10x10 , tab. antacid 10 ×10 , tab. dilantin sodium ( 100 mg) 10 ×10 , tab. drotaverime ( 40 mg) 10×10 , tab. anaspas 10 ×10 , tab. nitrocontin (2.6 mg) 10 ×10 , tab. sorbitrate ( 5 mg) 10 ×10 , tab. ecospirin (75 mg) 10 ×10 , tab. ecospirin (100 mg) 10 ×10 , tab. telmisarten ( 20 mg) 10 ×10 , tab. telmisarten ( 40 mg) 10 ×10 , tab. aceclofenac (100 mg) 10 ×10 , tab. ondansetron ( 8 mg) 10 ×10 , tab. ondansetron ( 4 mg) 10 ×10 , tab. chloroquine 10 ×10 , tab. zinc sulphate ( 20 mg)10 ×10 , tab. metoclopramide 10mg 10x10 , tab. metronidazole (200mg) 10x10 , tab. metronidazole (400mg) 10x10 , tab. nefedipine 20 mg 10x10 , tab. norfloxacin 400 mg+ tinidazole 600 mg 10x10 , tab. ofloxacin100mg.10x10 , tab. ofloxacin 200mg 10x10 , tab. ofloxacin200mg + ornidazole (500mg) 10x10 , tab. pantoprazole 40mg 10x10 , tab. ranitidine (150mg) 10x10 , tab. roxythromycine 150mg 10x10 , tab. roxythromycine 300mg 10x10 , tab. salbutamol 4mg 10x10 , tab. tranaxaemic acid + mefenamic acid 10x10 , tab. vitamin b complex 10x10 , tab. levocetirizine 5 mg+montelukast 10 mg.10x10 , tab.vitamin c 10x10 , tab.vitamin d 10x10 , tab.amoxycilline + clavulanic acid(625 mg) 10×10 , tab.amoxycilline + clavulanic acid(325 mg) 10×10 , tab.ascorbic acid10×10 , tab. levocetrizine 5mg 10×10 , tab. erythromoycin250 mg 10×10 , tab. cefpoboxime proxetil50 mg. 10×10 , tab. cefpoboxime proxetil100 mg. 10×10 , tab. cefpoboxime proxetil200 mg. 10×10 , tab. cefuroxime axetil 10×10 , cap. omeprazole (20mg) 10x10 , cap. omeprazole (10mg) 10x10 , cap. doxycycline (100 mg) 10x10 , cap. cefalexine (500mg) 10x10 , cap. ampicilline 500mg 10x10 , cap. ampicilline 250 + cloxacilline 250 10x10 , cap. amoxycilline (250mg) 10x10 , cap. amoxycilline (250 mg) cloxacilline (250mg) 10x10 , cap. amoxycilline (500mg)10×10 , cap. depin (5 mg)10×10 , cap. cefalamine (500 mg)10×10 , cap. cefalamine (250 mg)10×10 , inj.amikacine (100mg)vial , inj. amikacin (250mg) vial , inj. amikacin (500mg) vial , inj. theophyillin + ethophyillin2ml ampl , inj. perinorm 5mg, 2ml ampl , inj. tramadol 50mg, 2ml ampl , inj. arteether 150mg ,2ml ampl , inj. cefotaxime with water(500 mg)vial , inj. cefotaxime with water(1 gram)vial , inj. ceftriaxone 250mg with watervial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone inj 1gram with watervial , inj. ceftriaxone+ salbatum with water (1.5 gram) , inj. drotaverin40mg ,2ml ampl , inj. h coart/ prima coart 100mlvail , inj. pam ampl 500 mg, 25 ml , inj. trenexa ampl 500 mg, 5ml , inj. ketorolac 30mg, 1 ml, vail , inj. pantoprazole with water40 mg ,vial , inj. fortwin ampl 30mg, 1 ml, ampl. , inj. stemetil ampl 12.5mg, 1 ml ampl. , inj. citycolin ampl 500 mg, 2ml ampl , inj. neostigmine 2.5 mg, 5ml ampl , inj. antirabies human illnvoglabin vail , inj. antitetanus human illnvoglabin , inj. halopendol ampl , inj. lasix 20 mg ml ampl , inj. dilantin sodium100 mg 2 ml ampl , inj. labatalol 20 mg4 ml ampl , inj. diclofenac aqua 75 mg (1 ml) , inj. anaspas 2 ml ampl , inj. insulin primixed (30/70) 3ml ampl. , inj. xylocaine 2% (plain) 30 mlvail , inj. multivitamin 2 ml ampl , inj. avil 22.75 mg 2ml ampl , inj. tetvac 0.5ml ampl. , inj. tetvac 10ml vial , inj. tetanus toxide 1mg 10 ml vial , inj. sodium chloride 100ml iv , inj. sodium bicarbonate 25ml ampl , inj. sensorcaine (30 ml) vial , inj. ranitidine 50mg 2ml ampl , inj. b complex 2ml amp , inj. botroclot 1mlamp , inj. pipracillin(piperacillin 4000mg + tazobactam 500mg) 4.5 gm. vial. , inj. pipracillin+ tazobactum 1.125 mg. vial. , inj. meropenam 1.125 mg. vial , inj. kanadian. 0.5 mg. ampl , inj. anawin heavy 4mlampl. , inj. adenosine 3mg. 2ml vial , inj. antidine 2ml ampl , inj. phenargan 25mg 2ml ampl , inj. metochlopramide 2ml ampl , inj. oxytocin 1mlampl , inj. ondensetron 2ml ampl , inj. methyl ergometrine 0.5 mg 1 ml ampl , inj. megnesium sulphate 5mlampl , inj.pheniramine 2ml ampl , inj. phenytion sodium 50mg 2 ml ampl. , inj. ketamin inj. (10ml vail) , inj. ketamin (2ml) ampl , inj. carboprost 1ml ampl , inj. propofol 10 ml vial , inj. promethazine 2 ml ampl. , inj. dobustat 250 mg vial , inj. labetalol 20 mg. 4ml vail , inj. immunoglobin 10 mg, 100 ml iv , inj. gentamycine 80 mg.2ml vial , inj. gentamycine 20 mg.2ml vial , inj. epsolin 2ml ampl , inj. dopamine 200mg 5ml ampl , inj. dicyclomine20mg 2ml ampl , inj. diclophenac sodium 2ml ampl , inj fusemide 20 mg 2ml , inj. dexamethasone2 ml ampl , inj. chromostat 1 mg 2 ml amp , inj. cefoperazone (1 gm.) with watervial , inj. dizepam 50 mg 10 ml vail , inj. atropin 0.6mg 1ml ampl , inj. ampicillin500mg vial , inj. ampicilin 250mg vial , inj. amino phylline 250 mg 10 ml vail , inj. adrenaline 1 ml ampl , inj anti snake venus serum 10ml vail , inj a.r.v. (anti rabies) single dose 1ml ampl , inj a.r.v. (anti rabies) multi dose , inj calcium gluconate amp 100mg 10ml ampl , injclindamycine 600 mg. 4ml ampl , inj. narabre naline 4mg 2 ml amp , inj. heparine 5000 iu 5 ml vial , inj. pentazocine lactate 1ml amp , inj. neostigmine methyle sulphate. 2.5mg. 5 ml ampl , iv saline rl (500ml) , iv saline n.s. (500ml) , iv saline dextrose 5%(500ml) , iv saline dextrose 10%(500ml) , iv saline d.n.s. (500ml) , iv metronidazole 100ml , iv mannitol (300ml) , iv mannitol (100ml) , iv ciprofloxacine(100ml) , iv plasma volume expendore 500 ml , dextrose 25% 100 ml , ors each , susp. salbutamol sulphate 100ml , susp. paracetamol 125mg 60ml , susp. ofloxacin + ornidazole 30 ml , susp. metronidazole 30ml , susp. metronidazole+ ofloxacin 30ml , sup. iron folic acid 200ml , susp. domperidone (30ml) , susp. cough syrup adult100ml bottle , susp. cough syrup child60 ml bottle , susp. co trimoxazole 50ml , susp. cetrizine 30ml , susp. cefixime 50mg 30ml , susp. albendazole 10mg 15ml , susp. azithromycin (200 mg ) 30 ml , susp. antacid 100 ml , susp. amoxycilline 60ml , susp. levocetrizine 60ml , salbutamol inhaler each , ciprofloxacine eye / ear drop 10ml , m.c. lotion400ml , lysol 500ml , lotion. benzyl benzoate (1000ml) , formalin solution 500ml , ec (agrawal)400 ml , g.v. paint lotion 400ml , lindone & cetrimide lotion 100 ml , spirit 01 ltrs , spirit 100 ml , antifungal skin cream 20gm , diclofenacgel 30 gm (diclofenac 1.0 % +linseed oil 3.0%+bezyle alochol 1.0%+menthol 5.0%+methyl salicylate 10.0%) , analgesic cream(30 mg tube) , neaomycine oint.15 gm. , fradiomycin cream 15 gm , betamathson ditrotionate oint. 15 gm , silverex ointmet (burning) (20 gram) , silverex ointmet (burning) (500 gram) , neospsrin powder 10 gm. , stritching thread , savlon 1 liter. , saline set , prolene 1 0 (100 pc) , prolene 1(100 pc) , phenyl 5 ltrs , needle straight (100 pc) , needle curved (100 pc) , mucus sucker 100 pcs , leucoplast 4(100 pc) , leucoplast 3(100 pc) , lecopore 3(100 pc) , leclyete p(100ml) , leclyete m(100 ml) , isolyte p(500ml) , intestinal catgut 2 0(100 pc) , intestinal catgut 2(100 pc) , intestinal catgut 1 0(100 pc) , intestinal catgut 1(100 pc) , water for injection , handiplast 100 pcs. per box , gloves 7.5 surgical pair , gloves 7 surgica pair , gloves 6.5 surgical pair , gloves 6 surgical pair , gauge than (18m x 90cm) , folly’s catheter 20 two way 100pc , folly’s catheter 18 two way 100pc , folye’s catheter 16 two way 100pc , folly’s catheter 10 two way 100pc , disposable syring 0.5 ml 100pc , disposable syring 1 ml 100pc , disposable syring 2ml 100pc , disposable syring 3ml 100pc , disposable syring 5ml 100pc , disposable syring 10ml 100pc , disposable syring 20 ml 100pc , disposable syring 50ml 100pc , insuline syring 1 ml. 100 pcs. , chromic catgut plain 2 100pc , chromic catgut plain 2 0 100pc , chromic catgut with needle 1 0 100pc , chromic catgut with needle 1 100pc , cotton thread 100pc , cotton roll 400gm nett , cord clamp 100pc , butter fly scalp vein set (24 no.) 100pc , butter fly scalp vein set (23no.) 100pc , povidine iodine lotion 500ml , neaomycinepowder 10gm , bandage than (18m x 90cm) , b.p. blade no. 22 (100pc) , b.p. blade no. 15 (100pc) , b.p. blade no. 11 (100pc) , adhesive micropore 2 100pc , adhesive micropore 1/2100pc , adhesive micropore 1100pc , bleaching powder 25kg bag , plaster of paris 5kg. bag , uro bag pic. , ryles tube 6 no. , ryles tube10 no. , ryles tube 12 no. , ryles tube14 no. , ryles tube16 no. , mersyl 2 0 withcurvedneedle 100 pcs. , mersyl 2 0 withstraight needle 100 pcs. , xylocaine jelly2% 30 gm , lidfast jelly30gm , b.t. set100 pcs. , burn patti100 pcs. , crep bandage 4100 pcs. , budecort0.5mg 2ml packet , duolin100 pcs. , catgut no. 1 with needle100 pcs. , catgut no. 2 with needle100 pcs. , vicryl no. 1 90 cm.round body 100 pcs. , vicryl no. 1 180 cm.100 pcs. , pop roll100 pcs. , dispo mask 100 pcs. , dispo cap 100 pcs. , cidex 5lt. jar. , leucopore 0.5 100 pcs. , gluco one kit (sugar test strip) , mersilk no. 1 cutting(100 pcs.) , mersilk no. 2(100 pcs.) , mersilk no. 3(100 pcs.) , silk thread (100 pcs.) , vain flam no. 18 (100 pcs.) , vain flam no. 20 (100 pcs.) , vain flam no. 22 (100 pcs.) , vain flamno. 24 (100 pcs.) , spinal needle 100 pcs , sanitary pad (cotton) (100 pcs.) , triple layer surgical mask , n 95 mask , hand sanitzer 100 ml , hand sanitzer 500 ml , hand sanitzer 1 liter. , oxygen mask adult per pic , oxygen mask childpic , ppe kit per pic , hydrogen peroxide solution 100 ml , disposel head cap. 100 pcs , diaper (born baby) 10 pics pack. , first aid kit. (100 pcs.) (pcm 500 mg. 10 tab., ors 5 pac., tab. norfloxacin 400 mg+ tinidazole 600 mg. 10 tab., bandage 1 roll, cotton 1 roll, betadine onintment 1tube, handiplast 5 pic, cipro. 500 mg. 10 tab., domperidom 10 mg. 10 tab., dicyclomine 10 tab. diclofenac 50 mg 10 tab., savlone 50 ml.)...

Employees State Insurance Corporation - Jharkhand

37760141 bids are invited for disposables items mse cloth adhesive tape 5 cm , paper adhesive tape , bandage roller 2 inch , bandage roller 4 inch , bandage roller 6 inch , cotton roll 400gm , suction catheter 8fg , suction catheter 12fg , suction catheter 14fg , suction catheter 16fg , b p blade no 15 , b p blade no 22 , b p blade 23 , ecg electrode , intravenous canula size 20 g , intravenous canula22 g , intravenous canula 24 g , intravenous canula 16 g , intravenous canula size 26 g , mtp canula size 07 , mtp canula size 4 , mtp canula size 08 , mtp canula size 10 , oxygen mask adult , oxygen mask paed , nebulizer mask paed , nebulizer mask adult , needle disposablesize 18g , needle disposable size 24 g , gloves surgical size 7 , examination gloves plastic , nitrile examination gloves unsterile large , syringe disposable single use with needle 10ml 21g , syringe disposable single use with needle 2ml 24g , syringe disposable single use with needle 5ml 23g , blood set drip chamber with filter 18g needle , dispoable spinal needle size 23g , disposable spinal needle 25g , disposable spinal needle 26g , disposable spinal needle 27g , cotton crepe bandage 10cm x 4m , cotton crepe bandage 15cm x 4m , handloom cotton gauze 18m x 90cm , measured volume infusion set paed drip , abgel haemostatic sponge 1x5x8cm , two way folleys catheter 16fr , dyanplast 4 , knee brace m total quantity : 267465...

Health Department - Jharkhand

37751530 group c rate contract for medicine,instrument and consumables items at sadar hospital garhwa rate contract for medicine,instrument and consumables items at sadar hospital garhwa , items : , amitriptylline tab (10 mg) , amitriptylline tab (25 mg) , act kit (adult) , act kit (9 14 years) , act kit (5 8 years) , act kit (1 4 years) , act kit (less than 1 years) , acyclovir tab (200mg) , acyclovir tab (400mg) , acyclovir tab (800mg) , atrovastatin (5 mg) , atrovastatin (10 mg) , atrovastatin (20 mg) , anticold tab , amitryphylin tab (10 mg) , amitryphylin tab (25 mg) , acetyl salicylic acid tab (300 mg) , acetyl salicylic acid mouth dissolving tab (75 mg) , albendazole tablets (400 mg) , alprazolam tablets (0.25 mg) , aluminium hydroxide + magnesium hydroxide tablet (400 mg+400mg) , amlodipine tablets (2.5 mg) , amlodipine tablets (5 mg) , amlodipine tablets (10 mg) , amoxicillin 125 mg dt , amoxicillin 250 mg dt , amoxicillin capsules (250 mg) , amoxicillin capsules (500 mg) , amoxicillin + clavulinic acid tablets (375 mg) , amoxicillin + clavulinic acid tablets (625 mg) , ampicillin, capsules, (250 mg) , ampicillin, capsules, (500 mg) , ascorbic acid chewable tablets, (vitamin c 500 mg) , atenolol tablets (25 mg) , atenolol tablets (50 mg) , atorvastatin tablets (10 mg) , atorvastatin tablets (20 mg) , azithromycin tablets (250mg) , azithromycin tablets (500mg) , aceclofenac + pcm tab (100 mg + 325 mg) , antispasmodic tab (dicyclomine 20 mg + pcm 325 mg) , bupropion tab (150 mg) , betamethasone tab (0.5 mg) , bisacodyl tab (5 mg) , clonazepam (0.5 mg) , captopril tab (25 mg) , captopril tab (50 mg) , calcium carbonate + vitamin d3 tablets (500 mg) , calcium carbonate + vitamin d3 tablets (250 mg) , carbamazepine tab (100mg) , carbamazepine tab (200mg) , carbamazepine tab (400mg) , cefixime 50 mg dt , cefixime 100 mg dt , cefixime 200 mg tab , cetrizine10mg tab , clopidogrel tab (75 mg) , cephalexin125 mg dt , cephalexin capsules (250 mg) , cephalexin capsules (500 mg) , chloroquine phosphate tab (250 mg) , chloramphenicol cap (250 mg) , chloramphenicol cap (500 mg) , ciprofloxacin hcl tab (250mg) , ciprofloxacin hcl tab (500mg) , ciprofloxacin hcl 500mg + tinidizole 600 mg tab , clotrimazole veginal pessary , co trimoxazole pead. tab (trimethoprin 20 mg + sulphamethoxazole 100 mg) , co trimoxazole ss tab (trimethoprin 80 mg + sulphamethoxazole 400 mg) , co trimoxazole ds tab (trimethoprin 160 mg + sulphamethoxazole 800 mg) , chlorthalidone tab (6.25 mg) , chlorthalidone tab (12.5 mg) , cholecalciferol cap (60000 iu) / cap , cpm tab (25mg) , cycloserine tab (250 mg) , carbamazapine tab (200 mg) , dexamethasone tab (0.5 mg) , digoxin tab (0.25mg) , dicyclomine tab (10 mg) , dicyclomine tab (20 mg) , diclofenac sodium + pcm tab (50 mg + 325 mg) , diclofenac 100 sr tab , diclofenac sodium tab (50 mg) , doxylamine succinate 10mg + pyridoxine 10mg tab , di ethylcarbamazine tab (100 mg) , domperidone tab (10 mg) , doxycycline capsule (100 mg) , dizepam tab (2 mg) , dizepam tab (5 mg) , drotavintab (40 mg) , enalapril tab (2.5 mg) , enalapril tab (5 mg) , enalapril tab (10 mg) , escitalopram oxalate tab (10 mg) , erythromycin tab ( 500 mg) , erythromycin tab ( 250 mg) , erythromycin 125 dt , ethamsylate tab (250 mg) , ethamsylate tab (500 mg) , ethiophylin + theophylin tab , ethambutol tab (400 mg) , ethambutol tab (800 mg) , escitalopram tab (10 mg) , fluoxetine tab (2 mg) , famotidine tab (20 mg) , famotidine tab (40 mg) , ifa tab (l), 100 mg elemental iron + 500 mcg folic acid (red & blue) , ifatab (s), 30 mg elemental iron + 250 mcg , ibuprofun tab (200 mg) , ibuprofun tab (400 mg) , ibuprofun + pcm tab , fluconazole cap/ tab (150 mg) , folic acid tab (5 mg) , frusemide tab (40 mg) , glibenclamide tab(5 mg) , glyceryl trinitrate sublingual tab (0.5 mg) , griseofulvin cap/ tab (250 mg) , glimepride tab (1 mg) , glimepride tab (2 mg) , glimepride tab (3 mg) , glimepride tab (4 mg) , haloperidol tab , hydrochlorothiazide tab (12.50 mg) , hydrochlorothiazide tab (25 mg) , isoniaziazid tab (300 mg) , isosorbid mononitrate tab (10 mg) , isosorbid mononitrate tab (20 mg) , isosorbid mononitrate sr tab (60 mg) , levofloxacin tab (500 mg) , levothyroxine tab (0.05mg) , levothyroxine tab (0.1mg) , levocetrizine tab (5 mg) , labetolal tab (100 mg) , lenezolid tab (600 mg) , lorazepam tab (2 mg) , lithium carbonate tab (300 mg) , metoprolol succinate er tab (25 mg) , metoprolol succinate er tab (50 mg) , metoprolol succinate er tab (100 mg) , methyldopa tab (250mg) , moxifloxacine tab (400 mg) , montelucast 5 mg tab , montelucast 10 mg tab , montelucast + levocetrizine tab (10 mg + 5 mg) , metformin tab (500 mg) , metformin sr tab (500 mg) , metformin sr tab (1000 mg) , methylcobalamin tab (1500 mcg) , mifepristone tab (200 mg) , misoprostol tab (200 mg) , mma drug kit (mifepristone 200 mg + misoprostol 200 mg) , mefloquin tab (250 mg) , metronidazole tab 200 mg , metronidazole tab 400 mg , multivitamin cap , multivitamin tab (as per schudle v of f& c)) , n acetyl cysteine effervisent tab (600mg) , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 7 mg , nicotine patch 14 mg , nicotine patch 21 mg , olanzapine tab (10 mg) , omeprazole cap (20 mg) , omeprazole + domeperidon cap (20 + 10) , ondencetron tab (4 mg) , ofloxacin dt (100 mg) , ofloxacin tab (200 mg) , ofloxacin tab (400 mg) , ofloxacin + orinidazole tab (200 + 500 mg) , oseltamarir 75 mg , pyridoxin (100 mg) , pyrazinamide tab (500 mg) , pyrazinamide tab (750 mg) , pioglitazone tab (15 mg) , polyvitamin tab , paracetamol kid dt (125 mg) , paracetamol tab (250 mg) , paracetamol tab (500 mg) , paracetamol tab (650 mg) , paracetamol sr tab (1000 mg) , pantoprazole tab (40 mg) , pantoprazole + domperidone tab / cap , phenobarbitone tab (30 mg) , potassium chloride tab (600 mg) , potassium chloride tab (750 mg) , potassium chloride tab (1500 mg) , primaquine tab (2.5 mg) , primaquine tab (7.5 mg) , primaquine tab (15 mg) , prednisolan tab (5 mg) , prednisolan tab (10 mg) , prednisolan tab (20 mg) , prednisolan tab (30 mg) , prednisolan tab (40 mg) , promethazime tab (25mg) , quinine sulphate tab (300 mg) , risperidone + trihexyphenidy1 (2 mg) , ranitidine tab. (150 mg) , ranitidine tab. (300 mg) , ranitidine + donperidone tab , rabiprazole tab (20 mg) , rabiprazole + domperidom tab / cap , salbutamol sulphate tab (2 mg) , salbutamol sulphate tab (4 mg) , sodium valpourate tab (200 mg) , trihexyphenidy1 tab (2 mg) , telmisartan tab (10mg) , telmisartan tab (20mg) , telmisartan tab (40mg) , telmisartan tab (80mg) , tranexamic acid cap (500 mg) , tranexamic acid + pcm cap , tinidazole tab (500 mg) , tramadol cap (100 mg) , tramadol + pcm cap , verapamil tab (80 mg) , vitamin a cap (200000 iu) , vitamin a&d cap (vit a 5000 iu+vit. d3 400 iu/cap) , vitamin b complex , vitamin d3 satchet (1 gms) , vitamin b 12 , zolpidem tab (10 mg) , zinc tab (20 mg) , zinc tab (50 mg) , amphotericin inj (20 mg) , amlodarone inj(3 ml) 50 mg / ml , avs inj (anti venoum snake) lypholised , anafortan inj (2ml) , anti rabbies inj (multi dose with 5 syringe) , phenermine meleate inj (2ml) 22.75mg / ml , adrenaline bitartrate inj (1ml) 1 mg / ml , amikacin sulphate inj (2ml), 100 mg / 2 ml , amikacin sulphate inj (2ml), 250 mg / 2 ml , amikacin sulphate inj (2ml), 500 mg / 2 ml , amoxicillin + clavulinic acid inj (1,2gm) , ampicillin inj (250 mg) , ampicillin inj (500 mg) , ampicillin inj (1 gm) , atropine inj (1ml) 0.6 mg / ml , alpha beta artither inj (2ml) , artisunate inj (60 mg) , artisunate inj (120 mg) , aminophyline inj (25 mg / ml) , artracurium inj (10 mg / ml) 2.5 ml , azithromycin inj (500mg) , benzathine benzyl penicillin inj (6 lakh) , benzathine benzyl penicillin inj (12 lakh) , betamethasoneinj (2ml) 4 mg / ml , buskopan inj (20 mg / ml) , bupivacine inj (20 ml) , bupivacine inj (heavy) (bupivaccine 5 mg / ml + dextrose 80 mg / ml ) (anawin neon) , budesonide nebuliser suspension (2 ml) 0.5 mg / 2 ml respules , botropase inj (1 ml) , capnia inj (1 ml) , capnia inj (2 ml) , ceftriaxone inj (125 g) , ceftriaxone inj (250 g) , ceftriaxone inj (500 g) , ceftriaxone inj vial 1 g , cefotaxime inj (125 g) , cefotaxime inj (250 g) , cefotaxime inj (500 g) , cefotaxime inj (1 g) , ceftriaxone + salbectum inj (375 mg) , ceftriaxone + salbectum inj (750 mg) , ceftriaxone + salbectum inj (1.5g) , cefoperazone + salbectum inj (500 mg + 500 mg) , cefoperazone + salbectum inj (1000 mg + 500 mg) , cefepime inj (1 g) , calcium gluconate inj (10 ml) , carboprost inj (1 ml) 125 mcg / ml , carboprost inj (1 ml) 250 mcg / ml , chloramphenicol inj (1gm) , digoxin inj (2 ml) 250mcg / ml , clindamycin inj (2 ml) 300 mg / ml , diclofenac sodium inj (3ml)75mg / 3ml , diclofenac sodium inj (1ml)75mg / ml , dexamethasone inj (2ml) 4 mg / ml , doxycycline inj (100mg) , dicyclomine hcl inj ( 2ml) 10 mg / ml , dizepam inj (2 ml) 5 mg / ml , dopamine inj (5 ml) , drotaverine inj (2 ml) 20 mg / ml , dobutamine inj. (5 ml) (1 mg / ml) , erythropoietin inj (4000iu) , enoxaparin inj (0.4 ml pre filled syringe) 40 mg / amp , enoxaparin inj (0.6 ml pre filled syringe) 60 mg / amp , enalaprilat inj (1 ml ) 1.25 /ml , etomidate inj (10 ml) 2 mg / ml , ethamsylate inj (2 ml) 125 mg / ml , ephedrine inj (1ml) 30 mg / ml , ethiophylin + theophylin inj (2 ml) , fentanyl (2 ml) 50 mcg / ml , frusemide inj (2 ml) (10 mg / ml) , gentamicin inj (20 ml) , gentamicin inj (100 ml) , gentamicin inj (2 ml) 40 mg /ml , gentamicin inj (2 ml) 10 mg /ml , gentamicin e/e drop (5ml) , heparin (5 ml) 5000iu/ ml , heparin (5 ml) 25000iu/ ml , human premixed insullin inj 50/50 (40 mg/ml) , human soluble insulin inj (40 iu/ml) , human premixed insullin inj 30/70 (40 units/ml) , human anti d immunoglobuline (300 mcg / 2 ml) , haloperidol inj (2 ml) , halothane inj (30 ml) , hydrocortisone inj (100 mg) , haexatrin inj , haloperidol inj , iorazepam inj , ivig inj , insulin regular (10ml) 40 iu/ml , iron sucrose inj (2.5 ml) 50 mg / 2.5 ml , ketamine hcl inj (10 ml) 10 mg / ml , ketamine hcl inj (10 ml) 50 mg / ml , labetolal inj (2 ml) , levetiracetam inj (5ml) 500mg / vial , livnocain hcl inj (30 ml) 2% w/v , lignocaine + adrenaline inj (30 ml) , lignocaine heavy inj (2 ml) 5% w/v , levofloxacin inj (500 mg) , lorazepam inj (2 ml) 1 mg / ml , levosalbutamol nebulising solution (2.5 ml) 0.63 mg / 2.5 ml , levosalbutamol + ipratropium brominde nebulising solution (2.5 ml) (1.25 mg + 500 mcg) / 2.5 ml , multivatimin inj (10 ml) for infusion , metoclopramide inj (2 ml) 5 mg / ml , menadione sodium inj (0.5 ml) 1 mg / 0.5 ml , magnesium sulphate inj 500 mg/ ml , methylergometrine maleate inj (1 ml) 0.2 mg / ml , meropenam inj (125 mg) , meropenam inj (250 mg) , meropenam inj (1000 mg) , mephentermine inj (10 ml) , midazolam inj (10 ml) 1 mg / ml , methylcobalamine (1500 mcg / amp) , noradren aline inj (1 mg / ml) , neosligmine inj (5 ml)2.5mg / 5ml , oxytocin inj (1 ml) 5 iu/ ml , ondencetron inj (2 ml) 2mg /ml , promethazime inj , pentazocaine lactate inj (30 mg / ml) , potassium chloride inj (10 ml) 15% w/v , phenytoin sodium inj (2 ml) 50 mg / ml , piperacillin + tazobactum (2 gm + 250 mg / vial) , piperacillin + tazobactum (1 gm + 125 mg / vial) , piperacillin + tazobactum (4 gm + 500 mg / vial) , promethazime inj (2 ml) 25 mg / ml , pentazocin inj (1 ml) , paracetamol inj (2 ml) 150 mg / ml , phytomenabione inj (1 ml) (vitamin k1) , phenobarbitone inj (2ml) (200 mg/ml) , pantoprazale inj (40 mg / vial) , propofol 1% (10 mg / ml) , quinine sulphate inj (2ml) , rabeprazole inj (iv) 20 mg / vial , ranitidine inj (2 ml) 25 mg / ml , succinyl cholin chloride inj (50 mg / ml) , sodium bicarbonate inj (10 ml) 7.5% w/v , suxamethonium inj (2 ml) 50 mg / ml , sodium valproate inj (100 mg / ml) , sepsivac inj (0.3 ml) , sepsivac inj (0.6 ml) , toclizumab (400 mg) , thiopentone sodium inj (500 mg / vail) , teicoplanin inj (400 mg / vail) , t.t inj (0.5 ml) , t.t inj (5 ml) , tranexamic acid inj (5 ml) , tramadol inj (2 ml) , streptokinase inj (7.5 laks) / vials , streptokinase inj (15 laks) / vials , vencomycil (500 mg / vail) , vencomycil (1000 mg / vail) , vancorium inj (4 mg / 2 ml) , vancomycin inj (500 mg) , vancomycin inj (1000 mg) , vecuronium inj (2 ml) 4mg / amp , vasopressin inj (1 ml) 5 mg / ml , anticold syp (60 ml) , anticold drop (10 ml) , albendazole suspension (10 ml), 200 mg/ 5 ml , antacid syp. (170ml) , antacid syp. (megaldrate 400 mg + simethecone 20 mg / 5 ml ) , amoxicillin dry syrup (30ml) , amoxicillin dry syrup (60ml) , amoxicillin drop (15 ml) , amoxicillin + clavulinic acid syp (30 ml) , aceclofenac + pcm syp (60 ml) , azithromycin suspension (15ml) 100mg/5ml , azithromycin suspension (15ml) 200mg/5ml , antispasmodic syp (30 ml) (mefanamic acid + pcm) , antispasmodic drop (10 ml) (dicyclomine + activated diamethicone) , bethamethasone drop (10 ml) , carbamazapine syp (100 ml) 100mg / 5ml , carboxymathyle cellulose eye drop (10ml) , calcium syp. (200 ml) , calcium drop (15 ml) , cefixime dry syp. (30 ml) 50 mg / 5 ml , cefixime drop (15 ml) , cetrizinesyrup (30 ml) , cephalexin dry syp (30ml) 125 mg / 5 ml , co trimoxazole syp (trimethoprin 40 mg + sulphamethoxazole 200 mg) , chloroquine syp (60 ml) , chloramphenicol eye drop (5 ml) 0.4% , cough syp 60 ml codeinae + cpm formula , cough syp 100 ml codenae + cpm formula , cough syp(100ml), dmr + cpm formula , cough syp (60ml), dmr + cpm formula , cough expectorant (100ml) , cough expectorant(60ml) , cough syp (brohnchodialetor) (100ml) , cough syp (brohnchodialetor) (60ml) , cough drop (15 ml) , ciprofloxacin eye drop (5 ml) , clotrimazole and lidocain ear drop (10ml) , donperadon syp. (30 ml) , donperadon drop (10 ml) , enzyme syp (100 ml) , erythromycin syp (60 ml) , gentamicin eye drop (5 ml) , levocetrizine syp (30 ml) (2.5 mg / 5 ml) , moxyfloxacine eye drop (10 ml) , moxyfloxacine + dexamethasone eye (10 ml) , metoclopramide syp (30 ml) , montelucast + levocetrizine syp (30 ml) (4 mg + 2.5 mg / 5 ml) , metronidazole syp (60 ml) 100 mg / 5 ml , metronidazole syp (60 ml) 200 mg / 5 ml , multivitamin syp (100 ml) , multivitamin drop (15 ml) , iron & folic acid syp (100 ml) (ferrous salt) , ibuprofun syp (60 ml) , ibuprofun + paracetamol syp (60 ml) , ondemcetrone drop (10 ml) , ofloxacin syp (30 ml) , ofloxacin + metronidazole syp (30 ml) , ofoxacin + ornidazole syp (30 ml) , paracetamol syrup (60ml) 125 mg / 5ml , paracetamol syrup (60ml) 250 mg / 5ml , paracetamol drop (60ml) 100 mg / ml , phenobarbitone syp (100 ml) , povidine iodione gargle (100 ml) , promethagin syp (60ml) 5mg / 5ml , ranatidine syp (30 ml) , salbutamol sulphate syp (100 ml) 2 mg/5 ml , vitamin a syp (100000 iu/ml) , vitamin b complex syp (100 ml) , wax dissolvent ear drop (10ml) , acyclovir 5% cream (10gm) , anti safety lotion (100 ml) , anti safety lotion (1 l) , benzyl benzoate lotion (100 ml) , betamethasone dipropionate cream (10gm) , calamine lotion (100ml) , clotrimazole 1% cream (15gm) , chlorhexidine mouth wash (100ml) , diclofenac oint (30 gm) , diclofenac pain spray (55 gm) , fradiomycin ointment (10 gm) , gama benzine hcl lotion (100 ml) , gemtial violet 0.5% paint (30 ml ) , livenocain gelly (30 gm) , lidocaine oral gel (10 gm) , neomycin + bacitracin ointment 15 g (5 mg + 500 iu / g) , povidone iodine oint (15 gm) 5% w/v , povidone iodine soln. (500 ml) 5% w/v , povidone iodine soln. (2 litre) 5% w/v , povidone iodine surgical scrub (500 ml) , silver sulfadizine oint. (30 gm) , silver sulfadizine oint. (250 gm) , oral gel nexanox , oral gel ornigreat , tooth paste hydent pro 10gm , tooth paste sensodent k 100gm , tooth paste hydent k 100gm , ciprofloxacin i.v. (100 ml) 200 mg / 100 ml , ofloxacin i.v. (100 ml) 200 mg / 100 ml , metronidazole i.v. (100 ml) 500 mg / 100 ml , normal saline, injection, 540ml, 0.9 % , manitol 20% (100 ml) , manitol 20%, (350 ml) , normal saline, injection, 540ml, 0.9 % , paracetamol iv (100 ml) 1000 mg / 100 ml , sodium chloride (100 ml) (3% w/v) , levofloxacin iv (100 ml) , sodium chloride iv (100 ml) 0.9% w/v , dextrose 25% iv (100 ml) 25% w/v , linzolid i v 300 ml (2 mg / ml) , dextrose 5% iv (500 ml) , dextrose 10% iv (500 ml) , dextrose & sodium chloride (500 ml) (5% + 0.9% w/v) (dns) , ringer lactate inj (500 ml) as per ip , sodium chloride (500 ml) (0.9% w/v) , hemacil (500 ml) , n/2. n.s (0.45% sodium chloride) (500 ml) , isolite p (paediatric maintenance fluid) 500 ml / bottle , inj. normal saline (sod chloride) 500ml , inj.ringer lactate 500ml , chomic catgatwith needle no1 , chomic catgatwith needle no2 , chomic catgatwith needle no0 , vickryl no 1(90 cms) , vickryl no 0 (90 cms) , vickryl no 2 0 (90 cms) , vickryl no 1 with 180 cms (doubble niddle) , silk no1 (76 cms) , silk no 2 0 (76 cms) , cotton thred , silk no 3 0 (76 cms) , prolene no1 (76 cms) , prolene no2 0 (76 cms) , nylon no 2 0 (76 cms) , nylon no 3 0 (76 cms) , nylon no 1 (76 cms) , hernia mesh no 6*11cms , hernia mesh no 7*15cms , hernia mesh no 15*15cms , hernia mesh no 10*15cms , skin stapler , 3 ply mask , absorbent cotton roll , bp appratus mannualmachine , bandage than (90 cm x 16 mtr) 32 tpi clothes , b. t. set , b.p. blade no. 10 , b.p. blade no. 11 , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 , b.p. blade no. 21 , b.p. blade no. 22 , b.p. blade no. 23 , b.p. blade no. 24 , cap disposable , crepe bandage 6 , cotton roll (500 gm) net , cotton zig zag (300 gm) net , disposable syring (0.5 ml) , disposable syring with niddle (insulin) (1 ml) , disposable syring with niddle (1 ml) , disposable syring with niddle (2 ml) , disposable syring with niddle (3 ml) , disposable syring with niddle (5 ml) , disposable syring with niddle (10 ml) , disposable syring with niddle (20 ml) , disposable syring with niddle (50 ml) , disposable needle 18, 20, 22, 26 , dr morpean glucometer , electronic sphygnomanometer , elastoplast bandage , examination gloves (all size) , ecg /altura sound gelly (250 ml) , falcon tubes stand , fully digital bp machine , gluco meter with 2 years warrenty , gluco meter strip of same company , gauze than (90 cm x 16 mtr) , k95 mask , iv set , leucoplast , manual sphygnomanometer , microdrip set , nitrile gloves (all size) , plaster of paris 15 kg , plaster of paris 50 kg , pedia drip set , paper tape (size 1/2 inch) length 9 mtr/pcs , paper tape (size 1 inch) length 9 mtr/pcs , paper tape (size 2 inch) length 9 mtr/pcs , plan catheterno 6 , plan catheterno 7 , plan catheterno 8 , plan catheterno 9 , plan catheterno 10 , rylestube no 5 , rylestube no 6 , rylestube no 8 , rylestube no 10 , rylestube no 12 , rylestube no 14 , rylestube no 16 , rylestube no 18 , rylestube no 20 , surgical cap disposable , sline stand (standred quality) , surgical gloves 6 , surgical gloves 6.5 , surgical gloves 7 , surgical gloves 7.5 , surgical gloves 8 , urin bag (adult) , urin bag (pead.) , foleys catheter (2 way) no 6 , foleys catheter (2 way) no 8 , foleys catheter (2 way) no 10 , foleys catheter (2 way) no 12 , foleys catheter (2 way) no 14 , foleys catheter (2 way) no 16 , foleys catheter (2 way) no 18 , foleys catheter (2 way) no 20 , foleys catheter (2 way) no 22 , foleys catheter (2 way) no 24 , forcape size 6’x 8’ , three way cannula , iv cannula (18 no) , iv cannula (20 no) , iv cannula (22 no) , iv cannula (24 no) , iv cannula (26 no) , weighing machine (digital) , weighing machine (mannual) , scissors size 6’x 8’ , bti(for polluted & non polluted water) , covid 19 detection amphification kit ( anqstrom) , jsb stain 1 (500 ml) bottle , jsb stain 2(500 ml) bottle , slide(50 pcs) box , lab wash (1 ltr bottle) , immerssion oil (25 ml) , w.b.c diluting fluid (500ml / bottle) , sodiummeta bisulfate (500 ml bottle) , v.d.r.l.(syphiline rapid test card ) , glassslide (per box) 50pcs , sodium citrate 3.8% (500ml) , uric acid kit (200ml) bottle , microablumin test strip (per test) , crp test kit (turbi) 50ml bottle , aso titre kit , hbsag kit (hepatatis b rapid test card) 1 step , hiv & syphilis combo rapid test kit , fully automated analyser cleanser chemical (100ml) , pregnancy rapid test card , refrigerator 2 8 with glass self , ra test kit (turbi) 50ml bottle , widalkit (10*4 ml) , methenol (500ml) , micro pipelte (100 to 1000ml) , micro pipelte (10 to 100ml) , micro pipette tips (20 to 200 ?l) (himedia) , micro hps (1000ml) , micro hps (100ml) , tissuepaper (per box of 100pcs) , washbottle (500ml bottle) , pricking needle (per box of 100 pcs) , glucose (1000ml bottle) , urea (500ml bottle) , creatnine (500ml bottle) , cholesterol (500ml bottle) , triglyceride (500ml bottle) , temephos , hdlcholesterol (100ml bottle) , bilrubine total (100ml bottle) , bilrubine direct (100ml bottle) , sgpt (500ml bottle) , sgot (500ml bottle) , alkline phosphate (100ml bottle) , total protein (200ml bottle) , albumine (20ml bottle) , urinestrip (2 parametor) per bottle of 100 test , urinestrip (4 parametor) per bottle of 100 test , urinestrip (10 parametor) per bottle of 100 test , edta vial (100 pcs pkd.) non vaccume tube, doubble cap , plain vial (100 pcs pkd.) non vaccume tube, doubble cap , fluride vial (100 pcs pkd.) non vaccume tube, doubble cap , centrifusemachine , blood group abo & rh (3*10ml) , hb pipette , hb tube square , bgem card (blood gas analyzer kit) , dengue ns 1 antigen kit , dnase rnase free water (himedia) , ethanol 100% (himedia) , isopropyl rubbing alcohol (100ml bottle) 68 72% v/v , isopropyl rubbing alcohol (400ml bottle) 68 72% v/v , isopropyl rubbing alcohol (5000ml jar) 68 72% v/v , 3 8% sodium litratt 500ml , fluride vial , leshmain stain , ls instruments bs 2 , ls instruments leminar airflow , ls instruments vertical auto clave (12*20) , ls instruments (80 degree) ultra low temp. freezer , ls instruments pass box , centrifuge machine (fixed angle rotoe hade) (neuation technology) , mini centrifuge machine(with pcr strip rotter) (neuation tcehnology) , n/10 hcl , ecg/ ultrasound jelly 250 ml , filter tips (qiagen) machine only 1000?l , gulcometer strip 25stp.(dr. morphen) , tetra , vtm stand (tarsons) , parafilm 2 , para film , qiagen automated nucleic acid extraction system , test tube stand (48 tubes) , labman drybath incubator , deep freezer ( 20 degree) (100 ltr) (celfrost) , vortex mixture machine (neuation) , rotar adaptor (qiagen) machine only , rtpcr machine (bio rad cfx 96) with computer system , cardboard box for falcon tube sample collection storage , cryochill vial (1.8 ml) (tarsons) , cryo vial (himedia) , mct tube (2 ml) (tarsons) , mct tube (1.5 ml) (tarsons) , qiagen pipette tips (1000 ?l) , qiagen viral rna mini kit , lab apron , micro pipette tips 1/4 universal , mct tube 1.5 ml/2ml , mct tube stand , micro pipette (thermo scientific) 100 1000 ?l , micro pipette (thermo scientific) 02 20 ?l , micro pipette (thermo scientific) 20 200 ?l , micro pipette (thermo scientific) 20 200 ?l , micro pipette (thermo scientific) 100 1000 ?l , multichannel micro pipette (thermo scientific) , micro tips 5 ml , micro pipate (variable) 1 5 ml , water bath (remi) , pyrethrum extract 2% for spare spray , ppe kit (standred size) , sprit lamp 50ml , floride ion meter , abdominal bet (small) , abdominal bet (medium) , abdominal bet (large) , ambu bag (paediatric) , ambu bag (adult) , bucket plastic brand 15 ltr , bleaching powder (25 kg bag), contains not less than 30 % w/w of available chlorine (as per i.p) , baby diaper small size , baby tawels , bio waste basket all four colours (30 ltr) , bio waste troley (set of three) , biohazard bags (red, yellow, black, blue) , c pap , disposal gown , electric cattle , fire extinguisher , five para moniter (12 screen) with peadatric wrist probe , feeding cup with spoon , glucose c or d powder (100 gm) , glucose c or d powder (200 gm) , glucose c or d powder (500 gm) , glucose c or d powder (1 kg) , hemoglobin meter , hemoglobin strip , hand wash (standred quality) 200ml , hand wash (standred quality) 500ml , hand wash (standred quality) 5 ltr. , lifebuoy soap 125gm , mug plastic brand 1 ltr , neonatal eye protector , o2 hood (all size) , ors powder 21.8 g (as per who formula) , ors powder pead 4.2 g (as per who formula) , small dustbin , sanitary pad (deluxe) / pkd of 7 pcs , sugar test strip , sugar test machine (gluco meter) (price of gluco meter & strip most be of same company) , suction machine (electric) , salbutamol sulphate inhalor (200 mdi) , sanitizer 100ml , sanitizer 200ml , sanitizer 500ml , sanitizer 5 ltr. , tub plastic brand20 ltr , towel 1.5x2.0 feet , temphos / ltr. (polluted & non polluted water) , three way cannula , mosquito fogging machine model 180p , mosquito fogging machine small size , pulse oximeter , paediatric nasal prongs (preterm 3mm, 3.5mm) , pyrethrum extract 2% space spary / liter , ventilator (neonatal) , waiting chair (3 in 1) (stainless steel) , x ray film 8x10 (green) 50 pc/ pkt , x ray film 10x12 (green) 50 pc/ pkt , x ray film 12x15 (green) 50 pc/ pkt , x ray film dental (green) 150 pc/ pkt , zeeper bag (plastic) / kg...

Health Department - Jharkhand

37709206 group b rate contract for medicine at sadar hospital koderma , items : , tab. paracetamol ( 250 mg ) , tab. azithromycin ( 250 mg ) , tab. fluconazole ( 150 mg ) , tab. losartan potassium ( 50 mg ) , tab. ofloxacin ( 100 mg ) , tab. ofloxacin ( 200 mg ) , tab. ofloxacin + ornidazole , tab. calcium carbonate ( 500 mg ) &vitamin d3 , tab. clopidogrel ( 75 mg ) , tab. atorvastatin ( 10 mg ) , tab. erythromycin estolate ( 500 mg ) , tab. metformin ( 500 mg ) , tab. calcium & vit d3 250 mg ( each ) , tab. ciprofloxacin ( 250 mg. ) , tab. domperidone ( 10 mg. ) , tab. paracetamol ( 500 mg ) , tab. prednlsolone ( 5 mg ) , tab. prednlsolone ( 10 mg ) , tab. prednlsolone ( 20 mg ) , tab. azithromycin ( 500 mg ) , tab. famotidine ( 20 mg ) , tab. ibuprofen ( 200 mg ) , tab. ibuprofen ( 400 mg ) , tab. metronidazole ( 200 mg ) , tab. metronidazole ( 400 mg ) , tab. multivitamins ( as per schedule v of drugs and cosmetics rules ) ( 1 tab ) , tab. ciprofaloxacin ip + tinidazole ( 500 mg.+600 mg ) , tab. ciprofloxacin ( 500 mg. ) , tab. co trimoxazole ds ( 160 mg.+800 mg. ) , tab. co trimoxazole ss ( 80 mg.+400 mg. ) , tab. norfloxacin ip + tinidazole ( 400 mg+600 mg. ) , tab. cetirzine ( 10 mg ) , tab. nimesulide + paracitamole ( 100mg+325mg ) , tab. accelofenace+ para ( 100 mg + 325 mg ) , tab. ibuprofen ip+ paracetamol ip ( 400 mg.+325 mg ) , tab. ranitidine ( 150 mg. ) , tab. amoxycillin+ clavulanic acid ( 500+125 mg ) , tab. amoxycillin+ clavulanic acid ( 250+125 mg ) , tab .paracetamol + diclofenac sodium ( 325 mg.+50 mg ) , tab. dicyclomine hydrocloride.+ paracetamol ( 20 mg.+325 mg. ) , tab. misoprostal ( 200 gm ) , tab. salbutamol ( 4 mg ) , tab. folic acid 400 microgram , tab. norfloxacin 400 mg , tab. enalapril maleate 5 mg , tab. phenoxymethylpenicillin potassium 250 mg , tab. zinc sulphate 50 mg , tab. chloroquine 150 mg , tab. albendazole ( 400 mg ) , tab. amlodipine ( 5 mg ) , tab. cephalexin ( 500 mg. ) , tab. ondansetron ( 4 mg ) , tab. tinidazole 600mg , tab. allopurinol 100 mg , tab. rabiprazole 20+ domperidome 10 mg , tab. cefexime 200 mg , tab. doxycycline 100 mg , tab. vitamin c 500 mg , tab. paracetamol ( 650 mg ) , cap. amoxicillin ( 250 mg ) , cap. amoxicillin ( 500 mg ) , cap. tramadol 100 mg , cap. omeprazole ( 20 mg ) , cap. iron folic acid , cap. iron , cap. amoxy 250 + cloxy 250 , cap ampi 250 + cloxy 250 , cap. ampicillin 500 mg , cap tramadole 50 mg , syrup domperidom ( 30 ml ) , syrup ofloxacin ( 30 ml ) , syrup salbutamol sulphate ( 100 ml ) , syrup metoclopramide ( 5mg / 30ml ) , syrup. b complex 100 ml ( each ) , syrup paracetamol ip 125 mg ( 60 ml ) , syrup. cough supressent ( dextromethorphan based ) dextromethorphan hyd, chlophenical maleate&phenylephrine hyd ( 60ml ) , syrup. cough supressent dextromethorphan hyd, chlophenical maleate&phenylephrine hyd. ( 100ml ) , syrup. diphenhydramine hydrochloride ammounium chloride sodium citrate &menthol100 ml , syrup. cotrimoxazole ( 50 ml ) , syrup. amoxicillin 125 mg / 30 ml , syrup. nimesulide + para 60 ml , syrup potassium chloride solution , syrup. azithromycin 200 mg / 15ml , syrup. chlorphenatamin + dhenylephrione 60 ml , syrup. anti allergical cough suppresent 60 ml , syrup. metronidazole 60ml , syrup multivitamin , syrup ondemsetron , syrup hemfer , syrup. carbamazepine , syrup promethazine 60 ml , syrup. norbin power 30ml , syrup. zinc sulphate 100 ml , syrup. erythromycin 60 ml , syrup. ibuprofen 60 ml 100 mg , syrup. ibuprofen & paracetamol 60 ml , syrup do 60ml. , syrup carbamazepinesyrup , syrup. vitamin a 100ml , syrup promethazine 30ml , syrup. glyceryl trinitrate , syrup cetrizine ( 30 ml ) , syrup. carbamazepine , scabe lotion 100 ml , drop flurabifrofen eye5 ml , drop tropicamide with phenylephrine ( eye drop ) , drop homid ( eye drop ) , drop nephafenac ( eye drop ) , drop paracain ( eye drop ) , drop paracetamol 15 ml , drop ondenstron , drop cough 15 ml , drop multivitamin 15 ml , drop oflox oz 30 ml , drop azithromycin 100 mg susp. 30 ml , drop enzyme 15 ml , drop enzyme 100 ml , drop amoxicillin 10 ml , drop cefexime oral susp. 30 ml , drop domperidone , drop butrodol , drop moxifloxcin eye ( 5ml ) , drop lubricant eye ( 5 ml ) , drop. amoxycillin & potassium clavulanate oral 30ml , drop. cefpodoxime proxetil oral 30ml , drop dicyclomine , drop gentamycin eye / ear , drop ciprofloxacin eye ( 5ml ) , drop gentamycin ear ( 5ml ) , drop suspension albendazole ( 200 mg / 15 ml ) , drop suspension albendazole ( 100 mg / 15 ml ) , drop vitamin d3 15 ml , lens power number 21 to 24.5 ( each any number ) , sachet bifilac 0.5 gm , inj. ranitidine ( 25 mg / 2ml ) , inj. amlkacin ( 250 mg / 2 ml ) , inj. gentamicin ( 40 mg / ml ) , inj. ceftriaxone ( 1 gm ) with water , inj. ceftriaxone ( 125 mg. / 5 ml ) with water , inj. ceftriaxone ( 250 mg. ) with water , inj. ceftriaxone ( 500 mg. ) with water , inj. tramadol ( 50 mg ) , inj. gentamicin ( 80 mg / ml ) , inj. paracetamol 10 ml , inj. metoclopramide5mg , inj. amikacin ( 500 mg ) , inj. diclofenac ( 25 mg / 1ml ) , inj. ondansetron ( 4mg ) , inj. dicyclomine ( 10 mg ) , inj. human rabies immunoglobulin ( 300 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 250 iu / 2 ml ) , inj. human tetanus immunoglobulin ( 500 iu ) , inj. human tetanus immunoglobulin ( 1000 iu ) , inj. hepatitis b immunoglobulin ( 200iu / 1ml ) notavl , inj. hepatitis b immunoglobulin ( 100iu / 1ml ) , inj. anti imnuoglobin 250 mg , inj. anti imnuoglobin 1 gm , inj. pentazosin ( amp ) , inj. equine rabies immunoglobulin ( 1500 iu / 5 ml ) , inj. ampicillin 500 mg , inj. ampicillin 250 mg , inj. benzathine penicillin ( 6 lakh units ) 450 mg , inj. benzathine penicillin ( 12 lakh units ) , inj. anti rabies vaccine with 5 syringe ( multi dose intra dermal 1 ml ) , inj. dexamethasone 4 mg , inj. oxytocin 2 ml , inj. anti rabies vaccine withsyringe ( single dose intra muscular 0.5 ml ) , inj. desferal , inj. effcorlin , inj. cefotexime 125 mg , inj. cefotexime 250 mg , inj. amikacin 100 mg , inj. aminofylin 10 ml , inj. meropenum 1000 mg , inj. meropenum 500 mg , inj. meropenum 125 mg , inj. nikethamide each , inj. pipracillin 4000mg + tazobactom 500mg , inj. phenobarbiton , inj. phenytoin 100 mg , inj. caffirate , inj. livipil , inj. doubutamine , inj. xylocain 2% with adrinaline 30ml , inj. efipres each , inj ampicillin 125mg , inj.chromostate , inj. medazolam , inj. propofol 10 ml , inj. phenargan , inj. fentanyle , inj. kcl , inj. heaparin , inj. pethedin , inj. glycopyrolet , inj. butrodol 1 ml , inj. butrodol 2 ml , inj. suceinyle cholene , inj. calmpose , inj. noloxone , inj. butorphanal , inj. vecurouium , inj. adrenaline , inj. lignocaine hydrochloride& adrenaline 30ml vials , inj. triamcinolone acetonide 31ml , inj. defrioxamine 500 mg , inj. calcium gluconateiv 1gm , inj. aminophyline each , inj. mephentine , inj. spasmocare , inj. ketamin 10 mg , inj. streptomycin injection 0.750 grm , inj. streptomycin injection 0.500 grm , inj. streptomycin injection 1.000 grm , inj. capreomycin 01 grm , inj. cepromycin 750 mg , inj. kanamycine 01 grm , inj. kanamycine 500 mg , inj. hydrocortsione 100mg , inj. anawin ( 5% ) 30 ml , inj. insulin 40 units / 10 ml , inj. insulin zinc suspension 40 unit / 10 ml , inj. betamethasone4mg / ml , inj. furosemide 10 mg / ml , inj. diazepam5 mg , inj. etophyllin + theophylline ( deriphyllin ) , inj. cloxacillin 250 mg , inj. prostodine , inj. hydrocortisone 100mg , inj. drotaverin2 ml , inj. atropine 0.6 mg , inj. tranexamic acid , inj. vitamin k ( phytomenadione ) , inj. vitamin k 3 ( menadione ) , inj. xylocain 2%30ml , inj. xylocain 5%30ml , inj. phenylphrine ( 1ml ) , inj. camolol , inj. methergin , inj. sodium chloride ivi.p 0.9% w 1 v 500 ml , inj. aminophiline , inj. prostaglandin 205 mg , inj. prostadine each , inj. pipracillin + tazobactum 4.5 gm , inj. donperidone , inj ondacetron 2ml , inj. azithromycin 500 mg , inj augmentin 1.2 gm , inj paracetamol 1 gm , inj mvi , inj dobutamine , inj lasix , inj termin , inj nitroglycerine , inj esmolol , inj amzodarone 300 mg , inj. anti snake venum , inj. hydrocortisone sucoinate 100mg , inj. promethazine 25 mg / 2 ml , inj. magsulph magnisium sulphate i.p 50% , inj. oxytocin inj. , inj. phenytoin sodium 2 ml , inj. sodium bicarbonat iv 7.5% 10 ml , inj. sodibicarb 10 ml amp ( 7.5% ) , inj. anti d300 mg , inj. labetalol 100 mg , inj. labetalol 50 mg , inj. potassium chloride , inj. prostaglandin 205 mg , inj. dopamine 200 mg 10 ml , inj. betamethasone sodium phosphate , inj. plasma volume expender 500 ml bottle , inj. bupivaccine 0.5% 20 ml , inj. ropin 0.75% ( ropivacain ) ( neon ) , inj. dexmedine 100 ug , inj. atacurium ( atracurium ) , inj. anemol ( paracetamol 1 gm 100 ml ) , inj. midfast ( misazolam ) , inj. iflurane ( isoflrane ) 100 ml , inj. avil each , inj. hydrocortisone succinate ( efcorlin ) each , inj. dopamine each , inj. calcium sandoz each , inj. neostigmine each , inj. iron sukroj amp each , inj. ondacetron 2ml , inj. azithromycin 500 mg , inj. pentoprazole , ini. streptomycin injection 0.500 gram ( per vials ) , inj augementine 1.2gm , inj atracurium , inj noradrenaline , inj. digoxin , inj. insulin regular , inj. insulin intermediate , inj. aminophylline , inj. benzathine benzyl penicillin , inj. lignocaine hydrochloride , inj. streptokinase 7.5 lac vial , inj. streptokinase 15 lac vial , inj.mixed human insulin 30 / 70 , inj. mixed human insulin 50 / 50 , inj. penidure la6, la 12 , inj. pantaprazole 40mg , inj. hepatitis b immunoglobulin 100 iu / 0.5ml. , inj. heaparin 25000iu , inj. heparin sod 5000 iu , inj. heparin sod 10000 iu , inj. heparin sod 1000 iu , inj. hynidase , inj atracurium 2.5ml. , inj. diazepam , inj. promethazine , inj. promethazine , inj.glyceryl trinitrate , inj. tetvac vial 5ml , inj. tetvac vial 1ml , inj. rabis immunoglobin 1500 iu , inj. methylcobalamin , nicotinamind, pyridoxine hcl&d panthenol.2ml , inj. hydroxyprogesterone caproate 250 mg , inj. hydroxyprogesterone caproate 500 mg , inj. amikacine 100mg , ors powder ( 21.8 gm. pkt. ) , 2% xylocain jelly 30 gm , luliconazole cream 10gm , luliconazole lotion 15gm , diclofenac spry , ketokonazole soap , enteroglemina , oint. povidine iodine oint15 gm , oint. clotrimazole 15 gm , cream. clobetasol propionate, neomycin sulphate&miconazole nitrate , oint. clotrimazole + gentamycin + beclometasone ointment 15gm , oint. silverex ( 250 gm ) jar , drops. ciprofloxacine & betamethasone sodium phasphate e / e , drops. gentamicin & betamethasone sodium phasphate e / e , drops. ofloxacine & betamethasone sodium phasphate e / e , drops. moxifloxacine & dexamethasone sodium phasphate e / e , gamma benzene hexachhloride &cetrimide lotion 100ml , oint. clotrimezole oint. 15 gm , tab.glyceryl trinitrate , tab.alprazolam 0.25 mg , tab.alprazolam 0.50 mg , tab.cephalexine 250 mg , tab.drotavarin , tab.defrijet 250 ( each uncoted tab. for oral suspension contains deferarirox 250 mg ) , tab.defrijet 500 ( deferasirox 500 mg ) , tab.darcolex 500 mg , tab.digoxin 0.5 mg , tab. metoprolol 25 xl mg , tab. metoprolol 50 xl mg , tab. aspirin 75mg , tab. hydrochlorthiazide 12.5 mg , tab. hydrochlorthiazide 25 mg , tab. enalapril 2.5 mg , tab. enalapril 5 mg , tab. captopril , tab. clopidogrel , tab. isosorbidedinitrate ( sorbitrate ) , tab. glyceryl trinitrat , tab. verapamil ( isoptin ) , tab. potasium ip ( pencylin v ) , tab. carbamazepine , hiv rti / sti kit kit 1 grey a ) tab. azithromycin 1 gm tab. b ) tab. cefixime 400gm. 1 tab. , hiv rti / sti kit kit 2 green a ) tab. secnidazole 1 gm 2 tabs. b ) tab. fluconazole 150 mg1 tab. , hiv rti / sti kit ( kit 3 white a ) inj. benzathine penicillin 2.4 mu 1 no. b ) tab azithromycin 1gm. 1 tab. c ) sterile disposable syringe 10ml.21 g needle 1 no. d ) sterile water 10 ml. 1 no. ) , hiv rti / sti kit kit 4 blue a ) cap. doxyccline 100 mg. 30 caps. b ) tab. azithromycin 1gm. 1 no. , hiv rti / sti kit kit 5 red a ) tab. acyclovir 400 mg. 21 tab. , hiv rti / sti kit kit 6 yellow a ) tab. cefixime 400 mg 1 tab b ) tab metronidazole 400 mg. 28 tabs c ) cap. doxycycline 100 mg 2 tab , hiv rti / sti kit kit 7 black a ) cap. doxycycline 100mg 42 caps b ) tab. azithromycin 1 gm 1 no. , tab. azithromycin 100mg , tab. atenol 100 mg , tab. glimepride 5 mg , tab. premaquine 2.5 mg , tab. misoprostol 200 mg , tab. isoniazid 100 mg. , tab. isoniazid 300 mg. , tab. pyridoxine 100 mg , tab. pyrazinamide 750 mg , tab. pyridoxine 50 mg , tab. pyridoxine 25 mg. , mma drugs for safe abortion services ( in combi pack 1 tab mifepristone 200 mg and 2 tab misoprostol 200 mcg each tab ) , respule salbutamol + iprapropiun , respule budenocide , tab. methyldopa 250 mg , tab. pan 40 ( pantotrazole ) , tab. methyl dopa each , tab linezolid 600 mg , tab amlodeepine at , tab deriphyllin 50 mg , tab dexamethasone , tab enzyme , tab hcqs 200 mg , tab hcqs 400 mg , tab wysolone 10 mg , tab. glimepride 1 mg , tab. chlroquine 250 mg , tab. premaquine 7.5 mg , tab. erythromycin 250 mg , tab. trimethoprim 80mg & sulphamethoxazole 400 mg ( adults ) , tab. atenolol ( 25 mg ) , tab. atenolol ( 50 mg ) , tab. cefexime 100 mg , tab. pentoprazole 40mg , tab. favi piravir , tab. ivermectin , tab. asprin ( 75 mg ) , tab. captopril 2.5 mg , tab. methyldopa 500 mg , tab.atorvastatin 10 mg , tab. digoxin , tab. potasium ip ( penicillin v ) , tab. nifedipine 5 mg , tab. nifedipine 10 mg , tab.folic acid , tab. carbamazepine , tab prednisolone , tab promethazine , tab atenolol 25 , tab. metoprolol 25 , tab methyldopa 250 mg , tab. frusemide 40 mg , tab. issorbide dinitrate ( sorbitrate ) 10 mg , tab. issorbide dinitrate ( sorbitrate ) 5 mg , tab pioglitazone ( 15mg ) , tab. vildagliptin ( 50 ) , tab b complex , tab. methylcobalamine 1500 &alpha lupic acid &pyridoxine&folic acid , tab. telmisatan 40 mg , tab. escitelopam 5 mg , tab. pantaprazole ( 400 ) , tab. pantaprazole + domeperidone , tab. ondacetron ( ondem ) , tab atorvastatin 10 mg+ecosprin 75 ( combined ) , tab. epselin ( 100 mg ) . , tab. amlodipine2.5 mg, , tab. amlodipine 5mg , tab. amlodipine 10mg , tab ondencetron 4 mg , tab. nifedipine ( 5mg ) , tab. telmisartan 20 mg , tab. telmisartan 40 mg , tab metron 500mg , caps promethazine , cap hydroxyurea 500 mg , cap. rifampicin 150 mg , cap. rifabutine 150 mg , cap. clofazimine 100 mg. , cap. ampicillin 250 mg , cap depin 5 mg , cap depin 10 mg , cap chloramphenicol eye ointment 250 mg , cap vitamin bcomplex , cap. clofazimine 100mg , formalin500ml , oxygen nesal set paed , oxygen nesal set adult , oxygen nesal set ( neonetal ) , oxygen hood , corogated drain disposable , corogated drain rubber , vac set ( closewoundsuction ) size size 14 18 , adk set ( abdominal drain ) size 20 32 , cautery pencil , cotery pad disposable , pmo line ( 100 / 150 / 200 cm ) , 3 way line connector , senitizer 5 liter jar , pedia set 110 ml , pedia mask 0, 1 , feeding tube no. 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 , foleys catheter no. 14, 16 , ryles tube adult no. 6, 8, 10, 12, 14, 16, 18 , permethrin lotion 30 ml , plain catheter no. 10 , plain rubber urinary catheter each , hernia kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , mva / eva for safe aboration sevice kit , ec lotion 100 ml , crepe bandage 4x 4mtr , crepe bandage 6x 4mtr , french chalk powder 1 kg , viscoelastic hypersole , bitadin hand scrab , sprit 1 ltr. , soft cotton 4x 3mtr , soft cotton 6x 3mtr , roller bandege 2”x 3mtr , roller bandege 3”x 3mtr , roller bandage 4x 3mtr , roller bandage 6x 3mtr , gypsona 6x 2.7mtr , gypsona 4x 2.7mtr , leucoplastroll 4 x 6mtr , leucoplast roll 2x 6mtr , bandage than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , needle 26g , needle 24g , vicryl no:1 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no:1 0 ( 1 / 2 rc , 90 cm lenth ) , vicryl no. 2 0 curved round body needle ( 90 cm lenth ) , vicryl no. 3 0 curved round body needle ( 90 cm lenth ) , vicryl no. 4 0 curved round body needle ( 90 cm lenth ) , vicryl no. 6 0 curved round body needle ( 90 cm lenth ) , vicryl no:1 0 ( 40 mm1 / 2 rb, 90 cm lenth ) , vicryl no: 1 ( 40 mm1 / 2 rb tc 180 cm double needle ) , chromic catgut no:1 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:1 0 ( 40 mm1 / 2 rb, 76 cm lenth ) , chromic catgut no:2 ( 45 mm1 / 2 rb, 100 cm lenth ) , chromic catgut no: 2 0 ( 30 mm 1 / 2 rb 76 cm lenth ) , prolene 1 0 curved round body , prolene 2 0 curved round body , prolene 3 0 curved round body , prolene 3 0 curved cutting needle , pds 5 0 curved round body , pds 6 0 curved round body , ethilon 3 0 curved cutting needle , ethilon 4 0 curved cutting needle , silk thred 3 0 curved round body , silk thred 4 0 curved round body , suture 10.0 , cresent knife 2.5 mm , keratome knife 2.8 mm , respirometer ( 3 ball ) disposable , prolene mesh size 6 x 11 cm , prolene mesh size 8 x 15 cm , prolene mesh size15 x 15 cm , trimmer ( per pcs ) , deshnet 1 ltr. jar , bt set ( sigle chamber ) disposable , tamophose 50 ec ( 5 ltr. jar ) , distil water 7.4 5 ltr. jar , perineal sheet , sodium metabisulfate 500 gm , gentian violet 500 ml , glass slide ( per box ) 100 pcs , saving blade , ecg gel 1 kg , usg gel 1 kg , ab gel , sticking plaster ( surgical tape ) 2.5 cm x 9.10 m , cotton thred no. 10 , surgical uncals utility gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves sterile all size ( no. 6.5, 7, 7.5 ) pair , surgical gloves ( non sterile ) all size ( no. 6.5, 7, 7.5 ) pair , gloves ( nitrile ) all size ( 100 pc / 50 pair ) , shoe covers. ( disposable ) , service gloves 400 mm , mask surgical 3 lyer ( with nose clip ) , mask surgical 3 lyer ( without nose clip ) , n95 mask ( with nose clip ) , n95 mask ( without nose clip ) , mask cotton cloth , duoline repsules , umbilical cathether ( 100 pc ) , nenaton cathether no. ( 6 to 18 any each no. ) , iv set ( disposable ) , povidine iodine solution ( 500 ml ) 5% , povidine iodine solution ( 100 ml ) 5% , povidine iodine gargile ( 100 ml ) , gouze than ( 90 cm x 16 mtr ) f ( ii ) d&c rule 1945 , plaster of paris 5 kg jar , surgical sprit 100 ml , urobag disposable 2000 ml , endotracheal tube 2.5 4.5 plain , endotracheal tube couved5 to 12 , hydrogan pyroxide 100 ml , priking needle len set , sanitizer 500ml litre , i v canula size no: 18, 20 & 22 , i v canula no: 24 , savlon ( 100 ml ) each , band aid , malaria kit , bleaching powder ( 25 kg beg ) , kelleys pad each , blood bag , sodium hypochloride , umbilical cord clamp , suction tube plain size no:6 16 , mersilk 2.0, 1.0 cutting needle 90 cm lenth , n / g tube 5, 6 no. , silk thred ( reel ) no: 0 1, 0 2 , pregency kit , spinal needle no: 23 , 24, 25, 26, 27 , ryles tube infant size all , microdrip set , nosogastric tube no. 6 , spirit ( 100% ) ( per 5 ltrs ) , surgical spirit ( 100% ) 5 ltrs jar , nosogastric tube no. 6 feeding tube , plain rubber urinary catheter , curved cutting needle each , gentian violet 30 ml 0.5% , ecg paper ( schller ) ( per pkt. ) , sodium hypo chloride ( 5 ltr jar ) , disposable syring 1 ml , disposable syring 2 ml , disposable syring 3 ml , disposable syring 5 ml , disposable syring10 ml , disposable syringe 20 ml , disposable syringe 50 ml , insuline syringe 40 u , cotton400 gm , micropore 2x9mtr , mucus exatractor , bp blade all size , lysol 400 ml , oxygen mask set ( complete set ) , infusion set with hypodermic needle 21g 1.5 , disposable delivery kit ( ddk kit ) ( content of the kit2 pair of glove blade 1 pc carbolic soap 1 cord clamp 1 plastic sheets 2x2 mtr. ) , intera kit, size 18 / 20 / 22 ( infusion therapy kit ) iv canulla 1 pc, canulla fixatar 1pc, syringe 5 ml 1pc, sterile alcohol swab 1pc, infusion set 1 pc , micro scalp veinset no. 26 ( buterfly ) , formalin ( 5 ltr. jar ) , plain rubber urinary catheter each , mosquito repellent each , curved cutting needle each , cidex 5 ltr. jar , nsv kit , casete with inensifying screen 12x15 ( konica ) , casete with inensifying screen 12x12 ( konica ) , casete with inensifying screen 12x10 ( konica ) , casete with inensifying screen 8x10 ( konica ) , developing tank ( 13.5 ltr. ) , appendectomy bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalneedle no. 25 , developer13.5 ltr , fixture13.5 kg , chest stand flour model , safe flight 8x10 , clip big , half flim bloker 12x15 , half flim bloker 12x12 , half flim bloker 12x10 , half flim bloker 8x10 , x ray film 8x10 ( blue ) ( 50 pc pkt. ) , x ray film 10x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x12 ( blue ) ( 50 pc pkt. ) , x ray film 12x15 ( blue ) ( 50 pc pkt. ) , cr x ray film 8x10 ( 125 sheet ) make konika , crx ray film 10x12 ( 125 sheet ) make konika , dve x ray film 8x10 ( 125 sheet ) make carestream , dve x ray film 10x12 ( 125 sheet ) make carestream , halothen i.p 0.01%ww , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , ambubag with zero size ( infant ) , triple dye lotion , lead apron , inj. metronidazole iv 100 ml , iv amninovein 10% ( 500 ml ) , iv dextrose 10% 500 ml , iv dextrose 25% 100 ml , iv isolyte p 500 ml , iv n / 4 ns 500 ml , iv dns 0.45% , iv dns 10% , iv dns ( 500 ml ) , iv ns ( 500 ml ) , iv 5% dextrose ( 500 ml ) , iv rl 500 ml , iv rl glass 500 ml , inj. ciprofloxacine iv 100 ml , inj. mannitol 20% 300 ml , hydrocele operation kit ( bp blade no. 22 1 pc, disposable shaving set 1 pc, surgical gloves ( 7, 7.5 no. ) 1 pair, corrupated drain ( romsons ) 1 pc, no ( 1 0 ) intestinal catgut ( chromic catgut needle ) 2 pc, mersilk ( 2 0 ) cutting needle 2 pc, spinalne , cold box with ice pack 6 ltr , cvc catheter uno4, 5, 6 fr lenth 15 / 16, 20 cm , cvc catheter duo7 fr lenth 15 / 16, 20 cm , cvc catheter trio 7 fr lenth 15 / 16, 20 cm , cvc catheter trio 5 fr lenth8 cm , epidural minipacksize no: 16 g, 18g , av fistula needle size no: 15g, 16g, 17g , av fistula needle size no: 15g, 16g, 17g pair , three way stop cock with extention 10, 25, 50 cm , heamodilysis kitdouble size :12fr x13 cm , heamodilysis kittriplesize :12fr x13 cm , sample cup , allicote ( bullete tube ) , liga clip lt 300 , liga clip lt 400 , tube ciller , refrigertor graph paper , calpol suppository , duphalac suppository , ecg lead neonate , paraffin wax , xylene 5 ltr. jar , 100% absolute alcohol 5 ltr. jar , hematoxylene stain , scotts tap water , eosin tap water , hcl 1% , dpx mount 250 ml , scalpel for hpe , blades for scalpel , water bath ( small ) 2 ltr. , staining jar ( coplin jar ) 250 ml , glycerine ( 500 ml ) , glass marker ) , hmf sachet 1 gm , sodium choride ( nacl ) 500 grmper pkt. ) n / 1o , disodium hydrogen phosphgate ( na2hpo4 ) , 500 gm per pkt. , sodium dihydogen phosphate ( nah2po4, 2h2o ) 500 gm pkt. , anthydrous ( k2 hp04 ) 500 gm pkt. ( potassium phosphate dibasci anhydrous , sponin 1000 gm per pkt. , micropippet 200 1000 ul. , micropippet 5 50 ul. , variant ii control ( for hplc machine ) , variant ii sample ( 100x1.5 ml ) vial ( for hplc machine ) , cal a and cal b ( for electrolyte machine ) ( tulip ) , sodium fluoride vail ( non vacuum ) 2 ml ( 100 pc ) , citrate 3.2% vail ( non vacuum ) ( 100 pc pkt ) , urineanalyzer strip ( 10 para ) ( urit 50 biogeny ) , hi aid ( medicated dressing ) 22 mm diameter , vidas t3 1x60 t ( mini vidas ) , vidas t4 1x60 t ( mini vidas ) , vidas tsh 1x60 t ( mini vidas ) , vidas fsh 1x60 t ( mini vidas ) , vidas lh 1x60 t ( mini vidas ) , prolactin 1x60 t ( mini vidas ) , vit d 1x60 t ( mini vidas ) , d dimer 1x60 t ( mini vidas ) , ns troponin i ( mini vidas ) , covid ig g ( mini vidas ) , covid ig m ( mini vidas ) , p.t. vail 1x100 ( mini vidas ) , urine analyzer print paper roll ( urit 50 biogeny ) , cuvette ( for coagulation analyzer ) ( make sysmex ) , p.t. test kit ( for coagulation analyzer ) ( make sysmex ) , control kit ( for coagulation analyzer ) ( make sysmex ) , p.m. kit elx 640 ( erba ) , caliberator kit ( erba ) ( cbc 5 part ) , elite h clean ( erba ) ( cbc 5 part ) , nutrient agar ( 100 ml bottle ) , mackoney agar ( 100 ml bottle ) , grams iodine 250 ml , suffranine 250 ml , ethyle alchohal 95% 250 ml , crystal voilet 250 ml , antibviotic sensitivity dises, amikacine , antibviotic sensitivity dises, cotrimoxazole , antibviotic sensitivity dises, ciprofloxacin , antibviotic sensitivity dises, gentamycin , antibviotic sensitivity dises, bentamycin , antibviotic sensitivity dises, lomefloxacin , antibviotic sensitivity dises, levofloxacin , antibviotic sensitivity dises, norfloxacin , antibviotic sensitivity dises, ofloxacin , antibviotic sensitivity dises, cephalixin , antibviotic sensitivity dises, tobramycine , antibviotic sensitivity dises, moxifloxacin , antibviotic sensitivity dises, ceftodoxime , antibviotic sensitivity dises, nitrofurantion , antibviotic sensitivity dises, clindamycin , antibviotic sensitivity dises, sefeazidime / clavulanic acid , antibviotic sensitivity dises, cefuroxine , antibviotic sensitivity dises, imipenem , turniquat , syrup phenobarbitone , cutting and round body needle medium size each , ctg paper ( per pkt. ) , carbolic lotion 2% , esr tube disposable , cover slip small ( 100x1 pkt ) , rh view box , vial rack , bovine albumin 20% 100 ml , anti h , immerssion oil ( bottle ) , hemosafe sls 1 ltr , test tube 12x75 mm , test tube rack , triglyeerides kit 2x150 ml , esr tube disposable with cap , tri sodium citrate 3.8% ( 500ml ) , a.b.d. ( 3x10ml ) , micro tips yellow ( 1000 pcs ) , micro tips blue ( 1000 pcs ) , widal antigen slide methed ( 4x5ml ) , urea kit 300 ml , tips ( 100 1000ul ) , petridish , tsh ( 1x96 test ) , t4 ( 1x96 test ) , t3 ( 1x96 test ) , liquiplastin ( 5 ml ) , liquicelin e ( 5 ml ) , calcium chloride ( 5 ml ) , hcv kit ( 50 test ) , amylase ( 50 test ) , lipase ( 50 test ) , recombinant factor viii ( 3rd generation dna origin ) 500 iu , recombinant factor viii ( 3rd generation dna origin ) 1000 iu , lh ( 1x96 test ) , fsh ( reagent ) , uric acid ( 5x20 ml ) , call counting machine , esr stand 6 tube capacity , bleading time test , helix pcd test ( conform to iso 13485 1class 2, 121c / 20 min, 134c / 3.5 min, shelf life 3 years after production, clear transition of pink into brown for steam, easy to interpret, easy to document, non toxic / lead free ) , chemical indicator ( shelf life 3 years after production, packed in an easy dispensing carton, clear colour transition of the emulator, non toxic / lead free ) , documentation labels ( process indicators ( steam ) , for steam 121 c 20 min & 134 c for 3.5 min, conform to iso 11140 1 class 1, clear transition of indicatorinto its end color, easy to use labe gun, double labels serve for an easy traceability and document , blood gas analyser card ( edan ) , blood gas analyser paper roll ( for printer ) , iv albumin 100 ml , hcb card test ( 50 test ) kit , rpr card test kit , whole blood finger prick test for hiv ( card test ) kit , sputum container ( per pcs ) , drop bottle ( per 200 ml ) , filter paper ( per 100 pcs pkts ) , cyrstol phenol ( per 500 gram pack ) , ethanol ( per 500 ml pack ) , liquid praffine ( per 500 ml pack ) , basic fuchin powder ( per 25 gram pack ) , urine strip 2 para meter ( 100 test ) , urine strip 4 para meter ( 100 test ) , urine strip 10 para meter ( 100 test ) , tarpin oil ( 400 ml ) , bt filter ( bacteria filter ) , ferittin estimatiry elisa reagent , dropper 3ml plastic , savlon ( 500 ml ) , optimal test kit for malaria test of pv , anti d 10 ml , anti a 1 lactin , anti a 10 ml , anti b 10 ml , anti ab sera 10 ml , edta ( k3 ) non vaccutenor ( 100 pc pkt. ) , plain vial non vaccutenor ( 100 pc pkt ) , cloride vial non vaccutenor ( 100 pc pkt. ) , rh view box , vdrl ( rpr test 100 ) , blood grouping kit , bovine serum albumin , test tube 3 / 4 inch ( 100 pcs ) , calcium 2x150 ml , w.b.c. diluting fluid 500 ml , test tube rack , widal koit span 4x5 ml , v.d.r.l ( shippils test strip one step ) , r.a. ( 1x50 test ) , s.g.pt kit ( 50 ml ) , uric acid kit ( 5x20 ml ) , triglyecride desgpopap ( 25 ml ) , alkaline phospohate ( 5x15 ml ) , leishman stain solution 500 ml , leishman stain solution 250 ml , sodium citrate 3.8% ( 500 ml ) , r.a. antigen ( 100 test ) , glucose antigen ( 2x200 ml ) , uric acid kit ( 20x2 ml ) , distilled water ( 5 ltr. ) , urea bun urease gldh ( 20x5 ) , urea dam mannual kit ( 125 ml ) , cholestral antiigen / kit ( 75 ml ) , hdl kit 50 ml , sgot 150 ml x 2 , total protien 25 test , albumin 25 test , microprotein kit 25 test , crp test kit 25 test , aso titre kit 25 test , urine pot , tips ( 100 1000ul ) , tissue paper ( each roll ) , cretinnine kit ( 50 test ) , billirubin kit ( 50 test ) , e.d.t.a vail 2 ml. ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction , halothen i.p 0.01%ww , thiopentone sodium 500 , coppersulphate crystal for chemical cautery of umbilical stump 500 mg , triple dye lotion , fulcon tube ( 50ml pot ) , mathylene blue ( 25 gram bottle ) , sulphuric acid conc. ( 500 ml bottle ) , phenol crystal ( 500 gram bottle ) , lense cleaning paper ( 100 pcs packet ) , ethanol ( ethyle alcohal ) 100% ( 500 ml bottle ) , sodium hypo chloride ( 5 ltr jar ) , slide staning trey aluminium , slide staining tray plastic , glass staning rode , drop bottle ( 500 ml ) , spirit lamp glass , water bath , slide stand , stain jsb 1 , stain jsb 2 , temephos 50% ec 1 liter , diflubenzuron 25% wp 1 kg , anixide h , spyrometer , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , carbon monoxide breathe monitor. , nicotine gum 2 mg , nicotine gum 4 mg , nicotine patch 21 mg, 15 mg, 7 mg , nicotine inhaller , nicotine nasal spray , bypropion 150 mg , varenicline 0.5 mg, 1 mg , sputum container ( 50 ml pot ) , glass slide , fulcon tube ( 50 ml pot ) , mathylene blue ( 25 gram bottle ) , sulphric acid conc. ( 500 ml bottle ) , phenyle liquid ( 40% ) ( 5 ltrs jar ) , phenol crystal ( 500 gram bottle ) , d.m. water ( 5 ltrs. jar ) , lense cleaning paper ( 100 pcs packet ) , filter paper ( 100 pcs per packet ) , tissue paper roll , auramin o ( 25 gram pack ) , ethanol ( ethyle alcohal ) 100% , hydro chloric acid conc. ( 500 ml bottle ) , potassium per manganate ( 500 gram bottle ) , basic fuchin ( 25 gram pack ) , liquid parafin ( 500 ml bottle ) , sodium hypo chlorite ( 5 ltr jar ) , slide staning trey plastic , staning stand , drop bottle ( 125ml. ) plastic , spirit lamp glass / ss 4oz. , forcap ( 6 ) ss disecting , water bath 2 rack capacity electrically operated , slide box ( 50 pc slide boxes ) plastic , slide boxes ( 100 pc slide boxes ) , scissor ( 8 ) ss , parmanent marker pen , funnel keep big ( glass ) sz 4 , funnel keep big ( glass ) sz 6 , slide stand aluminium , diluent for cbc machine 20 ltr , lyse for cbc machine 500ml. , cleaner for cbc machine, 5 ltr , cbc reporting paper ( per roll ) , mouth gag ss , test tube rack plastic 12.5mmx24hole , test tube rack plastic 12.5mm x48 hole , test tube rack plastic 15mmx24 hole , test tube rack plastic 15mmx48hole , test tube rack plastic 18mmx48hole , test tube rack plastic 18mmx24 hole , call counting machine ( manually ) 5 key , bleading time test capilary tube , plain rubber urinary catheter each , stainless steel small galley pot 20 25ml. capacity , ecg paper ( schller ) ( per pkt. ) , hydro chloric acid conc. ( per 500 ml ) , crescent knife ( 2.6 ) , keratome ( 2.8 ) , side port ( 15 ) , trypan blue , iol lense pamma lense , viscoelastic hypersole , enteroglemina , ferittin estimatiry elisa reagent , umbilical cathether ( 100 pc ) , halothen i.p 0.01%ww, 250ml. , coppersulphate crystal for chemical cautery of umbilical stump 500 mg, 500gm , drop gsb ear ( 10ml. ) , stainless steel small galley pot each , ahg ( antihuman globulin ) , 5ml. , rh view box , measuring cylinder ( glass ) 100 ml , measuring cylinder ( glass ) 1000 ml , measuring cylinder ( glass ) 2000 ml , beaker glass ( 250 ml ) , bovine serum albumin 5ml. , blood bag single adult / paeditric , anti h lectin 5ml. , testube brush big size , mersilk 2.0, 1.0 cutting needle , lab wash ( 500ml ) , distilled water ( 5 ltr. ) , urea dam mannual kit ( 125 ml ) , microprotein kit 1x50ml. , tips ( 100 1000ul ) big size , glucose ( 1x9x50ml ) , serum bilirubin kit ( 35 test ) , micropipette fixed volume , micropipette variable volume , large microtips ( 1000 pc ) , small microtips ( 1000 pc ) , tissue paper ( each roll ) , call counting machine ( manually ) 5 key , bleading time test capillary tube , filtter paper 9 cm ( 100 pc ) , cappillary tube ( 100 pc ) , h.c.l n / 10 ( 500 ml ) , creatinine antigen / kit ( 2x500ml ) , glucose kit good / pod ( 4x250 ) test , capillary tube ( 100 pc ) , creatinine jaffees reaction 4x60ml. , plain vials ( 100 pc ) , floride vials ( 100 pc ) , floride vials non vaccum ( 100 pc ) , edta kj tube ( 100 pc pkt ) , plain vials 2 ml non vaccum ( 100 pc ) , elisa ( hiv ) 4th genrationkit 1x96test , elisa ( hbsag ) kit ( 1x96 test ) , elisa ( hcv ) kit ( 1x96 test ) , elisa ( malaria ) kit ( 1x96 test ) , rpr latex kit ( 250 test ) , rapid ( hiv ) kit , rapid ( hbsag ) kit , rapid ( hcv ) kit , rapid ( vdrl ) kit, syphillis card test , rapid ( malaria ) kit , anti ab reagent 10 ml , anti ahg reagent 5ml , cupling jar plastic 5 slide cpacity , shalis method hb meter , gel card , ahg ( for cross match ) , gel card grouping ( forward & reverse ) , gelcard machine 8 card with warmer , gelcard machine 24 card with warmer , liss solution , labozent 500ml. , plastic tub , pasteur pipette , apron ( lab coat ) , tube sealer ( portable ) , glucon d 100gm , emergency medicine box , centifuse machine 16 channel r8c model , chemical balance machine , hot air oven , pap smear ( cyto brush +spetula ) , glass slide pkt of 50 , eosin stain yelllow 100 ml , heamotoxilline harris 500ml , isoprofile ( propen 2 ol 500ml , autoclave lable , tournicate valcro , antibiotic disc , culture plate disposable90 mm , culture plate glass 100 mm , maconkey agarv powder 500gm , maconkey agarv powder 100 ml , grams iodine100ml , grams iodine powder , cristel violate100ml , cristel violate powder 25gm , sodium citrate vial ( pt vial ) non vaccum , sodium citrate vaccum , alliequet vial , trop i , trop t , amkitdw plant , pm kitdw plant , phosphorus 10x12 ml , gamma gt 2x44 / 2x11ml , magnesium 2x44ml , uibc 125ml , ldh 2x44 / 2x11ml , serrum iron 125 ml , lipase 1x44 / 1x11ml , amylase5x22ml , ferritin , ferritin calibrator , ferritin control l , ferritin control h , erythromoietin , urine pot 30 ml , petridish 90 mmg ( titan biotech ) , blood agar ( titan biotech ) , maconekey agar ( titan biotech ) , muller hilton agar ( titan biotech ) , urea broth base ( titan biotech ) , distillwater , conical flask 100 ml , conical flask 500 ml , cotton roll , nichrome loop 2 mm with holder , amikacin antibiotic disc ( titan biotech ) , ampicillin antibiotic disc ( titan biotech ) , ampicillin + sulbactam antibiotic disc ( titan biotech ) , cefoxitin antibiotic disc ( titan biotech ) , ceftazidime antibiotic disc ( titan biotech ) , ciprofloxacin antibiotic disc ( titan biotech ) , colistin antibiotic disc ( titan biotech ) , co trimoxazole antibiotic disc ( titan biotech ) , doxycilline antibiotic disc ( titan biotech ) , erythrmycin antibiotic disc ( titan biotech ) , gentamicin antibiotic disc ( titan biotech ) , imipenem antibiotic disc ( titan biotech ) , levofloxacin antibiotic disc ( titan biotech ) , linezolid antibiotic disc ( titan biotech ) , meropenem antibiotic disc ( titan biotech ) , nitrofuran tion antibiotic disc ( titan biotech ) , norfloxazacin antibiotic disc ( titan biotech ) , piperacillin antibiotic disc ( titan biotech ) , polymyxin b antibiotic disc ( titan biotech ) , teicoplanin antibiotic disc ( titan biotech ) , tetracycline antibiotic disc ( titan biotech ) , vancomycin antibiotic disc ( titan biotech ) , cefazolin antibiotic disc ( titan biotech ) , tobramycin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , aztreonan antibiotic disc ( titan biotech ) , cefepime antibiotic disc ( titan biotech ) , cefoperazone antibiotic disc ( titan biotech ) , sparfloxacin antibiotic disc ( titan biotech ) , azithromycin antibiotic disc ( titan biotech ) , ofloxacin antibiotic disc ( titan biotech ) , clindamycin antibiotic disc ( titan biotech ) , triple blood bag , double blood bag , quadruple bag , penta bag , apheresis kit , acd solution for apheresis , total protein kit of colorimeter , iodine solution , height measurement scale , observation table , graph paper and pencil, ( remi, model no br 300 ) , graph paper and pencil, ( penpol, model no br 360 ) , graph paper and pencil df ( 300l ) terumo pcnpof , graph paper and pencil pdv 360 ultra re , double pan balance weight ( non digital ) , urinometer , hydrometer , copper sulphate , prothrombin time reagent , fibrinogen reagent , aptt kit , york scientific ( modal ysi 572 ) , digital weight machine ( 150 200 kg ) , measuring cylinder ( 1000 5000ml ) , gal card machine for blood grouping and cross machine , warmer for gel card machine , weighing scale , wall bp instrument , blood collection monitor , portable donor couch of stainless steel with z mattress , rh view box , protable tube sealer battery operated , stripper for blood withdrawal , carry box for blood ( 50 bags ) , carry box for blood ( 100 bags ) , portable o2 cylinder , reagent refrigerator model number ( br360 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , reagent refrigerator model number ( br300 ) specification: ( 1.safe storage for biological storage of temperature sensitiv reagents , kits, &samples, serocool meets reuirement of pharmacies&laboratories.2.salient features microprocessor based temperature control, wide4led display& alarm system, inner suface of medical grade compression molded plastic, outer body of high grade polished galvanized steel, automatic defrost mechanism, energy efficient due to insulation of high core density, uniform cooling by forced air cirulation adjustable coated wire mesh shelves, clear product visibility with dual gass door. ) , blood culture bottles ( a ) gloucose brothe w / 0.5% sps ( blood culture bottle ) ( b ) glucose broth w / 0.5% sps ( blood culture bottle ) ( titan biotech , anaerobic jar ( titan biotech ) , l.j. medium slant ( 10 slants ) ( titan biotech ) , antibiotic discs , nichrome loop 2mm with holder , petridish 90 mm ( titan biotech ) , grams stain kit ( titan biotech ) , nutrient agar ( titan biotech ) , maconkey agar ( titan biotech ) , zn staining kit, zn acid fast stain kit ( titan biotech ) , sprit 500 ml , betadine solution 500 ml , hand wash 250 ml , mask surgical , hand cap , viscolon 5 ml , lox 2% inj. , anawin inj. , dispoven 3 ml , dispoven 5 ml , dispoven 10 ml , dispoven 3 ml , eye dress eco , eye drape poly , honide ( eye drop ) , moxiflox ( eye drop ) , inj. hyni dase , surgical blades , eye instrument set , surgical instrument trolly , blood gluco test stripes , iol lense 22 no , iol lense 21.50 no , iol lense 23 no , gentamicin inj , dexona inj. , cap. amoxycillin 500 mg , tab. ranitidine 150 mg , tab. dicyclogin ( h ) , tab. calcium d3 , tab. misoprost 200 mg , syp. multivitamin 100 ml , inj. dilona , inj. oxytoxin , betadine ointment , cord clamp ( apex ) , surgical gloves 6.5 , d syringe 5 ml , d syringe 2 ml , inj. ceftrizone + salbactum 1.5 gm , inj. randidine 2 ml , inj. diclofenac sodium 3 ml , inj. ondem 2 ml , tab. amoxicilin + clavunate 625 mg , tab. aceclofenac + pcm+ serratiopeptidase , cap. omeprazole 20 mg , micropore 3 , betadine oint 15 gm , bandage 4 , syringe 10 ml , vicril 1 no. 180 cm with needle , catgut 2 no. , catgut 1 no. , gloves 6.5 no. , gloves 7 no. , folys cathethar 16 no. , urine bag , bp blade 22 no. , inj. ranitidine 3 ml , inj. diclofenac 3 ml , inj. bupicane , inj. perinorm , syringe 5 ml , syringe 3 ml , inj. pantazocin 1 ml , inj. oxytocin 1 ml , intra cath 18 no. , cord clamp ( apex ) , inj. ceftrazone 1 gm , inj. methargin 1 ml , inj. anamine 4 ml , spinal needle 25 no. , edta tube ( double cap ) , sodium fluoride tube ( double cap ) , erba auto wash kit , erba norm kit em 200 , erba multical ( erba path kit code 120221 ) , urine sprip ( 7 parameter ) , erba h 360 lyse , h 360 diluent , microtipes samllest 10 to 100 , anti abo ( arkray ) , widal , erba tsh , blood glucose ( semi autoera ) , blood urea ( semi auto erba ) , uric acid ( semi auto erba ) , alkline ( semi auto erba ) , bilirurin ( semi auto erba ) , crp ( semi auto erba ) , glocose hexokinase ( erba em 200 ) , alkaline ( erba em 200 ) , albumin ( erba em 200 ) , protien ( erba em 200 ) , creatine ( erba em 200 ) , urea ( erba em 200 ) , uric acid ( erba em 200 ) , triglyceride ( erba em 200 ) , hdl ( erba em 200 ) , calcium ( erba em 200 ) , medsource hbsag kit , pop cast 2 inch , pop cast 4 inch , pop cast 6 inch , pop cast 8 inch , soft roll for ortho cases 2 inch , soft roll for ortho cases 4 inch , soft roll for ortho cases 6 inch , soft roll for ortho cases 8 inch , inj. piptaj 4.5 g , inj. rantac , trulon 1 no , trulon 2 0 , mersilk 1 no , dynaplast...

Health Department - Jharkhand

37551293 rate contract for supply of upchar samgri (healing material)(group b) at latehar rate contract for supply of upchar samgri (group b)at latehar , items : , color coded buckets(black,red,yellow,blue) 80 ltr , color coded polybags(black,red,yellow,blue) 80 ltr , color coded buckets(black,red,yellow,blue) 20 ltr , color coded polybags(black,red,yellow,blue) 20 ltr , towels (big size) , towels (baby size) , cotton wool (400 gm) , gauze (than) 16cmx90cm , bandage(than) 16cmx90cm , bandage(roll) 03 inch , bandage(roll) 04 inch , rubber sheet roll , bed sheets (bombay dyeing minimum 200 tc cotton) , pillow (with cover) , blanket (2 kg) , baby blankets , mosquito net (for hospital bed) , ceilling fan (havells) , office table (godrej) , table (computer) (godrej) , revolving stool (godrej) , revolving chair for computer (godrej) , chair office (godrej) , chair plastic (neelkamal) , steel almirah (04 celf) 22 g(godrej) , steel racks (05 celf)(godrej) , gown,operation,cotton , cap. operation, surgeons 36x46 cm , macintosh, operation, plastic , phynile (05 ltr) , plaster of paris (5 kg) , foot step (two step) , sline stand , three seater waiting chair (iron) , three seater waiting chair (steel) , x ray view box , b.p instruments with stand (dimond/mukhargee/doctor) , b.p instruments digital , mucous sucker , lifter forcepe (cheter forcep) , battery (12 volt 200 amp) exide , invertor ( 1400 va) sukam/microtek , air cooler (symphoni/bajaj/sony) medium size , washing machine (comercial) 10 kg lg , washing machine (comercial) 10 kg whirlpool , tube light , curtains with rods , buckets (ss with lid) , waste disposal twin bucket for hypochlorite solution/bleach , dustbin with lid , sauce pan with lid , drum with tap for storing water , digital wall clock , room heater , filing cabinets , computer set with printer& ups (based on latese technology) , xerox machine (black&white) , bed with matteres , matteres for bed , delivery table , rack (04 cell minimum) , lock (link) large size , lock (link) medium size , food trolley (kitche applainces) , garbage hand carts (garbage trolley) , trolley for patient transport. , trolley for transporting medicine and medical supplies , outdoor garbage bins with stand (90 ltr) , indoor garbage bins (90 ltr) , outdoor wheelchair , handicapped walking equipment , deadbody cover (bag) , water heater kettle , led bulb12 watt (havells) , weight machine digital , refrigerators 285 ltr (lg) , refrigerators 285 ltr (whirlpool) , refrigerators 285 ltr (samsung) , astroturf doormat , shoe rach plastic (neelkamal) , bed sheet for children (cartoon print) , stethoscope , ro kent 15 ltr , electric mopping machine...

District Rural Development Agency - Jharkhand

37458939 tender for printing of job card, supply of medical kits (bandage, cotton, povidine qidine cream, savlon, cetrizine strip, diciofenace tab, paracetamol tab, dompendom tabl, ors satches, bandaid strip, soap, ciproloxacin tabl surgical knife)....

Health Department - Jharkhand

37458029 rate contract for supply of medicine , 0.5% bupivacain (heavy) , 1% gama benzene hexachloride lotion , 3% nacl 100 ml , 3% phenyl (5 litre) , 3.8% sodium citrate solution 500 ml , 5% lysole , abo & rh(anti ab&d) arkary10 ml each pkt. , abo & rh(anti ab&d) tulip10 ml each pkt. , absorbent bandage than 18 m x 90 cm special , absorbent cotton i.p 400gm/roll ( net weight) , absorbent gauze than 18 m x 90 cm special , acyclovir ointment , adenosine , airway 01234 , ambu bag adult , ambu bag pediatric , analgesic cream(30 mg tube) , anteseptic soap 75 gm , anti a1(lactin) serum 5 ml per pc. , anti ab sera arkray 10 ml per pc. , antifungal skin cream 20 gm , antihuman globulin serum 10 ml per pc. , antiseptic liquid 500ml , apron white cloth medium size per pc. , aso latex (span) (100 pcs) , asthalin respules , auto clave electric vertical (pressure &temprature display ) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , b.p. machine (mercury) diamonde per pc. , baby cap , baby dress , baby socks , baby tag , baby towel , barium chlorine 500 ml , bendicts solution 500 ml , betadine ointment , betamethasone dipropionate cream , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blleching powder 25kg bag , blood bag350 ml hl per pc. , blood bag 100 ml hl per pc. , blood bag tube sealer per pc. , blood collection monitor per pc. , botroclot 10ml per pc , bovine albumin 22% (10 ml) per pc. , bt set , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 22 no , cannula 24 no , cannula 26 no , cap. amoxycilline (250 mg) + cloxacilline (250mg) , cap. amoxycilline (250mg) , cap. amoxycilline (500mg) , cap. ampicilline 500mg , cap. cefalamine (250 mg) , cap. cephalamine (500 mg) , cap. cephalexin 250 mg , cap. cephalexine (250 mg) , cap. cephalexine (500mg) , cap. cholicalciferol 2000iu , cap. cholicalciferol 30000iu , cap. cloxacillin 250 mg , cap. cloxacillin 500mg , cap. depin (10 mg) , cap. depin (5 mg) , cap. doxycycline (100 mg) , cap. griseofulvin 250mg , cap. omeprazole (10mg) , cap. omeprazole (20mg) , cap. vitamin a 200000 iu , capillary tube , carbolic acid (500 gm) , chloramphenicol eye ointment , chlorhexidine , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , ciprofloxacine eye / ear drop 10ml , cleansole , clindamycin gel 30 gm , clobetasol fusidic acid cream , clotrimazole ear drops , clotrimazole ointment 30 gm , colorimeter per pc. , copper sulphate crystal 500 gm per pc. , cord clamp , cotton roll 400gm nett , cotton thread , cover slip (100 pcs) , cpr (latex) (20 pcs) , crape bandage 4 , creatinine(creast) (35 pcs) , crepe bandage 6 , crescent blade disposable , crp chemical , cuvet (for colorimeter) per pc. , dextrose 25% (100 ml) , diclofenac gel (30 gm) , dicyclomine hydrochloride + activated semithicone drop 10 ml , digital thermometer , diltiazem , disposable delivery kit for delivery of hiv patient , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1lt , distilled water 5lt per pc. , donepezil , double caps edta tube per pc. , drabkins reagent 500 ml per pc. , duolin respules , ec (700 ml) (agrawal) , ecg jelly , ecg roll , edta powder 25gm per pc. , edta vial per pc. , elisa reader per pc. , elisa washer per pc. , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , eye drop chloramphenicol 5ml 0.50% (5 ml) , eye drop occumox – p (moxifloxacin + prednesolone) (5 ml) , eye drop ofloxacin + dexamethasone , eye drop, flurbiprofen plus (5 ml) , eye drop, ofloxacin / moxifloxacin (5 ml) , eye drop, tropicacyl plus (5 ml) , falcun tube , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , fradiomycin cream 15 gm , fusidic acid cream , g.v. paint lotion 400ml , galamantine , gentamicin dexamethasone ear drops , glacial acetic acid (500 ml) , glass rod per pc. , glass slide (50 pcs) per packet , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer (ozocheck) , glucometer strip , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hand sanitizer 100 ml , hand sanitizer 5 lt , hand sanitizer 500 ml , hand wash liquid form 80ml , handiplast per pc. , handiplast roundper pc. , hbsagelisa 96 per pkt , hbsagrapid card aspen per pc. , hbsag card rapid hepaview per pc. , hcvelisa 96 per pkt , hcv rapid card aspen per pc , hcv rapid card flaviscreenper pc. , heavy duty gloves , hemasyl 500 ml , hiv elisa 96 per pkt. , hiv rapid card aspen per pc. , hiv rapid card qualpro per pc. , inj anti d , inj pcm 2ml , inj pentazocine 30mg , inj pipracilin tazobactum 1.125 gm , inj pipracilin tazobactum 4.5 gm , inj remdesivir 100mg/20ml , inj sevoflurane , inj vancomycin 250 mg , inj. a.r.v. (anti rabies) multi dose , inj. a.r.v. (anti rabies) single dose , inj. adrenaline ampl , inj. amikacin (250mg) vial , inj. amikacin (500mg) vial , inj. amikacine (100mg) , inj. amino phylline ampl , inj. ampicilin 250mg vial , inj. ampicilin 75 mg vial , inj. ampicillin500mg vial , inj. anafortan 2ml , inj. anamin , inj. anaspas , inj. anawin heavy , inj. anawin plain , inj. anti snake venus serum , inj. antitetanus human immunoglobulin , inj. arteether 2ml 50mg , inj. artesunate 1ml 60 mg , inj. atropin (ampoule)ampl , inj. avil ampl , inj. b complex amp , inj. botropase , inj. butodol , inj. caffeine , inj. calcium gluconate amp , inj. cefoperazone (1 gm.) with watervial , inj. cefotaxime with water(1 gram) , inj. cefotaxime with water(125 mg) , inj. cefotaxime with water(500 mg) , inj. ceftriaxone + salbatum with water (1.5 gram) , inj. ceftriaxone 250mg with water vial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone inj 1gram with watervial , inj. chlorpheniramine , inj. chromostat amp , inj. citicholine , inj. compose 2ml , inj. deriphylin , inj. dexamethasonevial , inj. dexamethasone sodium phosphate 2ml/4mg , inj. diazepam (5 mg)2ml , inj. diclofenac aqua (1 ml) , inj. diclofenacc sodium 2ml ampl , inj. dicyclomine ampl , inj. dicyclomine hydrochloride 10 mg 2ml , inj. dilantin sodium100 mg , inj. dizepam , inj. dobutamine , inj. dopamine ampl , inj. drotaverine , inj. e mal , inj. efcorlin 50mg , inj. endpoprost inj , inj. enoxaparin , inj. epitrate , inj. etophylline + theophylline 220mg (169.4+50.6 mg) , inj. fluconazole 100ml , inj. fortwin ampl , inj. furosemide 2ml , inj. fusemide vial , inj. gardinal , inj. gentamicin 10 mg , inj. gentamicin 40 mg , inj. gentamycine 20 mg. vial , inj. gentamycine 80 mg. vial , inj. glycopyrrolate , inj. haloperidol 5mg , inj. hydro cortisone , inj. hydrocort 100mg , inj. hynidase , inj. hyprosol 5ml , inj. i.v. ciprofloxacine , inj. immunoglobin ampl , inj. insulin primixed (30/70) , inj. iron sucrose , inj. kcl , inj. ketamin (2ml) ampl , inj. ketamin inj. (10ml vail) , inj. ketorolac (1 ml) , inj. k nate (phytomenadione) 1ml , inj. labatalol , inj. lasix ampl , inj. levipil , inj. levitiracetam , inj. lignocaine adrenaline , inj. lorazepam 2mg , inj. magnesium sulphate ampl , inj. megazid xp , inj. mephentermine , inj. meropenam 1gm , inj. meropenam 250 mg , inj. meropenem 125 mg , inj. methergin , inj. methyl ergometrine ampl , inj. metochlopramide ampl , inj. metoclopramide 10mg , inj. midazolam , inj. moxifloxacin , inj. multivitamin ampl , inj. nacphin 10 mg , inj. naloxone , inj. neostigmine ampl , inj. netromycin 10 mg , inj. netromycin 25 mg , inj. norad 2mg , inj. ondansetron ( 4 mg) , inj. ondansetron ( 8 mg) , inj. ondem 2mg , inj. ondem 4mg , inj. ondensetron ampl , inj. oxytocin ampl , inj. pam , inj. pantoprazole with watervial(40 mg ) , inj. perinorm ampl , inj. phenargan ampl , inj. phenobarbitone , inj. phenraminemaleate ampl , inj. phenytoinampl , inj. pilocarpine , inj. promethazine 25mg , inj. promethazine 50mg , inj. propofol , inj. prostadin , inj. ranitidine ampl , inj. sensrocain (30 ml) vial , inj. sodium bicarbonate ampl , inj. sodium chloride ampl , inj. termin , inj. tetvac ampl. , inj. tetvac vial , inj. theophyillin + ethophyillin ampl , inj. thiamine , inj. thiopentane 0.5gm/1gm , inj. tramadol ampl/vial , inj. tranexa , inj. vitamin k1 1 mg/0.5 ml (phytonadione) , inj. xylocaine 2% (plain) , inj. xylocard 2 % , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , intravenous paracetamol , iodine test kit , iron drop , isolyte p (500ml) , itraconazole cream , iv ciprofloxacine(100 ml) , iv mannitol (100ml) , iv mannitol (300ml) , iv metronidazole (100 ml) , keratome 2.8mm disposable , khan test tube rack , khantest tubeper pc. , lam/i gel 01234 , lancet (200 pcs) per pkt. , leclyete m(100 ml) , leclyete p(100ml) , leishmans stain (500 ml) , lence paper , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , levipil syrup , lidfast jelly , loperamide , lotion. benzyl benzoate (1000 ml) , lox 2%with adrenaline , luglos iodine solution (100 ml) , luliconazole cream , lysol 500ml , m.c. lotion400ml , m.p pf/pv card antigen abbott per pc. , m.p pf/pv card antigen per pc. , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , marker pen for pulse polio , memantine , mersilk (1 0) , mersilk (1 no) , mersilk (1 no) , mersilk (2 0) , mersilk(8 0) , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , miconazole ointment 10gm , miconazole ointment 30gm , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micro tips per 1000 pc. , micropore 1 inch , micropore 1/2 , micropore 2 , morphine , moxifloxacin eye drop , mucus sucker , multivitamin drop , n/10 hydrochloric acid , n/2 , n/4 , nasal normal saline drop (10 ml) , nasal prongs (neonats) (cannula) , neaomycineoint , neaomycinepowder , nebulizer set , needle curved , needle destroyer (electrical) , needle straight , neomycin (5 mg + 500 iu / g) 15gm , neospsrin powder 100gm , new born diaper , nitroglycerin , noscapine drop1.83 mg/ml , noscapine linct7mg/5ml , ofloxacin + dexamethasone ear drops , ors , ors adult 21 24 gm pack , ors( pedartic pack) , oxygen mask adult , oxygen mask child , oxygen regulator with flow meter , para hit arkray total per pc. , paraffin mesh , parafin liquid 1000 ml , pedia set , permethrin lotion 5% , phenyl 5 litre , phenylephrine , pilocarpine drop , pippet stand per pc. , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial per pc. , plasma volume expendore 500 ml , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , plastic sputum container with sticker , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , potasium per magnate , pottasium permagnate (400gm) , povidone iodine lotion 500ml , prednisolone drops 0.1% , prednisolone drops 1% , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pumping ball / smile ball , pyrethrum extract 2% , pyronate , r.p.r card aspen per pc. , r.p.r strip aspen per pc. , ra latex( span) (20 kits) , rapidor , rbc diluting fluid , refrigerator digital thermameter per pc. , rhyles tube16 no. , rivastigmine , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , salbutamol inhaler , saline d.n.s. (500ml) , saline dextrose 10%(500ml) , saline dextrose 5%(500ml) , saline ns(500ml) , saline rl (500ml) , saline set , sanitary napkin pad , shoe cover disposable , side port disposable , silver sulfadiazine 1% cream 100gm , silver sulfadiazine 1% cream 20gm , silver sulfadiazine 1% cream 500gm , silverex ointmet (burning) (20gm) , silverex ointmet (burning) (500gm) , slide dying rack , sodium calcium hypochloride (5 litre) , sodium hypochlorite solution per 5 lt. , soframycin cream , sofratulle mesh , specimen collection bottle , spinal needle 25 g , spirit (methylated) 1000ml , spirit 100 ml , spirit 1000 ml , sprit lamp , stritching thread , stylet , suction catheter , suction tube6fr , suction tube 8 fr , sulphar powder 100 gm , surgeon cap , susp amoxyclav 228 mg/5ml , susp levosalbutamol ambroxol , susp. albendazole 400mg 10ml , susp. amoxycilline 60ml , susp. antacid 170 ml , susp. antacid 200 ml , susp. azithromycin (200 mg ) 30 ml , susp. bromhexine hydrochloride 4mg/5ml , susp. calciumcarbonate +vitamin d3 calcium 250 mg+vit d3 125 iu/5 ml , susp. cefixime 50mg 30ml , susp. cephalexin 125ml/30ml , susp. cetrizine 30ml , susp. co trimoxazole (trimethoprim 40mg+ sulphamethoxazole 200mg) 100 ml , susp. co trimoxazole 50ml , susp. cough syrup adult 100 ml , susp. cough syrup child60 ml , susp. dexchlorpheniramine maleate 0.5 mg / 5ml , susp. digene , susp. domperidone (30ml) , susp. ibuprofen 100mg/5ml , susp. iron folic acid 200ml , susp. levitiracetam , susp. levocetrizine , susp. methadone , susp. metronidazole 30ml , susp. montelukast , susp. ofloxacin + metronidazole 30 ml , susp. paracetamol 125mg 60ml , susp. pheniramine maleate 15 mg/5ml , susp. phenobarbitone , susp. salbutamol sulphate 100ml , susp. vitamin a 100000 iu/ml , swab , syringe 50ml , syusp. clobazam , t bact ointment , tabmidazolam 500 mg , tab acetazolamide 250 mg , tab favipiravir 200mg , tab favipiravir 400mg , tab midazolam 250mg , tab multi vitamin , tab. aceclofenac (100 mg) , tab. aceclofenac + paracetamol , tab. acetyl salicylic acid 300mg , tab. aciloc, 150mg. , tab. albendazole (400 mg) , tab. alprazolam 0.25 mg , tab. aluminium hydroxide+ magnesium hydroxide 400mg , tab. amitriptyline 25 mg , tab. amlodipine (10mg) , tab. amlodipine (5mg) , tab. amoxy 250 mg dt , tab. amoxycilline + clavulanic acid(325 mg) , tab. amoxycilline + clavulanic acid(625 mg) , tab. anaspas , tab. antacid , tab. anti cold , tab. artesunate 100mg , tab. artesunate 200 mg , tab. artesunate 25 mg , tab. artesunate 50 mg , tab. ascorbic acid 500 mg , tab. atenolol (50mg) , tab. avil (chalpheniramin( 25 mg) , tab. azithromycine250 mg , tab. azithromycine 500mg , tab. bisacodyl5mg , tab. buprenorphine , tab. calcium carbonate 500mg , tab. calcium d3 500mg. , tab. carbamazepine 200mg , tab. carbamezapine 25 mg , tab. cefadroxyl 250mg , tab. cefadroxyl 500mg , tab. cefixime (100mg) , tab. cefixime (200 mg) , tab. cefixime (50 mg) , tab. cefuroxime axetil250mg , tab. cefuroxime axetil500 mg , tab. cephalexin 500 mg , tab. cepodoxime proxetil , tab. cetrizine 10mg. , tab. chloroquine 300mg , tab. chloroquine phosphate 150 mg , tab. chromostat , tab. cipro 500mg + tz 600mg , tab. ciprofloxacin hydrochloride 250mg , tab. ciprofloxacin hydrochloride 500mg , tab. ciprofloxacine (250mg) , tab. ciprofloxacine (500 mg) , tab. clobazam , tab. clomipramine 25mg , tab. clonazepam 0.5 mg , tab. compose , tab. co trimoxazole (trimethoprim 80mg + sulphamethoxazole 400mg) , tab. co trimoxazole ds , tab. co trimoxazole ss , tab. deriphylline 150 mg , tab. deriphylline 300 mg , tab. diamox 250 mg , tab. diazepam (2 mg) , tab. diazepam (5 mg) , tab. diclofenac sodium 100 mg , tab. diclofenac sodium 50 mg , tab. diclofenac sodium 75 mg , tab. dicolofenae sodium (50mg) , tab. dicolofenc + paracetamol , tab. dicyclomine , tab. dicyclomine + paracetamol , tab. dicyclomine hydrochloride 10 mg , tab. diethylcarbamazine citrate 100 mg , tab. dilantoin sodium ( 100 mg) , tab. domperidon (10mg) , tab. domperidone 10mg , tab. doxycycline (100 mg) , tab. drotaverine ( 40 mg) , tab. ecospirin (75 mg) , tab. erythromoycin250 mg , tab. escitalopram 10 mg , tab. escitalopram 5 mg , tab. etophylline + theophylline 100 mg (77+23 mg) , tab. etophylline + theophylline 150 mg sr , tab. etophylline + theophylline 300 mg sr , tab. famotidine(40 mg) , tab. famotidine 20 mg. , tab. fluconazole 150 mg. , tab. fluoxetine 20 mg , tab. folic acid 5mg , tab. folic acid large , tab. furosemide 40mg , tab. glibenclamide 5mg , tab. glimepride ( 2 mg) , tab. glyceryl trinitrate 0.5 mg , tab. griseofulvin 250mg , tab. haloperidol 5mg , tab. hydrochlorothiazide 12.5 mg , tab. hydrochlorothiazide 25 mg , tab. ibuprofen 200mg , tab. ibuprofen 400mg , tab. ibuprofen 400mg + paracetamole 325mg , tab. imipramine25mg , tab. ketrolac ( 50 mg) , tab. labetalol 100mg , tab. lanoxin0.25mg , tab. lasix 40 mg , tab. levitiracetam , tab. levocetrizine 5mg , tab. levofloxacin (500mg) , tab. levofloxacine 250mg , tab. lithium carbonate 300mg , tab. lorazepam 2mg , tab. losartan potassium 50mg. , tab. metformin(500 mg) sr , tab. methyl prednisolone 4mg , tab. methyl prednisolone 8mg , tab. metoclopramide 10mg , tab. metronidazole (200mg) , tab. metronidazole (400mg) , tab. mifepristone 200mg , tab. misoprostol 200?g , tab. naltrex1one , tab. nefedipine 20 mg , tab. nitrocontin (2.6 mg) , tab. norfloxacin 400 mg+ tinidazole 600 mg , tab. ofloxacin100mg. , tab. ofloxacin 200mg , tab. ofloxacin 200mg + ornidazole (500mg) , tab. ofloxacin 400mg , tab. olanzapine 10mg , tab. olanzapine 5 mg , tab. olanzapine 7.5 mg , tab. ondansetron ( 4 mg) , tab. ondansetron ( 8 mg) , tab. ornidazole 500mg , tab. p.c.m. d.t.( 250 mg) , tab. p.c.m. d.t.( 500 mg) , tab. p.c.m. d.t.( 600 mg) , tab. pantoprazole 40mg , tab. paracetamol (500mg) , tab. paracetamol (650mg) , tab. pheniramine maleate 25mg , tab. pheniramine maleate 50mg , tab. phenytoin sodium 100 mg , tab. primaquine 2.5mg , tab. primaquine 7.5mg , tab. ranitidine (150mg) , tab. risperidone 2mg , tab. risperidone 4mg , tab. roxythromycine 150mg , tab. roxythromycine 300mg , tab. salbutamol 4mg , tab. sodium valproate 200mg , tab. sodium valproate 500mg , tab. sorbitrate ( 5 mg) , tab. stemetil m.d , tab. telmisarten ( 20 mg) , tab. telmisarten ( 40 mg) , tab. terbinaffine 250mg , tab. thiamine , tab. tinidazole 500mg , tab. tramadol , tab. tranaxaemic acid + mefenamic acid , tab. tranexamic acid 250 mg , tab. tranexamic acid 500 mg , tab. trihexyphenidyl 2mg , tab. vitamin b complex , tab. voglibose ( 2mg) , tab. voglibose ( 3mg) , tab. wysolone 10mg , tab. wysolone 20 mg , tab. wysolone 5 mg , tab. zinc sulfate 20mg , tab. zinc sulphate ( 20 mg) , tab. zolpidem 10mg , tab.resperidone 1 mg , tab.resperidone 2 mg , tab.resperidone 4 mg , tarpin oil 1000 ml , temophos 25 ltr , test tube holding clamp , test tube rack , thermameter body per pc. , thiopentone , thrombophob ointment , tissue paper roll per pc. , tourniquet , trece ostomy tube set , tripane blue (blue day , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , urinometer with measuring cylinder per pc. , uro bag , vdrl (strip) per pc. , vicryl(1 0) with needle , vicryl1no 140 cm with needle , vicryl1no 45 cm with needle , vicryl1no 70 cm with needle , vicryl1no 90 cm with needle , vicryl1no with needle , vicryl (2 0) with needle , vitamin d drop , water for injection 5ml , wax ear drop , wbc diluting fluid , weight machine per pc. , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , xylocain jelly 5% , xylocaine jelly2% , xylometazoline nasal drop adult , yellow tips for micropipette , zipper pouch...

MGM Medical College - Jharkhand

37441743 supply of medicine and mise surgical items , name of medicine chemical misc surgical , inj. ketamine hydrochloride 50 mg / ml in 10 ml vial , isoflurane100 ml bottle , sevoflurane250 ml bottle , inj. thiopental sodium 0.5 gm , inj. vecuronium bromide 10mg , inj. bupivacaine hydrochloride 0.5% in vial 20ml vial , inj. bupivacaine hydrochloride0.5 in 4 ml ampoule to be mixed with 7.5% glucose solution 4ml ampoule , inj. lidocaine hydrochloride2% 30ml vial , inj. lidocaine hydrochloride 5% to be mixed with 7.5 glucose solution 2ml ampoule , lidocaine hydrochloride ( jelly ) ( topical ) 2% 30gm tube , inj.lidocaine hydrochloride ( viscous solution ) ( topical ) 4% 30ml vial , inj. lidocaine hydrochloride + epinephrine ( adrenaline ) 1% + epinphrine 1:200 000 30ml vial , lidocaine hydrochloride + epinephrine ( adrenaline ) 2% + epinphrine 1:80 000 in 2.2 ml cartridge ) ( dental cartridge ) 50ml vial , inj.lidocaine 2% + epinephrine ( adrenaline ) ( 0.005 mg / 1:2, 00, 000 ) 30ml vial , gel choline salicylate ( 8.7%w / w ) + lidocaine ( 2% w / w ) + benzalkonium chloride ( 0.01% w / w ) , topical spray lidocaine / lignocaine ( 15.0% ) , inj. glycopyrrolate usp0.2mg / ml 1ml ampoule , inj. myopyrrolate , inj. glycopyrrolate + neostigmine methylsulphate 5ml ampoule , inj. atropine sulphate 0.6 mg / ml 2ml ampoule , inj. diazepam5 mg / ml 2ml ampoule , inj. morphine ( sulphate or hydrochloride ) 10 mg 1ml ampoule , inj. fentanyl citrate0.05mg / ml 2ml ampoule , inj. midazolam 1mg / ml 5ml vial , tab. ibuprofen400 mg , suspension ibuprofen100mg / 5ml 60ml bottle , tab. paracetamol 500 mg , tab. diclofenac sodium 50mg , inj. diclofenac sodium25mg / ml pgsurfactant free 3ml ampoule , diclofenac sodium gel1% w / v 25 gm tube , tab. diclofenac potasium50mg , inj. ketorolac1ml 15mg / ml , syrup paracetamol 125mg 60ml , drop paracetamol 100mg / ml 15ml bottle , tab baclofen 5mg , tab. ibuprofen150mg+ paracetamol 500mg , tab. aceclofenac 100mg + paracetamol 500mg , inj. pentazocine 30mg / ml 1ml ampoule , tab. tramadol 50 mg , inj. tramadol 50mg / ml – 5ml , inj. butrophenol , tab. hydroxy chloroquine ( as phosphate or sulphate ) 150 mg ( base ) , tab. sulfasalazine 500 mg , tab. methotrexate 7.5 mg , inj. chlorpheniramine 10 mg / ml 1ml ampoule , tab. chlorpheniramine ( hydrogen maleate ) 4 mg , inj. dexamethasone phosphate disodium 4mg / ml 2ml ampoule , inj. epinephrine hydrocholride ( adrenaline ) 1mg / ml 1ml ampoule , powder for inj. hydrocortisone sodiumsuccinate vial 100 mg , tab. cinnarzine 25mg , syrup cetrizine 5mg / ml , tab. methylprednisolone 4mg , tab. levo cetrizine 5 mg , inj. phenaramin meleate 25mg / ml 2 ml amp , inj. calcium gluconate100 mg / ml 10ml ampoule , inj. pralidoxime25mg / ml 20ml vial , tab. prazocin2mg , tab. deferiprone500 mg , tab. carbamazepine 400mg , tab. diazepam5mg , inj. magnesium sulphate 500mg / ml 10ml ampoule , syrup phenobarbitone20mg / ml 60ml bottle , inj. phenobarbitone 200 mg / ml 1ml ampoule , tab. phenytoin sodium100 mg , inj.phenytoin sodium 50 mg / ml 5ml vial , tab. valproic acid ( sodium salt ) 200mg , tab. valproic acid ( sodium salt ) 500mg , valproic acid ( sodium salt ) ( liquid oral solution ) 200mg 100ml bottle , inj. valproic acid ( sodium salt ) 100 mg / ml 5ml , inj. leveteracetam100mg / ml 5ml vial , syp.leveteracetam100mg / 5ml 200ml bottle , tab. albendazole ( chewable ) 400mgsingle dose pack , suspension albendazole 200mg / 5ml 10ml bottle , tab. mebendazole100mg , suspension mebendazole100mg / 5ml 30ml bottle , tab. diethyl carbamazine citrate50mg , tab. diethyl carbamazine citrate100mg , syp.diethyl carbamazine citrate 10mg / 5ml 30ml bottle , tab. or cap. amoxicillin anhydrous 250mg , tab. or cap. amoxicillin anhydrous 500mg , amoxicillin anhydrous ( powder for oral suspension ) 125mg / 5ml 30ml bottle , ampicillin sodium ( powder for injection ) 1gm vial , inj. amoxicillin 250mg + potassium clavulanate 50mg vial , inj. amoxicillin 500mg + potassium clavulanate 100mg vial , inj. clindamycin 150mg / ml 2ml vial , benzathine benxzyl penicillin ( powder for injection ) 1.44g. benzylpenicillin ( =2.4 million iu ) 5ml vial , cap. cloxacillin sodium 500 mg , tab. or cap. cefalexin500mg , cephalexin ( powder for reconstitution with water ) 125mg / 5ml 30ml bottle , cephalexin ( powder for reconstitution withwater ) 250mg / 5ml 30ml bottle , ceftriaxone sodium ( powder for injection ) 250mg vial , ceftriaxone sodium ( powder for injection ) 1gm 30ml vial , inj. ceftazidime vial 250mg , inj. ceftazidime vial 1gm , imipenem monohydrate + cilastatin sodium ( powder for injection ) 250mg / 250mgvial , tab. amoxicillin + clavulanic acid 250mg + 125mg ( 375mg ) , tab. amoxicillin + clavulanic acid500mg + 125mg ( 625mg ) , syrup cefpodoxime 30ml 50mg / 5ml , tab. cefpodoxime 200mg , tab. ciprofloxacin hydrochloride 250mg , tab. ciprofloxacin hydrochloride 500mg , cap. doxycycline hydrochloride 100 mg , tab. azithromycin 250 mg , tab. azithromycin 500 mg , syrup azithromycin 100 mg / 5ml 15ml bottle , inj. gentamicine sulphate 80 mg 2ml vial , tab. ofloxacin 200mg , tab. ofloxacin 400mg , tab. metronidazole 200mg , tab. metronidazole 400mg , tab. sulphamethoxazole + trimethoprim 800 mg + 160mg ( co trimoxazole ds ) , oral suspensionsulphamethoxazole + trimethoprim 200 mg + 40mg , syrup cefadroxyl 125mg / 5ml 30ml bottle , inj. amikacin vial 250mg / 2ml , inj. amikacin vial 500mg / 2ml , tab. cefixime 200mg , syrup cefixime 100mg / 5ml 30ml bottle , inj. meropenem 500 mg 5ml vial , inj. hyaluronidase 1500iu , inj. placenta extracs 0.1 gm , inj. meropenem 1gmvial , inj. vancomycin 250mg vial , inj. cefotaxime 250mg vial , inj. cefotaxime 1gm vial , inj. netilmicin 50 mg 5 ml vial , inj. netilmicin 300 mg / vial , inj. piperacillin + tazobactum 4g+0.5gvial , inj. etofylline + theophylline2ml ampoule , inj. cefoperazone + sulbactum vial 500mg + 500mg , inj. paracetamol – 5ml , tab ursodeoxycholic acid 300mg , syrup cough 100 ml bottle , inj. methyleprednisolone 40mg / ml , inj. ceftriazone 1gm + tazobectum 125mg / vial , inj. ceftriazone 1gm + sulbectum vial , tab cefpodoxine 200mg + clavulanic acid 125mg , tab. clindamycin 300mg , tab. clindamycin 600mg , tab. rebamipide 100mg , oral suspension ibuprofen ( 100mg ) + paracetamol ( 162.5mg ) , syrup / oral suspension amoxycillin 200mg + clavulanic acid 28.5mg , syrup / oral suspension amoxycillin 400mg + clavulanic acid 57mg , tab misoprostol 100mcg , tab misoprostol 200mcg , inj. methylergonovine ( methergine ) , inj. oxytocine5 iu– 1 ml , inj. carboprost ( pgf2a ) as tromethamine 250mcg / ml – 1 ml amp , inj. carbetocin 100mg / ml – 1ml , inj. ethamsylate 125mg / ml 2ml ampoule , tab ethamsylate 500mg , tab. tranexamic acid500mg , inj. tranexamic acid 500mg / 5ml 5ml ampoule , haemocoagulase lotion 0.2 cu , inj. haemocoagulase , feracrylum gel 15gm , tab ursodeoxycholic , tab l ornithine l aspartate , inj. l ornithine l aspartate , inj. camofylin ( comylofin ) , inj. valethamate bromide , amphotericin b lipholised ( powder forinjection ) 50 mg vial , cap. fluconazole 150 mg , inj. fluconazole 2mg / mlvial , clotrimazole ( mouth paint ) 1% w / v , clotrimazole+steroid ointment1% w / w+0.025% w / w 10g tube , ketoconazole cream , tab. acyclovir 200 mg , acyclovir ( oral solution ) 200mg / 5ml 60ml bottle , acyclovir ( ophthalmic ointment ) 5gm tube 0.03 , acyclovir ( as sodium salt ) ( powder forinjection ) 250 mg 10ml vial , tab. acyclovir 800mg , acyclovir ointment , cap. oseltamivir 75mg , tab. tinidazole 500mg , tab. ornidazole 500mg , norfloxacin 400mg + tinidazole 600mg , ciprofloxacin 500mg + tindazole 600mg , ofloxacin 200mg + ornidazole 500mg , syrup nitazoxamide 100mg / 5ml 30 ml , syrup sodium alginae , tab. itopride 50 mg , tab. itopride 150mg , tab. chlordiazepoxide + clinidium + bromide , inj. artemether 80 mg / ml 1ml ampoule , inj. artesunate 60mg 2ml ampoule , tab. chloroquine ( as hydrochloride, phosphate or sulphate ) 150 mg base , syrup chloroquine ( as phosphate or sulphate ) 50mg / 5ml 60ml bottle , tab. primaquine diphosphate / phosphate 7.5mg , tab. primaquine diphosphate 2.5mg , tab. quinine ( bisulphate or sulphate ) 300mg , quinine ( bisulphate or sulphate ) ( oral solution ) 150mg / 5ml 60ml bottle , inj. quinine dihydrochloride 300mg / ml 2ml ampoule , inj. artether 2ml 150mg , syp. artemethar 200mg + lumefantrin 120 / 5ml 30ml bottle , syp. artemethar 40mg + lumefantrin 240 / 5ml 30ml bottle , drop. ferrous fumarate5mg / ml , ferrous sulphate ( oral solution ) equivalent to 25 mg iron , tab. ferrous sulphate + folic aciddried ferrous slphate ip eq. to ferrous iron 100 mg & folic acid ip 0.5 mg , tab. ferrous sulphate + folic acid equivalent to 20 mg iron + 0.1mg folic acid , syrup ferrous sulphate + folic acid equivalent to 20 mg iron + 0.1mg folic acid per 1ml in bottle , tab. folic acid 5mg , inj. folic acid ( sodium salt ) 1mg 1ml ampoule , inj. ferric carboxymaltose 500mg / 10ml , inj.iron sucrose 100mg / 5ml , inj. heparin sodium5000 iu / ml 1ml vial , inj. phytomenadione10 mg / ml 5ml ampoule , inj. protamine sulphate 10mg / ml 5ml ampoule , tab. warfarin sodium5mg , inj. vitamin k 1mg / ml 1ml ampoule , low molecular weight heparin 40mg , tab. isosorbide medicines 5mg , tab. isosorbide medicines 10mg , tab. verapamil hydrochloride 40mg , inj. glyceryl trinitrate 25mg 5ml ampoule , tab. glyceryl trinitrate 2.6 mg , tab. clopidogrel 75mg , tab. atenolol 50mg , tab. atenolol 25 mg , tab. digoxin 250mcg , digoxin ( oral solution ) 50mcg / ml 30ml , inj. verapamil hydrochloride2.5mg / ml 2ml ampoule , tab. amiodarone200mg , inj. amiodarone150mg 3ml vial , tab. diltiazem 30mg , inj. diltiazem vial 30mg , inj. adenosine 3mg / ml 2ml ampoule , tab. enalapril 2.5mg , tab. enalapril 5mg , tab. methyldopa250mg , cap. nifedipine 5mg , tab. nifedipine 10mg , tab.nifedipine 20mg , inj. mephentermine 30mg / ml 10 mlvial , inj. nor adrenaline 4mg / 2ml 2ml ampoule , tab. metoprolol 25mg , tab. metoprolol 50mg , tab. labetalol 100mg , inj. labetalol 10mg / ml 20ml vial , tab. telmisartan 20mg , tab. telmisartan 40mg , tab. s amlodipine 2.5mg , tab. s amlodipine 5mg , inj. sodium nitropruside 5ml vial , inj. dopamine hydrochloride 40mg 5ml vial , tab. hydrochlorothiazide 25mg , inj. dobutamine 50mg / ml 5ml ampoule , tab. furosemide 40mg , tab. ramipril 2.5mg , tab. ramipril 5mg , tab. atorvastatin 10mg , tab. atorvastatin 20mg , tab. fenofibrate 300mg , miconazole nitrate ointment or cream 2% 15 gm tube , framycetin sulphate cream 0.50% 15 gm tube , povidone iodine solution 5% 500 ml bottle , povidone iodine ointment 5% 500 gm jar , neomycin sulphate + bacitracine zinc ointment 5 mg + 500 iu / gm 1 gm tube , fusidic acid cream 2.00% 10 g , permentherine 5% ointment 10gm , permentherine 5% lotion 60ml , gambenzine hexachloride and certimide lotion 100mg bottle , sodium fusidate skin cream , furosemide ( oral solution ) 20mg / 5ml , inj. furosemide 10mg / ml 2ml ampoule , tab. spironolactone 100mg , tab. acetazolamide 250mg , tab. torsemide 5mg , tab. torsemide10mg , tab. aluminium hydroxide + magnesium hydroxide + active dimethicon / simethicon ( chewable tablet ) 500mg ( 250mg + 250mg +50mg ) , tab. ranitidine150mg , inj. ranitidine50mg / 2ml 2ml ampoule , cap. omeprazole 20mg , cap. omeprazole 40mg , tab.pantoprozole40mg , inj. pantoprozole40mgvial , tab aspirin gastro resistant 150mg , tab. sodium bicarbonate 500mg , tab. metoclopramide hydrochloride10mg , inj. metoclopramide hydrochloride 5mg / ml 2ml ampoule , tab. domperidone10mg , inj. promethazine hydrochloride 25mg / ml in2 ml ampoule , tab. prochlorperazine5mg , inj. ondansetron2mg / ml 4ml ampoule , syrup ondansetron2mg / 5ml 30ml , tab. ondansetron 4mg , liquid paraffinliquid 500 ml bottle , tab. dicyclomine hydrochloride10mg , inj. dicyclomine hydrochloride 10mg / ml 2ml ampoule , inj. drotavarine20 mg / ml 2ml , tab. drotavarine40mg , syp. drotavarine 10mg / 5ml 30ml bottle , syp. drotavarine 20mg / 5ml 30ml bottle , inj. degludec + aspart , inj. aspart analogue , placentrex ointment , nano silver colloid gel 50gm , amnioheal – af gel , tab. bisacodyl5mg , syrup lactulose 667mg / ml 60ml , bisacodyl ( suppository ) 10mg , glycerine sodium chloride ( enema ) 15% w / v 30ml 20ml plastic ampoule , glycerine sodium chloride ( enema ) 15% w / v 50ml 20ml plastic ampoule , oral rehydration salts 1 sachet ( 1 litre ) 20.5 g / l;components to reconstitute 1 litre of glucoseelectrolyte solution: glucose: 13.5g / sodiumchloride: 2.6g / l; potassium chloride:1.5g / l; trisodium citrate dehydrate*: 2.9g / l , zinc sulphate ( dispersible tablt ) 20mg , tab. rifaximin 550mg , tab. zinc 50mg , liquid prednisolone5mg / 5ml 120ml bottle , inj. insulin injection ( soluble ) 40 iu / ml 10ml vial , inj. inermidiate acting insulin ( as compound insulin zinc suspension orisophane insulin ) 40 iu / ml 10ml vial , tab. metformin hydrochloride500mg , tab. glimipride2mg , tab. glipizide 5mg , inj. premix insulin 40iu / ml30 :70vial , inj. rapid acting insulin2ml / cartvial , tab. gliptin , tab. levothyroxine sodium25mcg , tab. levothyroxine sodium50mcg , tab. levothyroxine sodium 100mcg , tab. propyl thiouracil50mg , tab. carbimzole5mg , inj. antitetanus immunoglobulin ( human ) 500 iu vial , inj. diphtheria antitoxin 10000 iuvial , inj. rabies immunoglobulin equine 300 u / ml 5ml vial , inj. anti – d immunoglobulin 150 mcg , inj. anti – d immunoglobulin300 mcg , inj. tetnus immunoglobulin 250 iu , inj. human normal immunoglobulin 16.5% 2mlvial , inj. hepatitis b vaccine 20mcg 1ml vial , inj. tetanus vaccine ( inj. tetanus toxoid ) 0.5 ml ampoule , inj. anti rabies vaccine 2.5 iu 1ml vial , inj. anti rabies vaccine 2.5 iu – 0.5 ml vial , inj. anti snake venum , inj. neostigmine metilsulfate 500 micrograms 1ml ampoule , inj. neostigmine metilsulfate2.5mg 5ml ampoule , gentamicin sulphate eye / ear drop ( solution ) 0.30% 5ml , ciprofloxacin hydrochloride eye / ear drop ( solution ) 0.3% w / v sterile aqueous 5ml , ciprofloxacin hydrochloride ointment ( eye / ear ) 0.30% 5gm tube , acyclovir ophthalmic ointment 3.00% 5gm tube , ofloxacin eye drops ( solution ) 0.30% 5ml , tobramycine eye drops ( solution ) 0.30% 5ml , moxifloxacin eye drops ( solution ) 0.5% v / w 5ml drops , moxifloxacine +dexamithasone eye drop , tab. prenisolone 10mg , carbachol vial , hyaluronidaze vial 1500iu , trypan blue solution vial 0.06% , tropicamide +substance hypromellose 2% , pilocarpine eye drop 2% , carboxymethylcellulose eye drop 0.5% , atropin eye ointment , atropin sulphate eye drop , tab. acetazolamide250mg , surfactant 200mg per vial – 8ml vial , inj. aminophylline 25mg / ml – 10ml amp , salbutamol sulphate ( respirator solution for use in nebulizers ) 5mg / ml 15ml , salbutamol sulphate ( mdi ) ( cfc free ) 100mcg / dose in 200 doses 200 mdi , tab. etiophylline + theophylline77mg+23mg ( 100mg ) , ipratropium bromide ( inhalation ) 200 mdi20mcg / metered dose , formetrol+fluticaxone ( inhalation ) 150 mdi5mcg+50mcg , tab. monteleukast4mg , tab. monteleukast10mg , dextrose ( injectable solution ) ( intravenous fluid ) 5% 500ml , 25% dextrose 25ml ampoule , dextrose ( injectable solution ) ( intravenous fluid ) 10% isotonic 500ml , dextrose with sodium chloride ( injectablesolution ) ( intravenous fluid ) 5% dextrose, 0.9% sodium chloride 500ml , manitol 20% 100 ml , inj. potassium chloride 20ml ampoule11.2% ( equivalent to k+1.5mmol / l, cl 1.5mmol / l ) , sodium chloride ( injectable solution ) ( intravenous fluid ) 0.9% isotonic ( equivalent to na+154 mmol / l, cl 154mmol / l ) 500ml , sodium bi carbonate ( injectable solution ) ( intravenous fluid ) 1.4% isotonic ( equivalentto na+167 mmol / l, hco3 167 mmol / l ) , sodium lactatecompound sloution ( ringer lactate solution ) ( intravenous fluid ) each 100ml contains: sodiumlactate 0.32gm, potassiumchloride 0.4gm, sodium chloride 0.6gm, calcium chloride 0.027gm. 500ml , electrolyte g ( multi electrolytewith 5% dextorse iv injection type iii usp ( injectable solution ) ( intravenous fluid ) each 100ml contains: anhydrous dextrose 5gm, sodiumchloride 0.37gm, potassium chloride 0.13gm, ammonium chloride 0.37gm: sodium sulphate 15mg. 100ml , electrolyte m ( multi electrolytewith 5% dextorse iv injection type iii ip ( injectable solution ) ( intravenous fluid ) each 100ml contains:anhydrous dextrose 5gm, sodiumacetate trihydrate 0.28gm, potassium chloride 0.15g, dibasic potassium phosphate 0.13g sodium chloride 0.091 g 100ml , electrolyte p ( multi electrolytewith 5% dextorse iv injection type iii ip ( injectable solution ) ( intravenous fluid ) each 100ml contains: anhydrous dextrose 5gm potassiumchloride 0.13gm, sodium acetate 0.32 gm, dibasic potassiumphosphate 0.026gm, magnesiumchloride 0.031gm 100ml , amino acid 5% 500ml , amino acid 10% 500ml , haemaccel 500ml bottle , i.v. hydroxy ethyl starch 6% , infusion paracetamol 100ml , human albumin 20% in 100ml , infusion / inj. metronidazole 500mg 100ml bottle , infusionciprofloxacin hydrochloride 100ml 2mg / ml , infusion levofloxacine 500mg / 100ml , tab. ascorbic acid ( vit. c ) 500mg , cap. vitamin e , tab. vitamin a palmitate50000iu , vitamin a palmitate ( as per nrhm supply ) oral oily solution multidose dispenser 100000 iu / ml , inj. thiamine hydrochloride ( vit b1 ) 50mg 10ml , tab. riboflavin ( vit b2 ) 5mg , tab. pyridoxine hydrochloride ( vit b6 ) 25mg , tab. / cap. multivitamin ( b1, b2, b6, niacinamide, pantothenate , folic, acid, ascorbic acid, biotin ) 10mg+10mg+3mg+100mg+50mg+1.5mg+150mg+ 100mcg , cap / tab vitamin e / tocopherol 10.0iu + copper 1.0mg + zinc sulfate 27.5mg + beta carotene 10.0mg + l selenium 75.0mcg + alpha lipoic acid 50.0mg + lycopene 5.0mg , tab. iron , tab b complex , inj. vitamin b complex with vitamin b12 2ml ampoule , vitamin d360000 iu , tab. calcium salts 500mg ( as elemental clacium ) , syrup multivitamin + multimineral 100ml , drop. vitamin d3400iu 30ml bottle , syrup zinc acetate 20mg 30ml bottle , tab. deferasirox 250mg , tab. deferasirox 500mg , xylometazoline nasal drop10ml 0.05% not in childrenless than 3 month , tab cinnarizine25mg , ofloxacin +clotrimazole+beclomethasone+lignocaine ear drops , paradichlorfevzene +chlorbutol +terpentine oil ear drop / wax softner , levofloxacin ear drop , polymyxin b sulphate +chloramphenicol+dexamethasone ear drop , sodium chloride 0.65%+benzalkonium sodium 0.01% nasal drop , l. alanyl l glutamine 50ml bottle20% , silver sulfa diazine 1% w / w with chlorhexidine gluconate solution 0.20%w / w, aloe 0.5% w / w, allontion 0.1% w / w, cream base 200 gm , formalin 5 ltrpack , white petrolium jelly ( medicinal use ) 1 kg jar , silk protein nano silver powder 100gm , recombinant human epidermal growth factor 150? gel , recombinant human epidermal growth factor silver sulfadizine and chlorhexidine gluconate 30gm tube , collagen sheet 15 x 30 cm , collagen sheet 10 x 10 cm , tab. flucoxetine 20 mg , tab. flucoxetine 40 mg , tab. escitalopram 5 mg , tab. escitalopram 10 mg , tab. risperidone 2mg , tab. risperidone 3mg , tab. risperidone 2mg + trihexylphenidine 2mg , tab. risperidone 3mg + trihexylphenidine 2mg , tab. olanzapine 5mg , tab. olanzapine 10mg , tab. olanzapine 15mg , tab. haloperidol 1.5mg , tab. haloperidol 5mg , tab. divalproex sodium 500mg , tab. divalproex sodium 1000mg , tab. lithium carbonate 300mg , tab. carbamazepine 200mg , tab. clonazepam 0.5mg , tab. clonazepam 1mg , tab. lorazepam2mg , tab. trihexyphenidyl 2mg , inj. haloperidol 5mg / ml , inj. lorazepam 4mg / ml , inj. phenargan 2mg / ml , hydrogen peroxide solution 6% w / v 1litre , surgical spirit solution 94% 500ml , carbolic acid 450ml bottle , cidex solutions – 5 ltr jar , chloroxylenol ( dettol ) 1 ltr bottle , e.c. lotion – 450 ml bottle , ethanol – 95% , acetic acid for via , g.v. paint 20ml , lysol 450ml bottle , m. c. marcrom 20ml , chlorhexidine gluconate + cetrimide ( savlon ) – 1ltr bottle , terpentine oil – 500ml bottle , hand sanitizer 500ml bottle ethyl alcohol ( denatured ) 95% ip 76% v / v eq. to absoulute alcohol 72.34% v / v , alkaline phasphatase kit ( pnpp kinetic method ) – 500 ml bottle , ammonium oxalate powder 500gm bottle , strips for occult blood strip per pkt 100 strip , blood glucose kit ( god / pod ) end point method 500ml bottle , blood urea kit ( berthelot method ) enzyme method / end point method – 500ml bottle , brillient cresyl blue ( bcb ) for retic count. liquid 100ml bottle , capillary tube – per tube , combistix ( ph / sp / gr / glucose / proteine ) – per packet 100 strip , cover slip good quality – per packet 100 strip , e dta powder – 250 gm bottle , filter paper – per pkt , serum cholesterol ( chod / pap method ) ( end point method ) 500ml , serum triglyceride ( gpo / pap method ) ( end point method ) 500ml , immersion oil – liquid prafin – 50ml , blood collection glass tube with cap plain 3” x ½” per piece , plan glass tube without cap 3” x ½” per piece , k2 e d t a vial blood collection tube –edta 3” x ½” per piece , blood collection glass tube oxalate 3” x ½” per piece , blood collection glass tube –fluoride 3” x ½” per piece , leishman powder – 25 gm , lugol’s iodine – 100ml bottle , methylene blue – 100 ml bottle , micro cover slip – english glass 22mm x 30mm , n / 10 – hcl for hb% 500 ml bottle , platelets diluting fluid ( ammonium oxalate crystals ) – 100 ml bottle , potassium oxalate powder – 500 gm , r. b. c. fluid ( tri sodium citrate + formalin ) – 100 ml bottle , semen diluting fluid ( sodium bicarbonate powder ) – l00 ml bottle , serum creatinine kit ( jaffes method ) end point method – 500 ml bottle , serum bilirubin kit ( jendrassik method ) end point method – 100ml bottle , s. g. o. t. kit ( modified ifcc method ) – 500 ml bottle , s. g. p. t. kit ( modified ifcc method ) – 500 ml bottle , sodium citrate crystals – 500 gm , sodium fluoridepowder – 500 gm , sodium, potassium and chloloridekit ( end point method ) – 15 tests / kit , sodium hypochloride liquid – 5 ltr jar , sprit rectified – 500 ml bottle , sulphur powder – 500 gm , sulphosalisilic acid powder 500gm , w. b. c. fluid ( glacial acetic acid + sod.chloride ) 100 ml bottle , hemoglobino meter set , urine strips 2k ( ketone+glucose ) per packet 100 strips , urine strips for sugar, protein, blood & ketone ( multistix ) – perkit 100 strips , hbsag test kit – per test , uric acid kit –end point method 100ml bottle , micro pipette 1000 ?l ( 1ml ) per piece , micro pipette 5 – 100 ?l per piece , esr stand – 50 holes per piece , esr stand – 20 holes per piece , test tube stand 100 holes per piece , test tube stand 50 holes per piece , test tube stand 20 holes per piece , glass slide per piece , glass marker pencil per piece , anti a1 – 5 ml , anti a grouping kit – 10 ml , anti b grouping kit – 10 ml , anti d grouping kit – 10 ml , anti d rh typing kit– 10 ml , anti h – 5 ml , anti ab grouping kit – 10ml , anti ahg kit 5ml , copper sulphate crystal anhydrous 500gm , anti human globulin 15 ml , band aid – per pice , distilled water –5 ltr jar , hbsag test kit elisa ( iv generation ) – per test , hcv test kit elisa ( iv generation ) – per test , hiv test kitelisa ( iv generation ) – per test , malaria test kit ( antigen ) – per test , vdrl ( rpr ) test kit – 20 ml , lactin a1 , sensitizes o cell , single blood collection bag per piece , double blood collection bag per piece , triple blood collection bag per piece , hand press ball per piece , kahn tube per piece , micro tips – 1000 ?l per piece , micro tips – 100 ?l per piece , micro slide english glass per piece , lancet per piece , ambu bag 240ml , abdominal drain no. 12 , abdominal drain no. 14 , abdominal drain no. 16 , absorbable gelatin spongegel ( ab gel ) , bandage cloth ( as per f ii ) 100 x 20 meters , blood transfusion set ( b. t. set ) , b. p. blade no. 11 , b. p. blade no. 15 , b. p. blade no. 20 , b. p. blade no. 22 , b. p. blade no. 24 , b.p. instrument marcural , b.p. instrument digital , b.p. instrument marcuralwith stand , crescent knife , cotton 400 gm. net. loss on drying – i.p. limit – nmt 8%w / w sinking time – i.p. limit – nmt 10 seconds , dispossible apron , lead apron , dispossible face mask triple layer , n 95 particulate respirator mask , personal protection equipment ( ppe kit ) , dispossible cap , foly’s catheter with styletno. 8 , foly’s catheter no. 10 , foly’s catheter no. 12 , foly’s catheter no. 14 , foly’s catheter no. 16 , electric needle burner with syring destroyer , endotracheal tube ( disposable size 0 , endotracheal tube ( disposable size 1 , endotracheal tube ( disposable size 2 , endotracheal tube ( disposable size 6.5 , endotracheal tube ( disposable size 7 , endotracheal tube ( disposable size7.5 , endotracheal tube ( disposable size 8 , epidural kit 18 g , sterile feeding tube no. 4 , sterile feeding tube no. 5 , gauge cloth ( as per f ii ) 90 x18 meters , paraffin gauze dressing ( jelonet ) , gulco meter strips – ( accu chek active ) , gulco meter strips – ( romo check plus ) , i gel airway 3 , i gel airway 4 , i.v. cannula no. 16 , i.v. cannula no. 18 , i.v. cannula no. 20 , i.v. cannula no. 22 , i.v. cannula no 24 , leucoplast4” x 5 mtr ( adhesive tape ) , round adhesive tape , liga clip 300 , microporous 1” , needle 26g , keratome knife 2.8mm , site port 15 degree , neonatal nasal prongs size 0 , neonatal nasal prongs size 1 , neonatal nasal prongs size 2 , oxygen flow meter ( for oxygen cylinder ) , oxygen face mask adult size , oxygen face mask child size , oxygen nasal mask , plaster of paris roll 4” , plaster of paris roll 6” , ryles tube size – 6 , ryles tubesize – 8 , ryles tube size – 10 , ryles tubesize 12 , ryles tube size – 14 , ryles tube size 16 , ryles tube size – 18 , saline set ( i. v. set ) , scalpvein set size – 22 , scalpvein set size – 23 , scalpvein set size 24. , silicone ventouse cup 40mm , silicone ventouse cup 50mm , stethoscope , neonatal stethoscope , digital thermometer , chromic catgut with needle no. 1 , chromic catgut with needle no. 1 0 , chromic catgut with needle no. 2 , chromic catgut with needle no. – 2 0 , chromic catgut with needle no. – 3 0 , mersilk cutting needle no. 1 , mersilk cutting needle no. 1 0 , mersilk cutting needle no. 2 0 , mersilk cutting needle no. 3 0 , mersilk cutting needle no. 4 0 , vicryl with needle no. – 1 , vicryl with needle no. – 3 0 , vicryl with needle no. – 4 0 , suture 10 0 absorble , suture 8 0 , silk suture 3 0 with reverse cutting needle , silk suture 4 0 with reverse cutting needle , port closure needle with vicryl , proline no. 1 , proline no. 1 0 , proline no. 2 0 , proline no. 3 0 , proline no. 4 0 , ethelon cutting no. 2 0 , ethelon cutting no. 3 0 , proline mesh 15 x 15 , proline mesh 7.6 x 15 , proline mesh 3 x 6 , surgical gloves disposable sterilized size – 6” , surgical gloves disposable sterilized size – 6½” , surgical gloves disposable sterilized size – 7” , surgical gloves disposable sterilized size – 7 ½ ” , elbow length gloves size 7” , insulin syringe with short needle disposable 1 ml , syringe with needle disposable – 2 ml. , syringe with needle disposable – 3 ml. , syringe with needle disposable – 5 ml. , syringe with needle disposable – 10 ml. , syringe with needle disposable – 20 ml. , syringe with needle disposable – 50 ml. , nebulizer mask adult size , syringe pump connecting tube , three way cannula , chest aspiration needle , peripheral nerve stimulator nerve block needle 5cm , peripheral nerve stimulator nerve block needle 10cm , disposable needle18g , urobag , spinal needle n0. 25g , plastic suction cannula , m.v.a. kit with cannula syringe , bakri balloon catheter for p.p.h. , lbc ( liquid based cytology ) kit , pipelle cannula for endometrial biopsy , pap smear kit ( koplin jar, cyto brush, ayre spatula ) , pusle oxymeter , interceed , umbilical cord clamp ( disposal ) , delivery kit , x – ray film size 6.5” x 8.5” , x – ray film size 8” x 10” , x – ray film size 10” x 12” , x – ray film size 12” x 12” , x – ray film size 12” x 15” , x – ray film size 14” x 17” , dvbdigitalx ray film size 8” x 10” , dvbdigitalx ray film size 10” x 12” , dvbdigitalx ray film size 14” x 17” , dve digitalx ray film size 8” x 10” , dve digitalx ray film size 10” x 12” , dvedigitalx ray film size 14” x 17” , digital cassett with screen8x10 , digital cassett with screen10x12 , digital cassett with screen14x17 , ultra sound film , c.t. scan film fuji ( 14” x 17” ) , c.t. contrast 100ml , x ray developer ( to make 9 ltrs ) , x ray fixer ( to make 9 ltrs ) , replenisher ( to make 4.5 ltrs ) , ultra sound jelly 5 ltr , rubber sheet ( mackintosh ) double colour, water proof , ecg jelly – 250 gm , dinoprostone gel – 150 gm tube...

Health Department - Jharkhand

37396525 rate contract for supply of medicine, machinery and consumables , drugs items : , acetyl salicylic acid tab 300 mg , acetyl salicylic acid tab 75 mg disp or mouth dissolve , adrenaline bitartrate, injection 1ml amp, 1 mg / ml , albendazole, suspension ( 10 ml ) , 200 mg / 5 ml , albendazole, tablets, 400 mg , alprazolam, tablets, 0.25 mg , aluminium hydroxide + magnesium hydroxide, tablet, 400 mg+400mg , amikacin, injection, 2ml, 250 mg / 2 ml , amlodipine, tablets, 5 mg , amoxicillin, capsules, 250 mg , amoxicillin, syrup / suspension, 250 mg , amoxicillin+clavulinic acid, tablets, 625 mg , ampicillin, capsules, 250 mg , ampicillin, capsules, 500 mg , ascorbic acid , chewable tablets, 500 mg , atenolol, tablets, 50 mg , atorvastatin, tablets, 10 mg , azithromycin, suspension, 15ml, 100mg / 5ml , azithromycin, tablets, 500mg , benzyl benzoate, lotion 100ml, 0.25% , betamethasone dipropionate, cream / ointment 10g, 0.0005 mg / gram , bisacodyl, tablets, , 5 mg , bleaching powder , powder 25kg bag, contains not less than 30 % w / w of available chlorine ( as per i.p ) , calcium carbonate, tablets, 500 mg , carbamazepine, tablets , 200mg , cefixime, tablet, 200mg , inj. pam 25mg , inj. pam 500mg , inj. neosligmine 2.5mg / 5ml , inj. diolona 3ml , inj. diolona 5ml , ceftriaxone, injection, vial, 1 g , cephalexin, capsules, 250 mg , cephalexin, syrup 30ml, 125 mg / 5 ml , chloramphenicol, eye drops, 5ml, 0.4% , chloroquine phosphate, tablets, 150 mg base , ciprofloxacin hydrochloride, tablets, 250mg , ciprofloxacin hydrochloride, tablets, 500mg , cloxacillin, capsules, 500 mg , co trimoxazole ( trimethoprim + sulphamethoxazole ) , suspension, trimethoprin 40mg + sulphamethoxazole 200mg ( bott of 100 ml ) , co trimoxazole ( trimethoprim + sulphamethoxazole ) , tablets, trimethoprin 80+ sulphamethoxazole 400 mg , dexamethasone, injection, 2ml, 4 mg / ml , dex chlorpheniramine maleate, syrup, 30ml, 0.5 mg / 5 ml , diclofenac injection im 3 ml ampoule ( diclofenac sodium ip 25mg / ml ) , diclofenac, tablets, 50 mg , dicyclomine hydrochloride, injection, 2ml, 10 mg / ml , dicyclomine hydrochloride, tablets , 10 mg , di ethylcarbamazine citrate, tablets, 100 mg , domperidone, tablets, 10 mg , doxycycline, capsules, 100 mg , erythromycin estolate, tablets, 500 mg , dec tab. 100mg , famotidine, tablets, 20 mg , ferrous and folic acid , oral solution, 100ml, equivalent to 20 mg elemental iron + 100 mcg folic acid / ml , ferrous and folic acid , tablets ( l ) , 100 mg elemental iron + 500 mcg folic acid , ferrous and folic acid , tablets ( s ) , 30 mg elemental iron + 250 mcg , fluconazole, capsules or tablets, 150mg , folic acid, tablets, 5mg , furosemide, tablets, 40mg , gentamicin, e / e drops, 5ml, 0.3% , gentamicin, injection, 2ml, 40 mg / ml , gentian violet, paint, 30ml, 0.5% , glibenclamide, tablets, 5mg , glyceryl trinitrate, sublingual tablets, 0.5 mg , griseofulvin, capsules or tablets, 250 mg , hydrochlorothiazide, tablets, 25 mg , ketamine hydrochloride, injection ( 10 ml vial ) , 10 mg / ml , levocetrizine, tablets, 5mg , magnesium sulphate, injection, 500 mg / ml , metformin, tablets, 500mg , mifepristone, tablets, 200mg , misoprostol, tablets, 200?g , neomycin + bacitracin, ointment, 15g, 5 mg + 500 iu / g , normal saline, injection, 540ml, 0.9 % , ors, sachet, ip composition , oxytocin, injection, 1ml, 5 iu / ml , paracetamol, syrup 60ml 125 mg per 5ml , paracetamol, tablets, 500 mg , phenobarbitone, injection, 2ml, 1ml ampouls ( 200 mg / ml ) , phenobarbitone, tablets , 30 mg , polyvalent antisnake venom, injection, vial, 10 ml , primaquine tab. 2.5mg , primaquine tab. 7.5 mg , quinine sulphate tab. 300mg , quinine sulphate amp. , inj. anti rabies vaccine, 1 ml , povidone iodine, solution, 500ml bottle, 5% , povidone iodine, solution, 2ltr bottle / jar, 5% , prednisolone tab 20 mg , ranitidine, injection, 2ml, 25 mg / ml , ringer lactate, injection, 540ml, as per ip , salbutamol sulphate, inhalation, 200mdi, 100?g / dose , salbutamol sulphate, syrup, 100ml, 2mg / 5ml , salbutamol sulphate, tablets, 2mg , tinidazole, injection, 400ml, 2mg / ml , tinidazole, tablet, 500mg , tramadol, cap, 100mg , vitamin a, capsules, 200000 iu , vitamin a, syrup, 100000 iu / ml , zinc sulfate, dispersible tablet, 20 mg elemental zinc , pyrethrum extract 2% for space spary per liter , calmpose, 2ml / amp , deriphylin, 2ml / amp , atropine , 1ml / amp , primacort100mg vial , lasix , 2ml / amp , gentamycin, 80mg, vial , cefotaxim 500mg / vial , ceftraixome 1mg / vial , ceftraixome 500mg / vial , ceftraixome 250mg / vial , ceftraixome 125mg / vial , tramadol , 2ml / amp , amikacin 500mg / vial , amikacin 100mg / vial , pantoprazale40 mg / vial , ondestron, 2ml / amp , ampicillin 250mg / vial , ampicillin 500mg / vial , cefoperzone 500mg+ sulbactom 500mg / vial , cefoperzone 1mg+ sulbactom 1mg / vial , moropenam 1gm , febrinil , 2ml / amp , k nat amt0.5ml / amp , soda bicarbonate25ml / vial , serense ( haloperidol ) , tetanus toxide 0.5ml, amp , anawin / vial , tranexa 5ml / amp , termin, 2ml / vial , inj. avil 2ml / vial , inj. dexona 2ml / amp. , inj. xylocain 2% 20ml / vial , inj. fortwin 2ml / amp , febrinil , 2ml / amp , inj. tetvac 2ml / amp. , inj. anafortan 2ml / amp. , azithromycin250mg , ciprofloxacin + tinidazole300mg , ciprofloxacin 250mg , cotrimoxazolelp paed ( sulphamethoxazole100mg+trimethoprim 20mg , glimpride1mg , glimpride2mg , ibrufen 200mg , ibrufen 400mg , metronidazole 200mg tab. , metronidazole 400mg tab. , ofloxacin 200mg , ofloxacin 400mg , paracetamol325mg + ibuprofen400mg , polyvitamin , ranitidine150mg , ranitidine300mg , vitamin b complex , drotavin40mg , dicyclomin500mg , antispasmodic , omeprazole 20mg + domeperidone 10mg , acelofenac 100mg + paracetamol500mg , calcium + vitamin d3 250mg , cetrizine10mg , metformin500mg , ofloxacim 200mg + ormidazole 500mg , pantoprazole 40mg , paracetamol325mg + diclofenacsod50mg , silver sulfadizine ointment , rem cc ( pcm 500mg + cpm 2mg ) , escitalopram oxalate tab. 10mg , paracetamol , cifixime , antispasmodic , domperdidone , ofloxacin & tinidazale , anticough syrup , paracetamol syrup , antispasmodic syrup , ofloxacin & tinidazale syrup , anticold syrup , cefixime syrup , enzymesyrup , perinorumsyrup , promethazine , cetrizinesyrup , multivitamin syrup , lubricant eye drop , moxyfloxcine eye drop , ciplox eye drop , betnosol eye drop , jsb, 1 ( 500 ml per bottle ) , jsb, 2 ( 500 ml per bottle ) , slide ( 100 pcs ) box , slide ( 50 pcs ) box , lab wash , immerssion , w.b.c diluting fluid 500ml , sodiummeta bisulfate 500 ml , v.d.r.l. ( shippils test strip1 step ) , glassslide ( per box ) 50pcs , sodium citrate 3.8% ( 500ml ) , uric acid kit , microablumin test strip , crp test kit , aso titre kit , hbs ag kit , fully automated chemicalminence analyser kit , pregnancy test kit strip , ra test kit , widalkit , methenol ( nice ) , micro pipelte ( 100 to 1000ml ) , micro pipelte ( 10 to 100ml ) , micro hps ( 1000ml ) , micro hps ( 100ml ) , tissuepaper , sprit 500ml , washbottal , pricking needle ( 200 pc. per box ) , temphos per liter ( polluted & non polluted water ) , glucase , urea , creatiuine , cholesterol , triglyceride , hdlcholesterol , bilm ( t ) , bilm ( d ) , sgpt , sgot , alkline , t.prot , alv , urinestrip ( sd ) 2 parametor , edta vial , plainvial , flnoridevial , centrifusemachines , blood group abo & rh , hb pipette , hb tube square ( top ) , bgem card ( blood gas analyzer kit ) , dengue ns 1 antigen kit , act kit adult , act 9 14 yrs kit , act 5 8 yrs kit , act 1 4 yrs kit , surgicalsprit 450ml , chomic catgatwith needle 2no , chomic catgat 1no , chomic catgat 2no , micropore 1 , micropore2 , catheterno, 6, , catheterno, 7 , catheterno, 8 , catheterno, 9 , catheterno, 10 , foleys catheterno 16with uro bag , 14 , wikryl 0, 1 , wikryl 2.0, , wikryl 3.0 , b.p.blade 10no. , b.p.blade 11 no. , b.p.blade 15 no. , b.p.blade 22 no. , b.p.blade 24 no. , cottonthred , urobag , bandege ( 90cmx16mtr ) , betadin 500ml , savlon 500ml , lysol500ml , intrcaith ( kit kat ) 18, no , intrcaith ( kit kat ) 20, no , intrcaith ( kit kat ) 24 no , microdripset , plasterof paris15kg jar , plasterof paris50kg jar , xylocanejelly 2% , rylestube18, 16 , prolene 3 , prolene , 3 8% sodium litratt 500ml , fluride vial , leshmain stain , n / 10 hcl , ecg / ultrasound jelly 250ml , gulcometer strip 25stp. ( dr. morphen ) , tetra , intra muskular needle 24 no. , catgut size 1no. , catgut size 2no. , catgut size 1 0 no. , disposable syring ( 1ml ) , insuline syring ( 1ml ) , disposable syring ( 2ml ) , disposable syring ( 3ml ) , disposable syring ( 5ml ) , disposable syring ( 10ml ) , disposable syring ( 20ml ) , cotton500 gm , surgical gloves 6 , surgical gloves 6.5 , surgical gloves 7 , disposable gloves 6 , disposable gloves 6.5 , disposable gloves 7 , iv set ( disposable ) , gouze than 5 mtr. , cotton zic zac 500 gm , bandge than 5 mtr. , pop powder , 2% xylocaine vial , 2% xylocaine jelly , savlon , catgat 2 0 , catgat 3 0 , mersilk 1 0 , mersilk 2 0 , mersilk 3 0 , prolin 1 no 1 0 , urine bag ( standred ) , x rayfilm8x10 ( green ) 50pc / pkt , x rayfilm10x12 ( green ) 50pc / pkt , x rayfilm12x15 ( green ) 50pc / pkt , x rayfilmdentalfilm / pic , devloper 9 littre , fixture9littre , 5% dextrose, 500ml , 10 % dextrose, 500ml , r l , 500 ml , n s, 500 ml , d.n.s, 500ml , hemacil, 500ml , manitol 20%, 100ml , manitol 20%, 350ml , metron i.v., 100ml , 3% n.s. , n / 2. n.s. , isolite p , ofloxacin i.v. 100ml , ciprofloxacin, i.v., 100ml , inj. noradren aline 1mg / ml , inj. vasopressin 5mg / ml , inj. dobutamine 1mg / m , inj. adrenaline 1mg / ml , inj. atropine sulphate 1mg / ml , inj. amiodarone 150mg , inj. enalaprilat 1.25 , inj. labetalol 5mg / ml ( 10ml ) , inj. midazolam 10mg , inj. vecuronium 4mg / ml , inj. suxamethonium 50mcg / ml , inj. fentanyl 50mcg ml , inj. amoxycillin / clavulinic acid ( 500mg 125mg ) , inj. targocid 400mg , inj.vancomycin 500mg , inj. ciprofloxacin 500mg , inj. levofloxacin 500mg , inj. cefotaxime 1gm , inj. artesunate 120mg , inj. linezolid 600mg , inj. clindamycin 600mg , inj. metronidazole 500mg , salbutamol respiratory solution 5mg , salbutamol ipratropium solution5m 500mcg , formetrol budesonide ( 20mcg 0.5mg ) , lignocaine 2% inj. ( 30ml ) , chlorhexidine mouth wash , chlorhexidine skin cream , betadine skin preparation , heparin 5000 iu / ml inj. ( 5ml ) , inj. enoxaparin 0.6ml , inj. tranexamic acid 50mg ml , inj. frusemide 10mg ml ( 2ml ) , inj. hydrocortisone acetate 100mg 1ml , inj. potassium chloride 15% 10ml , inj. sodium bicarbonate 7.5% , regular insulin ( 100u ml ) , tab. prednisolone 5mg , inj. sodium valproate 100mg ml , inj. levetiracetam 500mg , glyceryl trinitratesub iingual tabs , diazepam inj , diazepam tab , inj. atropine sulphate , inj. normal saline ( sod chloride ) 500ml , inj.ringer lactate 500ml , inj.mannitol 20% 300ml , tab folic acid , inj benzathine benzyl penicillin , inj lignocaine hydrochloride , inj.dexamethasone 2mg / ml vial , tab prednisolone , inj pheniramine 22.75mg / ml 2ml. ample , tab amlodipine 10 mg* , tab telmisartan 40 mg* , tab chlorthalidone 12.5mg* , tab. metformin 500mg , tab glimeperide 1mg , tab. aspirin , tab. atenolol , tab. metoprolol , tab. enalapril 2.5 / 5mg , tab. captopril , tab. methyldopa , tab. atorvastatin 10mg , tab. clopidogrel , tab. frusemide 40mg , tab. isosorbide dinitrate ( sorbitrate ) , inj. adrenaline , inj. atropine sulphate , inj. digoxin , tab. digoxin , tab. verapamil ( isoptin ) , inj. mephentine , tab potassium ip ( pencilliln v ) , inj. insulin regular , insulin intermediate , inj. aminophylline , carbamazepine tabs , carbamazepine syrup , tab prednisolone , promethazine tab , promethazine syrup , promethazine cap , promethazineinj , hydraclorthiazide 12.5mg , hydraclorthiazide 25mg , inj. streptokinase 7.5 lac vial , inj. streptokinase 15 lac vial , acetyl salicylic acid ip tab , acyclovir ip tab , acyclovir ip ointment , bisacodyl enteric ip tab , bromhexine hydrochloride ip syrup , cholicalciferol ip tab , clotrimazole ip cream , clotrimazole ip vaginal pessary , clotrimazole ip ear drop , diazepam ip tab , diclofenac sodium ip tab , dicyclomine hydrochloride + activated semithicone drop 10 ml , domperidone ip tab , eardrop forwax 10 ml , etoylline+ theoylline tab , etoylline+theoylline tab , famotidine ip tab , framycetin sulphate cream , gentamicine ip drops 5ml , glibenclamide ip tab , griseofulvin ip caps. or tab , levothyroxine ip tab , methylcobalamin tab , multivitamin schedule v of d & c rules tab , neomycin + bacitracin ointment, 15mg , salbutamol sulphate ip tab , salbutamol sulphate ip inhalation 200 mdi , silver sulfadiazine cream 1% ww , tramadol cap ip , vitamin d3 sachet , benzyl benzoate ip lation 100ml , calamine ip lotion 100 ml , chlorpheniramine maleate ip tab , codeine phosphate syp 60ml , aceclofenac + pcm tab , dicyclomin+pcm tab , iodine providen ointrent ip ointment ip , other drugs according to jharkhand edl listpioglitazone 15mg , inj. pantoprazole , tab pan 40 , inj. dicyclomine , ranitidine tab , telemesartan tab 40mg , multipara monitor , electric suction machine , electric kettle , paediatric nasal prongs ( preterm 3mm, 3.5mm ) , neonatal eye protector , baby diaper small size , baby tawels , pulse oximeter , disposal gown , sugar test strip , bag and mask ( ambu bag ) , head box ( o2 hood ) small , head box ( o2 hood ) medium size , ventilator neonatal ( optioanl ) , feeding tube and suction tube ( 8, 10, 12 no. ) , feeding cup with spoon , three way cannula , pipzo / maxotaz injec. ( 1.125g ) , calcium sandoz injection , adrenaline injection , c pap ( continuous positive airway pressure ) , abutamine and aminophylline injection , nicotine gum 02 mg , nicotine gum 04 mg , nicotine patch 21 mg , nicotine patch 14 mg , nicotine patch 07 mg , bupropion tab 150 mg , inj. toclizumab 400 mg , inj. amphotericin 20 mg ( liposomal 50mg ) , inj. atracurim ( 25mg / 2.5ml ) , inj. consider sepsivac ( 0.3ml ) , inj. labetalol , inj. irun sucrose , inj. ciprofloxacin iv , inj. ivig ( intracvenons immunoglobulin ) , inj. haexatrin , cap. oseltamarir 75 mg , montelukast 10 mg plane tab , nebulising asthalin solution , nebulising n acetyle cyxteine soution , inhaler budsonide ( plane ) , rl water , d5% water , dns water , ns water , d10% water , ointment betadine , betadine losion , b.t set , inj. botridot / botropase , inj. abutamine and aminophyline , abdominal belt , inj. a.v.s , lignocaine topical oral gel , sanitary pad deluxe , hiv & syphilis combo test kit , enoxaporin inj. 40mg , enoxaporin inj. 60mg , erythropoietin 4000iu vail , iron sucrose 20mg / ml in5 ml amp , heparin 5000iu / ml in 5ml amp , glucose d ( dabur ) , dexamethasone 0.5mg tab. , haemoglobinometer with stript , plastic zeeper , vtm stand ( tarsons ) , falcon tube stand ( 50 ml ) , para film , bio waste basket red , chair 3in1 , test tube stand ( 13*31 ) , waste troley , qiagen automated nucleic acid extraction system , ls instruments bs 2 , ls instruments leminar airflow , ls instruments leminar airflow , neuation colling centrifuge fixed angle rotoe hade , neuation minni centrifuge with pcr strip rotter , ls instruments vertical auto clave ( 12*20 ) , labman drybath incubator , celfrost ( 20 degree ) deep freezer ( 100 ltr ) , ls instruments ( 80 degree ) ultra low temp. freezer , neuation vortex mixture machine , biorad cfx 96 rtpcr machine with computer system , ls instruments pass box , cryochill vial ( 1.8 ml ) ( tarsons ) , mct tube ( 2 ml ) ( tarsons ) , mct tube ( 1.5 ml ) ( tarsons ) , nitrile gloves , ethanol molecular grade ( hi media ) 5 ltr. , ethanol molecular grade ( hi media ) 10 ltr. , amplification kit ( angstron biotech ) , pcr tips ( 0.2 ml ) ( tasons ) , micro pipette tips ( 20 200 ?l ) ( himedia ) , qiagen filter tips ( 1000?l ) , qiagen viral rna mini kit , micro pipette ( thermo scientific ) 100 1000?l , micro pipette ( thermo scientific ) 02 20?l , micro pipette ( thermo scientific ) 20 200?l , micro pipette ( thermo scientific ) 0.2 10?l , pcr tubes stand , micro pipette tips ( himedia ) 0.2 10?l , micro pipette tips ( himedia ) 02 20?l , micro pipette tips ( himedia ) 20 200?l , micro pipette tips ( himedia ) 100 1000?l , multichannel micro pipette ( thermo scientific ) , vtm stand , small dustbin , biohazard bags ( red, yellow, black, blue ) , falcon tubes stand , mct tube 1.5 ml / 2ml , mct tube stand , cryo vial ( himedia ) , parafilm 2 , dnase rnase free water ( himedia ) , ethanol 100% ( himedia ) , plastic zipper a6 size , nitrile gloves large ( himedia ) , rotar adaptor ( qiagen ) machine only , filter tips ( qiagen ) machine only 1000?l , covid 19 detection amphification kit ( anqstrom ) , refrigerator 2 8 with glass self , water bath ( remi ) , pyrethrum extract 2% for spare spray , bti ( for polluted & non polluted water ) , temephos , sline stand ( standred quality ) , mosquito fogging machine model 180p , mosquito fogging machine small size , 3 ply mask , k95 mask , sanitizer 100ml , sanitizer 200ml , sanitizer 500ml , sanitizer 5 ltr. , ppe kit ( standred size ) , hand wash ( standred quality ) 200ml , hand wash ( standred quality ) 500ml , hand wash ( standred quality ) 5 ltr. , fully digital bp machine , bp appratus mannualmachine , bucket plastic brand 15 ltr , mug plastic brand 1 ltr , tub plastic brand20 ltr , towel 1.5x2.0 feet , cardboard box for falcon tube sample collection storage , fire extinguisher , lifebuoy soap 125gm , weighing machine ( digital ) , weighing machine ( mannual ) , scissors size 6’x 8’ , sprit lamp 50ml , forcape size 6’x 8’ , absorbent cotton roll , iv cannula 18 no , iv cannula 20 no , iv cannula 22 no , elastoplast bandage , crepe bandage 6 , bp blad 12 no , bp blad 22 no , bp blad 24 no , crepe bandage , inj. tramadol 2ml , inj. trenexa iv , inj. gentamicin 20ml , inj. gentamicin 100ml , inj. dopamine 5 ml vail , prednisolone 40 mg , prednisolone 30 mg , prednisolone 20 mg , prednisolone 10 mg , prednisolone 5 mg , rifampicin 300 mg , rifampicin 150 mg , floride ion meter , manual sphygnomanometer , electronic sphygnomanometer , dr morpean glucometer , micro tips 5ml , micro pipate ( variable ) 1 5 ml , vitamin b 12 , tab isoniazid 300mg , tab levofloxacin 500 mg , tab pyrazinamide 500 mg , tab pyrazinamide 750 mg , ethambutol 400 mg , ethambutol 800 mg , pyridoxin 100 mg , moxifloxacin 400 mg , lenezolid 600 mg , cycloserine 250 mg , leucoplast , lab apron , surgical cap disposable , cap disposable , micro pipette tips 1 / 4 universal , amitriptylline 10mg , amitriptylline 25mg , clonazepam 0.5mg , lorazepam 2mg , risperidone + trihexyphenidy1 2mg , escitalopram 10mg , trihexyphenidy1 2mg , zolpidem 10mg , haloperidol , olanzapine 10mg , inj lorazepam , tab lithium carbonate 300mg , ini haloperidol , tab carbamazapine 200mg , tab sodium valpourate 200mg , ini promethazine , fluoxetine 2mg , phenytoin sodium 100mg , multivitamin tab. , chlorhexidine mouthwash 500ml , povidone iodine, germicide gargle 2% m / v mint flavor , oral gel nexanox , oral gel ornigreat , tooth paste hydent pro 10gm , tooth paste sensodent k 100gm , tooth paste hydent k 100gm...

Patliputra Medical College - Jharkhand

37257618 purchase of surgical items and small equipments , laying and jointing pvc pipe. heading , aspiration needle no 14 , aspiration needle no 16 , anklet , b.p. blade11 no. , b.p. blade15no. , b.p. blade16 no. , b.p. blade18 no. , b.p. blade22 no. , b.p. blade23 no. , b.p. instrument (mercury) , b.p. instrument (digital) , b.p. instrument (dial) , baby mucous sucker , bain circuit adult (good quality) , bain circuit child (good quality) , bigg (tube exchanger) , bandage roll 4 meter f ii schedule 4 inch (as per list specification) , bandage roll4 meter f ii schedule 6 inch (as per list specification) , bandage than f ii100cm x 18 mtr (as per list specification) , b.t. set ( blood transfusion set) , bi valve marvel swab able antimicrobial 3 way stopcock , c.v.p. manometer , centro double lumen 5x8cm , colostomy kit no. 12 , colostomy bag , corrugated sheet , cord clamp (good quality) , cotton roll 400 mg (net) , cotton thread 1 no. , crepe bandage size 4 inch , crepe bandage size 6 inch , crecent blade , cutting needle (curved) different size (assorted size) , cutting needle (round body ) different size (assorted size) , cutting needle (straight) different size (assorted size) , dispo cap for o.t.use , dispo maskfor o.t. use (3 ply) , disposable bladder wash syringe , disposable insulin syringe1ml , disposable syringe 1 ml , disposable syringe 2 ml , disposable syringe 3 ml , disposable syringe 5 ml , disposable syringe 10 ml , disposable syringe 20 ml , disposable syringe 50 ml , drainage set (romodrain) , disposable ventilator circuit , dynaplast , ecg roll 80mm x 20 mtr. , ecg paper for schiller at 2 plus(z fold)size a4. , ecg paper for schiller at 1 (z fold) size 90mmx 90mm x 400 sheets. , ecg roll (6208) 60mmx 20mtr. (bpl) , ecg roll 910d 210mm (bpl). , ecg jelly 250ml. , elastic adhesive bandage size : 10cm x 4/6mtr. (stretched length) , endotracheal tube(plain) size no. 2.0 to 4.5 , endotracheal tube(plain) size no. 5.0 to 8.5 , endotracheal tube(cuffed) size 2.5 , endotracheal tube(cuffed) size no. 3.0 to 4.5 , endotracheal tube (cuffed), size no. 5.0 to 8.5 , epi cath 1/master box of 400 , epi sure size 16 , epi sure size 18 , epidural set with epidural catheter , face mask : black/white/colour for boyels anesthesia machine no: 1 , face mask : black/white/colour for boyels anesthesia machine no: 2 , face mask : black/white/colour for boyels anesthesia machine no: 3 , face mask disposable (as per list specification) , feeding tube gs no 10 , feeding tube gs no 8 , feeding tube no 6 , flatus tube , face shield ( as per list specification) , gauge than f ii schedule 18mtr. ( as per list specification) , hi mask adult , hi mask child , head harness nasal oral , helmet mask , hme filtre , hiv drape pack kit (as pe r list specification) , i.v. set ( as per list specification) , iv cannula (jelco needle) no 12 , iv cannula (jelco needle) no 18 , iv cannula (jelco needle) no 16 , iv cannula (jelco needle) no 20 , iv cannula (jelco needle) no 22 , iv cannula (jelco needle) no 24 , jelco sponge / heavy canulla , jelonate , kehrs t tube , kehrs t tube no. 14 , knee cap , l.m.a size 1 , l.m.a size 2 , l.m.a size 3 , laryngel mask silken size 4 , laryngel mask silken size 5 , leucoplastroll 4inch , leucoplastroll 6 inch , lense (foldable)18,19,20,21,22,23,24 , lense (non foldable) 18,19,20,21,22,23,24 , xylocaine spray (5%) , xylocaine spray (10%) , malecot catheter no : 12 , malecot catheter no : 14 , malecot catheter no : 18 , malecot catheter no : 20 , malecot catheter no : 24 , malecot catheter no : 26 , malecot catheter no : 28 , malecot catheter no : 30 , malecot catheter no : 32 , medi cap , methyl cellulose (visco) , micro infussion set , mucus extractor , nasopharyngeal airway 7 , nasopharyngeal airway 7.5 , nel cath size 14 , nel cath size 16 , nel cath size 18 , nel cath size 8 , nebuliser mask (adult ) , nebuliser mask (child ) , niv mask – nasal , n95 mask (niosh certified) , oxy set adult (tube with mask) , oxy set child (tube with mask) , oxygen delivery mask adult/paed. , patient return electrode compatible with valleylab diathermy. , pedia drip/pedia set. , plaster of paris 50kg. drum , ppe kit (as per list specification) , pvc apron (large size with cloth border stitched) , pleural aspiration needle , reinforced endotracheal tube8mm , rem polyhesive adult , respirometer , romodrain , round body needle (curved) different size , rubber sheet , ryles tube no : 6 , pleural aspiration needle , ryles tube no : 14 , ryles tube no : 16 , ryles tube no : 18 , ryles tube no : 20 , sanitary pad , scalp vein set , scalp vein set no: 14 , scalp vein set no: 16 , scalp vein set no: 18 , scalp vein set no: 20 , scalp vein set no: 22 , scalp vein set no: 24 , silicon coated foleys catheter no : 6 , silicon coated foleys catheter no : 8 , silicon coated foleys catheter no : 10 , silicon coated foleys catheter no : 12 , silicon coated foleys catheter no : 14 , silicon coated foleys catheter no : 16 , silicon coated foleys catheter no : 18 , silicon coated foleys catheter no : 20 , silicon coated foleys catheter no : 22 , silicon coated foleys catheter no : 24 , silicon catheter , spinal needle no : 23 , spinal needle no : 24 , spinal needle no : 25 , spinal needle no : 26 , spinal needle no : 27 , suction catheter , suction catheter (plain) size 6 , super oxidised water , supra cath plus , supracath set , suspensory bandage size: extra large , suspensory bandage size: large , skin stapler , stellate , surgical gown , surgeon gloves (sterile) no. 6 (as per list specification) , surgeon gloves (sterile) no. 6.5 (as per list specification) , surgeon gloves (sterile) no. 7 (as per list specification) , surgeon gloves (sterile) no. 7.5 (as per list specification) , sterile powder free & polymer coated latex surgical gloves (as per list specification) , sterile powder free & polymer coated latex surgical gloves (light brown) (as per list specification) , trocar cannula – adult size. , trocar cannula – paed size , thermometer(mercury) , thermometer(digital) , infrared thermometer scanner , uro trac , urine bag 1ltr. , vaccu suction set (romo vac set) adult , vaccu suction set (romo vac set) child , yankaur suction set , cassete with screen15x12 , cassete with screen 10x 12 , cassete with screen 12x 12 , cassete with screen 8 x 10 , cassete with screen 8.5 x 6.5” , led apron big size , led apron medium size , plain gut sutures size 1, 152cm, without needle , chromic gut sutures , with needle size 1no., 152cm, ½ circle r.b., 30mm. , chromic gut sutures, with needle size 2 no., 76cm, ½ circle rb ,30mm. , chromic gut sutures, with needle size 10 no., 76cm, ½ circle rb ,30mm. , chromic gut sutures, with needle size 1 0, 76cm, ½ circle rb ,30mm. , chromic gut sutures, with needle size 2 0, 76cm, ½ circle rb ,40mm. , chromic gut sutures, with needle size 1 0,76cm, ½ circle rb ,40mm. , polypropylene sutures, size 3 0, 70cm, 3/8 circle cutting, 22mm , polypropylene sutures, size 1, 100cm, ½ circle r b heavy, 30mm. , polypropylene sutures, size 2 0, 70cm, ½ circle r b, 30mm. , polypropylene sutures, size 1, 70cm, ½ circle r b heavy, 40mm. , polypropylene sutures, size 6 no., 70cm, ½ circle r b heavy, 40mm. , braided black silk sutures, roundy boby needle, size 3 0,76cm, ½ circle r b, 25mm , braided black silk sutures, cutting needle, size 2 0,75cm,1/2 circle r c, 38mm , braided black silk sutures, cutting needle, size 1 0,75cm,1/2 circle r c, 38mm , braided black silk sutures, cutting needle, size 1,75cm,1/2 circle r c, 38mm , braided black silk sutures, cutting needle, size 2,75cm,1/2 circle r c, 38mm , braided black silk sutures, cutting needle, size 3 0, 76cm,3/8 circle r c, 26mm , synthetic absorbable sutures (pg 910), round body, size 0,90cm, ½ circle r b,40mm 1 0 , synthetic absorbable sutures (pg 910), round body, size 0,90cm, ½ circle r b,40mm 2 0 , synthetic absorbable sutures (pg 910), round body, size 0,90cm, ½ circle r b,40mm 3 0 , synthetic absorbable sutures (pg 910), round body, size 0,90cm, ½ circle r b,40mm 1no. , synthetic absorbable sutures (pg 910), round body, size 0,90cm, ½ circle r b,40mm 2 no. , synthetic absorbable sutures (pg 910), round body, size 0,90cm, ½ circle r b,40mm 3no. , sutupak 2x75cm size 1 0 , sutupak 2x75cm size 1 , zipper bag medium , zipper bag big. , garbage bag. , breast pump (best quality) , gown for mother’s , dress set for new born (with disposable diapers, cap & socks) , oxyhood for new born , feeding equipments(sets of tubes, karories & spoons. , baby blanket , storage space/ lockers for mother’s , alcohol (>70 % alcohol)based hand sanitizer 500 ml. , alcohol (>70 % alcohol)based hand sanitizer 5 ltr. jar , single lumen central venous catheter , double lumen central venous catheter , triple lumen central venous catheter , pencil tip needle 25 g , pencil tip needle 27 g , epidural set 16g/18g , combined spinal epidural set , advanced i v administration set (closed system) , closed system safety cannula , single lumen paediatric central venous catheter , double lumen paediatric central venous catheter , triple lumen paediatric central venous catheter , balanced solution , medicated double lumen central venous catheter , medicated triple lumen central venous catheter...

Ministry Of Micro Small And Meduim Enterprises - Jharkhand

37059756 bids are invited for first aid and stationery items cotton roll , betadine lotion 100 ml , regular bandage handiplast , savlon antiseptic disinfectant liquid 500 ml , cotton bandage 2 inches , leukoplast tape 5 cm x 5m , rose water 120ml , burnol cream 20 gm , moov cream 35 gm , cipladine ointment 20 gm , self sticker paper label a4, 40 labels , correction pen , ohp marker black , permanent marker black , white paint marker , stapler no 10 , stapler 24 6 , plane rule register 240 pages , highlighter colour green , re stick page marker , torch battery r20 , pencil battery aa , brown tape 2 inches , laminated envelope 12 inches x 14 inches , stamp pad blue , stamp pad red , envelope 10 inches x 14 inches , sutli , plastic dustbin 10 ltrs without cover total quantity : 3193...

Rural Works Department - Jharkhand

36925946 tender for supply of medical kit 4 bandage 2 pcs, cotton 2 pcs, povidine qidine cream 1 pc, savlon 1 pc, cetrizine 1 strip, diciofenace tab 1 strip, paracetamol tab 1 strip, dompendom tab 1strip, ors satches 5 pcs, bandaid strip 10 pcs, soap 10 gm 1pc, ciproloxacin tab 1 strip, surgical knife 1 pc), gi sheet and plastic...

Health Medical Education And Family Welfare Department - Jharkhand

36875130 bids are invited for boq01 led torch , wall clock , adult stethescope , manual hub cutter , weight machine infant , dressing tray with lid , ss tray with cover , artery forceps , bowl , kidney tray small , kidney tray big , toothed forceps , non toothed forceps , sponge holding forceps , examination gloves , mucus extractor , foley catheter , iv cannula , cannula fixator , autoclave 15 ltrs , dressing drum with lid , mask , cap , floor mopping stick , yoga mat , dari 10x10 ft , bedsheet , yellow dustbin 60 ltr , red dustbin 60 ltr , blue dustbin 60 ltr , black dustbin 60ltr , bins 15 ltr , hcv , hbsag , typhoid , cord clamp , suction catheter , bandage 4inch , makintose , betadine lotion , spirit 500ml , savlon , episiotomy scissor , scalpel , ambu bag , manual suction machine , mattress , examination lamp , labour table , delivery trolley , revolving stool , pillow , pillow cover , office table , office chair , examination table , three seater chair , plastic chair total quantity : 31280...

Indian Army - Jharkhand

36795535 bids are invited for disposable gown , syringe disposable 50ml , bandage open woven for plaster of paris 10cmx5m , gauze absorbent, folded 1 cm x 100 metres , glucose strips one touch select bott 25 strips , n 95 mask , nrbm mask , pack nasal, merocel, 8cm and 4 cm , foleys balloon catheter 2 way, silicon 16 g , bandage elastic adhesive, 6 cm x 3 metres unstretched and 5 6 metres when stretched. , ecg roll 215mmx20m , bandage dvt stocking small , bandage dvt stocking medium , disposable labour kit , adhesive plaster zinc oxide 2.5 cm x 1 mtr , adhesive plaster zinc oxide 7.5 cm x 5 mtr , apparatus oxygen inhalation portable facemask disposable for , long i v line 15 g 100 cm , long i v line 18 g of 70 cm , long i v line 18 g of 100 cm , bismuth iodoform paraffin paste of 30 gm , splint nasal 0.5 mm thick , thermoplast ext nasal splint , silastic internal nasal splint...