Health Medical Education And Family Welfare Department - Jharkhand

39856108 bids are invited for dustbin and garbage bags dustbin black 60 liter , dustbin yellow 60 liter , dustbin red 60 liter , dustbin blue 60 liter , garbage bag big black 60 liter , garbage bag big yellow 60 liter , garbage bag big red 60 liter , garbage bag big blue 60 liter total quantity : 460...

Urban Development Department - Jharkhand

39846697 rate contract for supply of various items and services for iec and capacity building activities under swachh bharat mission design and development of audio jingles / songs theme songs audio materials etc. in hindi / english / tribal language dubbing of audio from master language language ( hindi / english ) ( hindi / english / tribal to another language ) design and development of documentary / short films / tele films / promotional videos / tv spots / tvc etc. with subtitle in english / hindi dubbing of video film to from ( hindi / english ) ( hindi / english / tribal language ) another mater language language recording and editing of audio visual training materials. this may require a bit of animation, graphics, photo editing etc. video bytes / interview etc. including shoot, editing and delivery with studio minutes setup fhd videography per day with professional camera ( deliverables raw video shooted and mixing with voice over ) still hd photography with i professional camera ( deliverables raw photos clicked and image corrected in full resolution ( at least 50% ) ) design, development of advertisements / articles in soft & hard copy newspaper design and development of creatives / backdrop in softcopy radio companying 11 am to 6 pm flex printing and mounting i.. ii. backlit flex mounting ( per sqft. ) iron flex printing and front lit flex printing with iron frame and mounting ( per sqft. ) iii. ordinary flex printing with iron frame and mounting ( per sqft. ) iv. cloth banner printing with iron frame and mounting ( per soft. ) in. bio degradable flex with iron frame, printing and mounting ( per sq.ft ) vi. promo walls with installation ( frame provided by rmc ) rental charges of all kinds of hoardings i. per day rental charges for all kinds of hoarding ii. weekly rental charge for all kinds of hoarding ( per sqft. ) iii. fortnightly rental charge for all kinds of hoarding ( per sq.ft ) iv. monthly rental charge for all kinds of hoarding ( per sq.ft ) in. yearly rental charge for all kinds of hoarding ( per sqft. ) advertising construction media i. and ordinary hoarding for nonlit display ( per sqft. ) installation 1 ii. iv. in. creative designing, i maintenance charges and ii. rental charges for hoarding wall painting ( weather i. proof exterior emulsion ii.. paint shall be used ) pole kiosks and standees with printing ( per sqft. ) pole kiosks and standees with printing ( per sqft. ) glow sign board with flex ( single side display ) ( per sqft. ) glow sign board with flex ( double side display ) ( per sqft. ) creative design per proposal annual maintenance charges for ordinary hoarding simple painting ( per sqft. ) artistic wall painting / sohrai painting / wall letter writing ( per sqft. ) street play with 8 artist and audio system street play with 6 artist and audio system folk arts with 8 artist and audio i. 11. system folk arts with 12 artist and audio system mid media component iv. folk arts with 16 artist and audio system in. drama with 6 artist we. vii. drama with 8 artist viii drama with 12 artist sticker paper with i. size 1 / 8 ( per pes. ) multicolour print ii. size 1 / 4 ( per pos. ) iii. size a3 paper ( per pes. ) i ii. size 1 / 4 ( per pes. ) size 1 / 8 ( per pcs. ) pvc sticker iii. size a3 paper ( per pes. ) i. size 1 / 8 ( per pes. ) sticker 250 gsm ii. size 1 / 4 ( per pes. ) iii size a3 paper ( per pes. ) badge print i. 58mm ( per pos. ) wooden with glass cover momento i. 13 inch ( per inch ) wooden without glass ii. 13 inch ( per pcs. ) cover moment wooden with glass cover memento time t shirt caller with single colour printing t shirt caller with double colour printing t shirt caller with multi colour printing t shirt round neck with single colour t s round neck with double colour t s round neck with printing multi colour cap with single colour print cap with double colour print cap with printing multi colour sms delivery social media promotion & content designing photography print album @per day @per day videography form & pamphlet printing i. a4 size form printing single side ( 100 pcs. ) ii. a4 size form printing double side ( 100 pcs. ) 1 / 5 dmy size pamphlet ( 100 psc. ) iv a3 size multi colour printing ( per pcs. ) in with single side single colour ( a4 size ) we single side multi colour ( a4 size ) vii double side single colour ( a4 size ) viii double side multi colour ( a4 size ) ix single colour without lamination ( a3 size ) x single colour with lamination ( a3 size ) xi. double colour without lamination ( a3 size ) xii. double colour with lamination ( a3 size ) xiii a4 size printing on photo paper invitation card with envelope ( multi colour ) hand card board trophy metal diamond crystal trophy i card advertisement vehicle 1. led ( 6p size 8x6 ) vehicle with full cover hoarding & public address audio system ( with fuel ) per day ii. e rickshaw with full cover hoardings & public address audio notice board of steel plate i. certificate print i. i. system per day thickness 20 gauge with both side paint in per sq. ft. 300 gsm a4 size multi colour per piece digital signage with installation electric pole ( out door p4 led size 6x4 digital signage with led with installation on steel pole ( out door p4 led size 6x4 ) led display board 2 / 2 out door acp sheet with vinyl ( per sqft ) sun board with vinyl ( per sqft ) nehru bandi ii. signage iii iv. others i. photo frame i. ii. certificate framing certificate with wooden framing round canopy full covered hut canopy canopy i. 11. standee i. 6x4 per pcs ii. 3x2 per pcs without printing jut bag size 2 / 3 single colour iii milt colour curtin bag i ii size 2 / 4 without printing size 27 / 4 single colour size 2 / 4 milt colour size 2 / 4 without printing size 2 / 4 single colour size 2 / 4 milt colour flag with stick i ii iii 500 p a. anchor 1 dr. hand gaps i event a stage of 16x12 i whose height from the ground should be 2 and at backdrop of 16wx10h in the background. to manage even by arranging the following items 2x3 feet board i printing vinyl with 3stick. ii b. 2000w sound system with one cordless mick, one desk podium mick, two sound box, and two led tv 32tv. sun 100 pcs 200 pcs iii 300 pcs iv 500 pcs anchor i male@ 2 hour ii female @2 hour iii male @ 4 hour iv female @4 hour garbage bag i 3x4 ii 3x2...

Health Medical Education And Family Welfare Department - Jharkhand

39829721 bids are invited for laptop with bag , printer a4 with scanner , computer table , refrigerator 180 ltr , laser printer bw , steel almirah , plastic chair , iron bed for patient , bed side locker , refrigerator stand , toner cartridge samsung model mltd101sml2161 , pencil battery duraguard , steel drum small , big size trunk , ups 1kva , desktop set27 inch screen hd web cam speaker antivirus total quantity : 272...

Indian Army - Jharkhand

39796190 bids are invited for eye boq cyclosporine eye drop 0.05 percent bott of 3ml , eye drop paracaine hcl 0.5 percent , acyclovir opht oint 3 percent w w in 5gm tube , tab dasatinib 50 mg , peritoneal dialysis solution ip 1.5 percent for capd 2 ltr bag , capd drain bag 2 ltr , inj omalizumab 150 mg , fentanyl citrate 50 mcg per ml 2ml injection total quantity : 1607...

Department Of Fertilizers - Jharkhand

39772819 bids are invited for procurement of bag testing machines at hurl sindri computerized tensile strength testing machine 0 250kgf , computerized thread tensile strength testing machine 0 45kgf , humidity chamber , denier gauge measuring meter total quantity : 6...

Eastern Coal Fields Ltd - Jharkhand

39754171 supplying and laying 6960 nos. sand bag at different places of mines area to protect soil erosion of side embankment from rain discharge water under rocp....

Indian Army - Jharkhand

39753789 bids are invited for white board size 4ft x 3ft with easel , target paper fig 11 , target frame wooden 1x1 , target paper 1x1 , case collector , sand bag total quantity : 2510...

Eastern Coal Fields Ltd - Jharkhand

39715958 supplying and laying 6960 nos. sand bag at different places of mines area to protect soil erosion of side embankment from rain discharge water under rocp....

Department Of Health And Family Welfare - Jharkhand

39709262 bids are invited for nicu picu equipments bp cuffs infant , bp cuffs child , aneroid bp instrument , pediatric stethoscope , ambu bag or resuscitator bag adult , ambu bag child , laryngoscopr pediatric , weighing scle adult , manual defibrilator , crash trolley , nebulizer , digital thermometer total quantity : 141...

Indian Army - Jharkhand

39688469 bids are invited for misc items stick orderly bag , pilot stick , steward dress , national flag , signal flag , rover flag , lancer flag velvet , rp arm band , lo arm band , duty nco band , white sleeves , bed sheets white , red mat , steel name plate , food net plastic , hand towel , hedge cutter , emergency light , enclosure strip , khurpi , foot mat 3 feet x 3 feet , green table cloth , blue table cloth , washing machine samsung model wa45bg4546by total quantity : 413...

Jharkhand State Forest Development Corporation Limited - Jharkhand

39667366 tender for netlump sum amount ( shuddh ek musht rashi ) basisfor sale of old kendu leaf lots of 2022 and before 1 old stock of kendu leaf 2 m.f.p.p. range lohardaga 3 rr lohardaga a / 2021 4 m.f.p.p. range ranchi 5 rr burmu / 2021 6 m.f.p.p. range simdega east 7 rr simdega east a1 / 2021 8 rr simdega east e / 2021 9 m.f.p.p. range chandwa 10 rr balumath c2 / 2021 11 m.f.p.p. range kundri 12 hd kundri d2 / 2020 13 m.f.p.p. range manatu 14 hd manatu c1 / 2021 15 hd manatu c2 / 2021 16 hd manatu d1 / 2021 17 hd manatu e2 / 2021 18 m.f.p.p. range manika 19 hd manika a/ 2021 20 m.f.p.p. range latehar 21 hd latehar b/ 2021 22 m.f.p.p. range bhandaria 23 hg kutku b / 2019 24 m.f.p.p. range nagar 25 hg nagar e / 2021 26 m.f.p.p. range bhawanathpur 27 hgbhawanathpur b / 2021 28 hgbhawanathpur c2 / 2021 29 m.f.p.p. range mohammadganj 30 hgmohammadganj a1 / 2021 31 m.f.p.p. range chauparan 32 hh barhi b / 2021 33 hh barhi c / 2021 34 m.f.p.p. range hazaribagh i 35 hh mandu / 2021 36 m.f.p.p. range hazaribagh ii 37 hh barkagaon a1 / 2021 38 hh barkagaon b2 / 2021 39 m.f.p.p. range partappur 40 hh partappur c / 2021 41 m.f.p.p. range chatra 42 hh rajpur a / 2021 43 hh rajpur b / 2021 44 m.f.p.p. range kunda 45 hh kunda b / 2021 46 hh kunda c1 / 2021 47 m.f.p.p. range pakur 48 hgd hiranpur a / 2019 49 m.f.p.p. range sahebganj 50 hgd rajmahal damin (p) a/ 2017 (854.560 st. bag)hgd rajmahal damin (p) c & mandro / 2017(557.700 st. bag) 51 m.f.p.p. range jamua 52 hgd doranda/ 2021 ...

Border Security Force - Jharkhand

39629956 replacement of old damaged sewer line, cleaning of chocked line, construction of manhole chambers of non residential area under tc&s bsf h / bag....

Indian Army - Jharkhand

39623336 bids are invited for panasonic camcorder and accessories panasonic ag cx8 ed 4k professional camcorder , simpex 670 tripod , panasonic ag cx8 ed 4k professional camcorder camera bag , sandisk memory card 128 gb , sandisk ultra memory card 128 gb total quantity : 5...

Border Security Force - Jharkhand

39611092 replacement of old damaged sewer line, cleaning of chocked line, construction of manhole chambers of residential area under tc&s bsf h / bag....

Urban Development And Housing Department - Jharkhand

39611006 bids are invited for furniture equipment and it communication cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , a 4 paper white , pen , floor wiper rubber , floor wiper jut , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , garbage poly bag black 10 kg. , garbage poly bag red 10 kg. , hand wash liquid , hand wash soap , bed sheet , patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold bedside screenwith curtain stand , plastic chair , desktop computer with ups , printer hp , speaker , aebas fingerprint scanner device total quantity : 1330...

East Central Railway - Jharkhand

39607585 supply of loco pilot tool kit pocket type bag with cover , belt and cover lock , size 14 x 9 high quality semi water proof lather...

Jharkhand State Forest Development Corporation Limited - Jharkhand

39508530 tender on net lump sum amount (shuddh ek musht rashi ) basis for sale of old kendu leaf lots of 2022 and before. , old stock of kendu leaf , m.f.p.p. range lohardaga , rr lohardaga a / 2021 , m.f.p.p. range ranchi , rr burmu / 2021 , m.f.p.p. range simdega east , rr simdega east a1 / 2021 , rr simdega east e / 2021 , m.f.p.p. range chandwa , rr balumath c2 / 2021 , rr chandwa c / 2021 , m.f.p.p. range chaibasa , seized / 2022 , m.f.p.p. range chakradharpur , seized / 2023 , m.f.p.p. range kundri , hd kundri d2 / 2020 , hd kundri c1 / 2021 , hd kundri c2 / 2021 , m.f.p.p. range manatu , hd manatu c1 / 2021 , hd manatu c2 / 2021 , hd manatu d1 / 2021 , hd manatu e2 / 2021 , m.f.p.p. range daltonganj , hd patan a2 / 2021 , hd patan c / 2021 , m.f.p.p. range manika , hd manika d1 / 2021 , m.f.p.p. range latehar , hd latehar b/ 2021 , hd latehar c/ 2021 , m.f.p.p. range bhandaria , hg kutku b / 2019 , m.f.p.p. range nagar , hg nagar e / 2021 , m.f.p.p. range ranka , hg ranka east (p)b / 2021 , m.f.p.p. range bhawanathpur , hgbhawanathpur b / 2021 , hgbhawanathpur c2 / 2021 , m.f.p.p. range mohammadganj , hgmohammadganj a1 / 2021 , m.f.p.p. range chauparan , hh barhi b / 2021 , hh barhi c / 2021 , m.f.p.p. range koderma , hh domchach b / 2021 , m.f.p.p. range hazaribagh i , hh mandu / 2021 , m.f.p.p. range hazaribagh ii , hh tandwa a / 2021 , hh barkagaon a1 / 2021 , hh barkagaon b2 / 2021 , m.f.p.p. range partappur , hh partappur c / 2021 , hh partappur e / 2021 , m.f.p.p. range chatra , hh rajpur a / 2021 , hh rajpur b / 2021 , m.f.p.p. range kunda , hh kunda b / 2021 , hh kunda c1 / 2021 , m.f.p.p. range pakur , hgd hiranpur a / 2019 , m.f.p.p. range sahebganj , hgd rajmahal damin (p) a/ 2017 (854.560 st. bag) hgd rajmahal damin (p) c & mandro / 2017(557.700 st. bag) , m.f.p.p. range jamua , hgd doranda/ 2021...

Central Coalfields Limited - Jharkhand

39493109 supplying of sand to be used for stemming material in blasting of ob and supplying of empty bag for sand filing for muffling and controlled blasting under sdocm project, dhori area....

Health Department - Jharkhand

39485354 supply for office stationery, equipments etc. , items names : , executive chair , revolving chair , study chair , office table , almirah ( for office use ) , glass almirah , journal rack , computer table , dinning table set ( 1 table + 6 chairs ) , dinning table , lab table , examination table , stool steel chair , bed side locker , single bed ( for hostel ) ( double decker ) , almirah , chair , table , needleholder : , 6 , 7 , 8 , suture cuttingscissors , sutureneedle : , straight , curved , mackintosh roll : , full bed length ( qtyin meters ) , draw mackintosh , extra for treatment and dressing , hot water bag , ice caps , ice collar , corrugated rubber sheet , gloves different sizes , catheters : , urinary catheters , foleys catheters , nasal catheters , plain catheters , rectal catheters , finger stalls different sizes ( set ) , air rings , mucus sucker , breast pump , nipple shield , gastric lavage tube , ryles tube , flatus tube , blakemore sange staken tube , rubber tubes with different diameter and size , rectale syringe with nozzle , ring pressories each size , douche nozzle different sizes , mortar and pestle , nelsons inhaler , spirit lamp , test tube stand , test tube holder ( in dozen ) , sterilizer small , portable autoclave , weighing scales , adult weighing scale , baby weighing scale , back rest , splints different sizes , i. v .stand , microscopes , sphygmomanometer ( mercury ) , a regular ( dial ) , b electronic ( digital ) , stethoscope , over bed table ( cardiac table ) , screens / bed side curtains , three way adapter , mattress: , adult , child , mattress cover: , adult , child , bed sheets , baby cot sheets , draw sheets , sandbags with covers , sponge cloth , hot water bag covers , ice cap covers , air ring / cushion covers , gowns masks , patient s clothes: , male ( set ) , female ( set ) , baby dresses of different sizes ( set ) , diapers different sizes ( set ) , trolley cover , dirty linen bag / box , leggings ( pair ) , perineal sheets , triangular bandages , many tailed bandages , eye shields , dusters , slings , t binder , screen curtains ( set ) , adult human articulated skekelton with hanging facility in a glass cupboard with locking facility. , full set of dis articulated human skeleton. , full size human body showing all muscles and articals , human torso : , male , female , skin cross section , heart and large blood vessels , heart with detachable parts on a stand , eye with different sections , ear with different sections , human brain with spinal cord , lungs and trachea , larynx , digestive system: , stomach , female reproductive system: , uterus on stand , male reproductive system , urinary system: , kidney: , joints and ligaments: , wrist , elbow , shoulder , ankle , knee , hip , teeth , skeleton system , muscular system: , showing different muscles of the body , joints and ligaments: , nervous system: , brain , cardio vascular system , respiratory system , lungs , trachea , larynx , digestive system , oral cavity , teeth , stomach pancreas and spleen , small intestine , large intestine , liver and gallbladder , kidney macroscopic structure , skin , eye , ear , female reproductive system , menstrual cycle , male reproductive system , endocrine glands , first aid for burns , cardiac pulmonary resuscitation: , adult , children , infant , first aid charts or emergencies such as fracture, drowning, wounds, poisoning, bites ( each ) , stages of development of embryo ( set ) , female bony pelvis , foetal skull , female dummy ( zoe model ) / obstetrical training with doll , placenta , full size fetus , new born baby , baby cradle , breast changes in pregnancy , uterine changes in pregnancy showing height of uterus at different terms of pregnancy , stages of labour , first stage , second stage , third stage , breech presentation , complete breech , incomplete breech , foot presentation , shoulder presentation , face presentation , brow presentation , twin pregnancy , placenta previa different stages , caput succedaneum, cephalhaematoma , congenital malformation of new born: , cleft lip palate , spina bifida , hydrocephalus , anencephalus , all in one computer set , laptop , xerox machine , color printer , air conditioner , lcd projecter , lcd screen , over head projecter , community health nursing for anm , community health nursing for anm ( hindi ) , health worker keliyepathyapustak , community health nursing ( samudayikswasthvigyan ) ( hindi ) , nursing manual of nutrition and therapeutic diet , essentials community health nursing in hindi , where there is no doctor a village health care handbook , where there is no doctor hindi , mecical surgical nursing , fundamentals of nursing , principal & practice of nursing , health promotion for anm , aaharavumposhan , text book of anatomy & physiology for nurses , anatomy & physiology anotomy and physiology for nurses ( sharirrachanavigyanevamsharirkriyavigyankewalnursonke live ) ( hindi ) , prathamiksahayataevamsankatkalindekhbbal ( hindi ) first aid and emergency care , manual of first aid ( prathamikupcharka manual ) ( hindi ) , health promotion , nurse keliyemanovigyanavumswasthya , psychiatric meantal health nursing , text book of microbiology for nurses , sukhamjivvigyankipathyapustak ( text book for microbiology for nurses ) ( hindi ) , primary health care nursing for anm , psychology and sociology for anm and bt students , nursing arts proceduces ( nursing kemoolsidhanth ) valume i ( hindi ) , fundamentals of nursing ( hindi ) , senior nursing procedure ( nursing kemoolsidhant volume ii ( hindi ) , sociology for nurses , pharmacology for nurses , medicine kipathyapustak , baal swasthya nursing for anm , child health nursing for anm ( hindi ) , quick look nursing pathophysiology , comprehensive manual of pediatric nursing procedures , pediatric nursing , english for nursing , textbook of computer in nursing , textbook of obstetrics , midwifery & gynecological nursing ( hindi ) , maternal & neonatal nursing care plans , midwifery for anm , midwifery and gynecological , nursing ( hindi ) , manual of midwifery procedures , pedicatric nursing care plans , cumulative record for general nursing midwifery course , health centre management , imnci module for basic health worker , chart booklet , simplified partograth ( big size ) , family planning , journal of midwifery, women health &gynaecological nursing. , journal of community & social health nursing , patient cots adult , child , bed side locker , revolving stools / chair , manikins for demonstrating nursing procedure: , adult male imported , adult female , child manikin , new born , cpr ( full body ) , trays different sizes: , 24x16 , 14x10 , 11x9 , 8x5 , trays with cover assorted sizes , bowls: , 16diameter , 10diameter , 4diameter , 2 3diameter , bowls with cover , 6diameter , 4diameter , enema can , 1 1t. capacity , 1 / 2 1t. capacity , kidney trays of assorted sizes ( big ) , measuring jugs , 1000 ml. , 500 ml. , 250 ml. , assorted size basins , catheter dish with cover , knife dish with cover , feeding cups , douche can , sputum mugs , bed pans , urinals male , funnel: , 4diameter , 2diameter , jars with covers: , 12x8 , 6x4 , dressing drums: , 8x4 , 12x9 , tub for sitz bath , saucepan with lid: , 1 1t. capacity , 2 1t. capacity , kettle: , 1 1t. capacity , 2 1t. capacity , trolleys with upper and lower shelves ( without steel top ) , pint measure , gallipots , mugs , bottle brush , cheatle forceps , sponge holding forceps , artery clamps: , straight 6 , curved6 , dissecting forceps: , toothed , non toothed , mosquito forceps , kocher’s , scissors: , surgical 8 , bandage , mayos cutting scissors , tissue forceps , sinus forceps , biopsy forceps , liver biopsy needle , alice forceps , probe , groove director with probe , mouth gag , tongue depressor , tongue holding forceps , nasal speculum , aural speculum , re tractors: , single hook , double hook , bladder sound , male urethral dilator ( set ) , packing forceps: , nasal , oral , ear irrigation syringe , ear speculum , shaving set , safety razor with blades , bard parker knife handle , surgical blades different sizes set ) , catheters , airway , laryngoscope: , paediatric , adult , proctoscope , infusion set , autoscope , ophthalmoscope , tracheostomy set with various size of tracheal tubes ( set ) , head mirror , tanning fork , oxygen cylinder with stand , oxygen mask , measuring cups: , 240ml. , 120 ml. , 30 ml. , undine , eyebath cup , pipettes & droppers , glass connection: different types e.g. y.t.l. ( each ) , wolfs bottle , conical flasks , ounce glass , dram glass , thermometers : , oral , rectal , bath , room , lotion , pulse meter , urinometer , lactometer , heamoglobinometer , specimen glasses , test tubes ( dozen ) , glass slides with cover ( box ) , bottels500 ml. capacity for lotion and mixtures , automizer , manometer , glucometer , head mirror , tuberculin syringe , insulin syringe with needle , needle all sizes ( one dozen each ) , lumbar puncture needle , trochar, cannula for abdominal paracentesis , i.v. cannula different type sand sizes , biopsy needle : , adult , children...

South Eastern Railways - Jharkhand

39476779 supply of collapsible folding canvas stretcher, specification of collapsible folding canvas stretcher as follows. it should be two fold stretcher. it should be light weight, easy clean and anodized aluminum alloy framework. it should be easy to use and durable enough to get the job done. handle should be excellent grip ( grip size 100 mm ) . aluminum tube : approx. dia. 30 x 1.5 mm. two safety straps to secure patient. washable, water proof and anti fungus fabric top and carrying bag. canvas size should be 1750 ( l ) x 540 ( w ) mm. overall size: 2000 ( l ) x 540 ( w ) x 150 ( h ) mm. aluminum grade should be 6063. self weight:6.5 kg. load capacity : 160 kg. lt should be ce, iso 9001:2015 , iso14001:2015 ;iso 13485 ;2o16 ;oh sas18001:2007. [ warranty period: 30 months after the date of delivery ] [ warranty period: 30 months after the date of delivery ] ...

Department of Higher Education - Jharkhand

39469531 bids are invited for sports items volleyball net , tennis net , badminton net , hockey goal net , football goal net , basketball ring net , cricket bat 1 , cricket bat 2 , cricket skier bat , wicket keeper gloves , cricket helmet men , batting gloves , plastic moulded stumps , cricket stump , hockey sticks , hockey goal keeper kits with bag , hockey face mask , hockey gloves , hockey ad , relay baton nelco , snooker billiard cue stick , snooker chalk , snooker tips , boxing gloves 1 , boxing gloves 2 , boxing gloves 3 , boxing gloves 4 , boxing gloves 5 , boxing headguard , boxing puching bag 1 , boxing puching bag 2 , boxing puching pad , boxing reaction ball , chest guard for karate , shin guard red for karate , shin guard blue for karate , gloves red for karate , gloves blue for karate , dummy standing kick bag for karate , female chest protector , curved focus karate kick pad , vinyl chess board , carrom , carrom powder total quantity : 502...

Health Department - Jharkhand

39468446 supply for materials supply for materials and medical equipments , equipments name: , hospital seat bed , semi flower bed with ms side rail , flower bed with ms side rail , hospital i.c.u bed , hospital bed matress , hospital pellow , hospital sline stend , hospital bed side locker , hospital 3 fold screen , hospital strecture on trolly , pediatric bed , pediatric flower bed , ecg machine computerized , ventilators ( adult ) , pulse oxymeter , a.c1.5 ton 5 star with fitting , a.c 2ton 5 star with fitting , stabilizer automatic for ac double phase 5 kva , stabilizer automatic for ac double phase 3 kva , b.p apparatus stand model (isi mark) , stehoscope (isi mark ) , thermometer ( isi mark) , ecg paper roll cardiart gen x 3 cardiart 6208 view , suction machine , foetal doppler ( pocket doppler ) , foetal doppler ( tabple top ) , r o water machine , autocalve double drum , kidney tray big , curve kocher clamp , iv set ( adult ) , uro bag , sanitary pads , focus light , plastic apron , shoe cover , disposable cap , rubber sheet , eb x49 xga projector brightness: 3600lm with hdmi port (optional wi fi) , dustbin with lid 30 ltr. , hub cutters ( mannual ) , hub cutters ( electric ) , water container ( steel 20 ltr) , stools for immunization room (steel ) , torch light 4 cell , air rotor , bed pan (ss) , coolers big (isi mark) , table cloth , double door 308 litres 5 star refrigerator , 205 l direct cool single door 5 star refrigerator , chromic catgut 1/0no , chromic catgut 2/0no , chromic catgut 3/0 no , shadoless cellar light led , mersilk 1/0 no , mersilk 2/0 no , surgical instrument set , foelys cather 14 no , foelys cather 8 no , foelys cather 10 no , foelys cather 16 no , foelys cather 18 no , disposable syringe 3 ml , disposable syringe 10ml , disposable syringe 5 ml , disposable syringe 20 ml , b.p blade ( 15 no. ) , b.p blade ( 20 no. ) , b.p blade ( 22 no. ) , spinal needle 25 no , skin hook single , skin hook double , foreign body remover , foreign body extractor , needle holder ( big) 9’’ , needle holder ( small ) 6’’ , tooth forceps , plainforceps , scissors mayo’s ( 7’’ & 9’’) , scissors ( suture cutting ( 7’’ & 9’’) ) , b.p handle no 3 , b.p handle no 4 , surgical spirit 500 ml , scissors 8’’ , pen elkos first , handi palast ( round ) , lifter , intrument sterliser ( electric ) small , intrument sterliser ( electric ) medium , intrument sterliser ( electric ) large , arteriforcep medium straight , arteriforcep medium curve , arteriforcep large , elices forceps , niddle holder 8’’ , abdominal retracter small , abdominal retracter medium , abdominal retracter large , doins retracter , bone lever small , bone lever large , bone holdinyforcep small , bone holder forcep large , periostium elevator , pop 50 kg drum , towel clip , k wire1 , k wire1.5 , k wire2 , ss – wire 20 , ss – wire 22 , ss – wire 24 , k – nail all size , v – nail , sq – nail , cotton roll 400gm nett. , cotton roll 100gm nett. , kit kath 16 no , kit kath 18 no , kit kath 20 no , kit kath 22 no , kit kath 24 no , bandage 6 inch , bandage 4 inch , gauze than , green cloth , cotton bed sheet , blanket ( 4x 6 )2.5 kg , blanket ( 4x 6 )3 kg , carpet ( dari )( 30/ 30) , bp instrument electronic chargeable , glucose meter (isi mark) , hemoglobin test machine , stethoscope (isi mark) , thermometer genral , x ray view box large size , pulse oximeter , blood bag ( singal ) hl , hiv rapid card aspen , hbsag papid card aspen , hcv rapid card aspen , para hit total (mp) , r.p.r test card aspen , r.p.r test strip aspen , blood group kit (abd) arkary , anti ab arkray , anti human globulin arkray , 22% bovine albumin arkray , hiv elisa kit , hbsag elisa kit , hcvelisa kit , hiv rapid card retroquik , hbsag rapid card hepaview , hcv rapid flaviscreen , refrigerator digital thermometer , blood bag collection monitor , glass slide blue star , distilled wateer , sodium hypochlorite solution. , khan/khans test tube borosil , copper sulphate crystal , lancetblood , dobule cap e.d.t.a tube , khan/khans test tube stand 60 hole plastic , colorimeter , digital weight machine baby , digital adult weight machine , b.p machine ( mercury ) , elisa processor transasia elan 30 s , pumping ball/smiley ball , electric insects killer , elisa reader , elisa washer , autoclave electric vertical( pressur & temp display) , blood bag tube sealer , drabkins reagent , measuring cylinder 50ml , hydrometer ( specific gravity ) , pippet stand , cuvette ( for colorimeter) , needle destroyer ( electric ) , blood bag storage refrigerator , blood bag storage refrigerator thermofisher 650 ltr. , hydrogen peroxide 500 ml , hydrogen peroxide 100 ml , ec( 500 ml ) , stirrup pump ( ddt spray machine ) , cotton roll 25 gm nett. , cotton rol l 50 gm nett. , cotton roll 200 gm nett. , cotton roll 400 gm nett. , crepe bandage 6’’ , crepe bandage 4’’ , office table t9with two drawer , examination table , office table t104( three drawer ) , office table t8both side drawer , patient stool revolvingtable , impres table 1800mm , premium visitor chair with full arm , chair ch7b , laseda high back chair , sedna high back chair , bandage 6 , bandage 4 , revolving chair with arm , barvo high back chair , computer table c3d , strowel plain (almira 20 gauge )7’’/3.5’’ , strowel plain (almira 20 gauge )4’’/3.5’’ , steel rack 6’’/3’’ ( 5 rack ) , mattrics 3 seeter chair with arm , mosquito net small , mosquito net medium , mosquito net large , xerox machine (mp 2014) , didital ups eb 1650 ah inverter with inva tubular battery 220 ah , computer i3/11 gen/ 8 gb ram / 512 gb ssd rom/ windows 11/20” display/web came , • printers • laser printer • m438nda laserjet a3 monochrome all in one printer with network, duplex & adf , scannerlide 120 , coolers big ( isi mark ) , pillows covers , pillows , wire cutter , digital x ray machine 100ma , pen drive 32gb(hp) , pen drive 16gb(hp) , floor duster with handle , plastic chiar , epson ecotank m3170 wi fi all in one monochrome ink tank printer ith adf & duplex , computer table , office table size 4ft x 2.5ft double drawers , office table size 3ft x 2ft single drawers , laptop core i5 12th gen. 8gb ram, 1tb/ssd hard disk/ 2gb graphics, windos 11 , 3.8% sodium citrate solution 500 ml , abo & rh(anti ab&d) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent gauze than 18 m x 90 cm special , adenosine , airway 0 no. , airway 1 no. , airway 2 no. , airway 3 no. , airway 4 no. , ambu bag adult , ambu bag pediatric , ambu bag neonatal , apron , aso latex (span) (20 pcs) , b.p. blade no. 12 , b.p. blade no. 15 , b.p. blade no. 20 (all size) , baby cap , baby dress , baby socks , baby tag , barium chlorine 500 ml , bendicts solution 500 ml , bilirubin (span) (35 pcs) , bleaching powder25kg bag , blood bag350 ml , blood bag 100 ml , botroclot 10ml , bovine albumin 22% (5 ml) , bt set , budecortrespules, , burn patti , butter fly scalp vein set (23no.)(all size) , butter fly scalp vein set (24 no.) , caffeine oral capnea , cannula (18 12)/jelco , cannula 20 no , cannula 24 no , cannula 26 no , capillary tube , chromic catgut plain 2 , chromic catgut plain 2 0 , chromic catgut with needle 0 1 , chromic catgut with needle 0 2 , chromic catgut with needle 1 , chromic catgut with needle 1 0 , cleansole , color coded bins black 20 litre , color coded bins black 40 litre , color coded bins black 60 litre , color coded bins black 80 litre , color coded bins blue 20 litre , color coded bins blue 40 litre , color coded bins blue 60 litre , color coded bins blue 80 litre , color coded bins red 20 litre , color coded bins red 40 litre , color coded bins red 60 litre , color coded bins red 80 litre , color coded bins yellow 20 litre , color coded bins yellow 40 litre , color coded bins yellow 60 litre , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , lam/i gel 01234 , lancet (100 pcs) , leishmans stain (500 ml) , lens no. 23 , lens no. 24 , lens no. 25 , lens no. 26 , lens no. 27d , mackintosh sheet (1 meter) , magills forceps large , magills forceps small , malaria pf/pv antibody card rapid test (50 kits) , malaria pf/pv antigen card rapid test (30 kits) , malecot catheter different sizes , maleria stain kit jsb (i) , maleria stain kit jsb (il) , memantine , mersyl 2 0 withcurvedneedle , mersyl 2 0 withstraight needle , metheline blue (500 ml) , micro pipette (10 1000ul tips) , micro pipette (10 100ul tips) , micropore 1 inch , micropore 1/2 , micropore 2 , mucus sucker , iron bed , mattress 3x6 , foot step , dustbin plan , hydraulic bed , bucket , bed side screen , test tube (khan tube) , test tube (khan tube) 2.5 3 ml , test tube (khan tube) 3 4ml , test tube holding clamp , test tube rack , thiopentone , thrombophob ointment , tissue paper roll , tourniquet , color coded bins yellow 80 litre , cord clamp , cotton roll 400gm nett , cotton thread , cover glass (100 pcs) , cpr (latex) (20 pcs) , creatinine(creast) (35 pcs) , crescent blade disposable , disposable niddle 18fr , disposable niddle 22 fr , disposable syring 10ml , disposable syring 1ml , disposable syring 2ml , disposable syring 3ml , disposable syring 5ml , distilled water 1ltr , distilled water 5ltr , donepezil , duolin respules , ec (700 ml) (agrawal) , ecg jelly , edta vial , endotracheal tube 2 no , endotracheal tube 2.5 no , endotracheal tube 3 no , endotracheal tube 3.5 no , endotracheal tube 6 no , endotracheal tube 6.5 no , endotracheal tube 7 no , endotracheal tube 7.5 no , enoxaparin , epidural catheter , epipress , esr stand(6group) westergrens method , ethamsylate , examination gloves 6.5 (100pcs) , examination gloves 7.0(100pcs) , examination gloves 7.5(100pcs) , fetal doppler , filter paper , fixer & developer 12 lt , fixer & developer 9 lt , flouride powder , flouride vial , folly’s catheter 10 two way , folly’s catheter 18 two way , folly’s catheter 20 two way , folye’s catheter 16 two way , formalin solution 500ml , fouchet reagent (500 ml) , g.v. paint lotion 400ml , glacial acetic acid (500 ml) , glass slide (100 pcs) , gloass rod , gloves 6 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 6.5 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7 surgical pair sterlised made of natural latex, finish for better grip, packed in plastic pouch , gloves 7.5 surgical pairsterlised made of natural latex, finish for better grip, packed in plastic pouch , gluco meter (dr morphen) , gluco meter strip (dr morphen) , glucometer , glucometer strip , glucometer (ozocheck) , glucometer strip (ozocheck) , glucose (auto span) (50ml) , gown , haemometer set , hbsag card rapid test kit (50 pcs) , hcv rapid (30 kits) , heavy duty gloves , hiv card rapid test (50 kits) , nasal prongs (neonats) (cannula) , needle straight , new born diaper , oxygen mask adult , oxygen mask child , paraffin mesh , pedia set , plain catgut (1 0) , plain catgut (2 0) , plain catgut 1no , plain vial , pottasium permagnate (400gm) , povidone iodine lotion 500ml , pregnancy kit , prolene(2 0) , prolene (1no) , prolene mesh 7.5 x10cm , prolene mesh 7.5 x15cm , prolene(1 0) , pyrethrum extract 2% , rhyles tube16 no. , room thermometer , ryles tube 5fr , ryles tube 6fr , ryles tube 7fr , ryles tube 8fr , saline set , shoe cover disposable , side port disposable , slide dying rack , sodium calcium hypochloride (5 litre) , spirit 100 ml , spirit 1000 ml , spirit (methylated) 1000ml , sprit lamp , stritching thread , suction catheter , suction tube6fr , suction tube 8 fr , ultrasound jelly , underwater 1c drain for chest tube , urea (creast) , uric acid (span) , urine albumin & sugar test kit , urine pot , urine strip (100pc pack) , uro bag , vdrl (strip) , vdrl (syphilis) card rapid test (100pcs) , vdrl rapid card , vdrl rapid latex , vicryl(1 0) , vicryl1no , vicryl1no 140 cm , vicryl1no 45 cm , vicryl1no 70 cm , vicryl1no 90 cm , vicryl (2 0) , westergrens tube , widal kit (span) , wooden spatula , x ray cassttee (08x10) , x ray cassttee (10x12) , x ray cassttee (12x15) , x ray plates (08x10) , x ray plates (10x12) , x ray plates (12x15) , yellow tips for micropipette , temophos 25 ltr , bti (as) for polluted/non polluted water , bti (wp) for polluted/non polluted water , swab , plastic tub 15 ltr , plastic tub 20 ltr , plastic tub 30 ltr , towel (24x18) , plastic mug 1 ltr , plastic bucket 20 ltr , anteseptic soap 75 gm , plastic sputum container with sticker , lence paper , potasium per magnate , zipper pouch , falcun tube , oxygen regulator with flow meter , non chlorinated biohazard bags black size 80kg , non chlorinated biohazard bags blue size 80kg , non chlorinated biohazard bags red size 80kg , non chlorinated biohazard bags yellow size 80kg , non chlorinated biohazard bags black size 2litre , non chlorinated biohazard bags red size 2litre , non chlorinated biohazard bags black size 40kg , non chlorinated biohazard bags blue size 40kg , non chlorinated biohazard bags red size 40kg , non chlorinated biohazard bags yellow size 40kg , hemogllobin test kit , hemogllobin test strips , lancet , glucometer , glucometer strips rate per pc , urine strips , hiv and syphilis test kit , hiv test kit , syphilis test kit , sickle cell rapid test kit , iodine test kit , hbsag test kit , filariasis test kit , malaria test kit , sanitary pad , plaster of paris 1kg , plaster of paris 50 kg , plaster of paris 5kg , oxygen cylinder small , oxygen cylinder medium , oxygen cylinder large , tubular battery 220 ah , ambu bag , eletric automatic unicron demmart star dental chair , dental x ray machine , vatech rvg sensor , desktop & color printer , dentail air compresor , auto clave , ultrasonic scalerhand pic walldent , waldent digital glass bed sterlizer , gdc extraction forcep kit set of 12 , gdc root elevator set kit10 , local anesthesia with aderenaline , dental micro moter with straight contra hand pic , walldent pro dental set 15 , mask , waldent dental lead appron , dental patient drape , gdc surgical curettee 3 (186) , air rotor handpic 2 lead (nsk) dyna , type 1 glass ionomer restorative , type 2 glass iconomer restrative , waldent composite kit , ewaldent eco plus light curring unity 2 , waldent endomeeter hand pic esw 2 , super endogald hand portopear file ( pack og of ) , waldeent flexgald rotry file 21 mm 25 mm , waldeent h hand file gald rotry 21 mm 25 mm , waldent e dta gutta percha paint 6% , waldent seal pexrin baid roat camal sealing matrial , raund barrel , stat barrel , farama cresal , calsium hydroxide podear 10 , saliva ejector , un chamber with 12 tray , gownpreparatior kit , endo2 bur , flish box , dj 16 , k hhand file , k file 6 to 15 , k file 8 to 15 , micro tourch & gas , skin mirar , mouth mirror , dental probe , dental twerer , dental cement carrier , steel visitor chair , transmittance / absorbance photometry based digital haemoglobinometer with auto / self calibration (no manual code / chip insertion) and 0 25gm/dl , strips / cuvette compatible with above digital haemoglobinometer , fad gdh enzyme based glucometer strips (1 glucometer free on 1,000 strips) , boronate affinity chromatography method based hba1c glycated haemoglobin analyzer with inbuilt bluetooth for wireless data transfer, in built rechargeable battery and weight less than 100g , strips compatible with above hba1c glycated haemoglobin analyzer , reflectance photometry based lipid analyzer for measuring tc, hdl, tg, ldl & tc / hdl ratio and inbuilt bluetooth for wireless data transfer , strips compatible with above lipid analyzer , auto disable / safety lancet (28g) with ec declaration of conformity / usfda & iso 13485:2016 , nt probnp rapid card , vitamin d rapid card , troponin i rapid card , troponin t rapid card , point of care device for hemoglobinopathies (sickle cell &? thalassemia) testing , point of care rapid test kit for sickle cell anaemia and beta thalassemia screening compatible with above device , portable automated abrneonatal hearing screeningdevice : based onbrainstem evoked response audiometry (bera) method batteryoperated device high sensitivity and specificity (more than 97%) test time: less than 5 minutes usb port and wi fi enabled non invasive and easy to use easy interpretable report: pass, refer and redo as the result validated and recommended by icmr (indian council of medical research) & department of health research (dhr) ministry of health,government of india...

Health Department - Jharkhand

39466638 supply for medicine , medicine name , cap. amoxyclilline 250 mg , cap. omeprazole20mg , cap. ampicillin 500 , cap. amoxcline 500 mg , cap. dapin 10mg , cap. dapin 5 mg , cap. amoxcyclline 500mg+ cloxacline500mg , cap.multivitamin , cap. amoxycilline ( 250 mg ) + cloxacilline ( 250mg ) , cap. ampicilline 500mg , cap. cefalamine ( 250 mg ) , cap. cephalamine ( 500 mg ) , cap. cephalexin 250 mg , cap. cephalexine ( 250 mg ) , cap. cephalexine ( 500mg ) , cap. cholicalciferol 2000iu , cap. cholicalciferol 30000iu , cap. cloxacillin 250 mg , cap. cloxacillin 500mg , cap. depin ( 10 mg ) , cap. depin ( 5 mg ) , cap. doxycycline ( 100 mg ) , cap. griseofulvin 250mg , cap. omeprazole ( 10mg ) , cap. omeprazole ( 20mg ) , cap. vitamin a 200000 iu , cap.omeprazole20 mg , cap.pantoprazole + donperidone , tab. ciprofloxacine 250mg , tab. diclofenac sodium 75 mg , tab. drotaverine 40mg , tab. etophylline + theophylline 150mg sr , tab. ibuprofen 200mg , tab. ofloxacin 200 mg , tab. ofloxacin + orindazole , tab. vitamin b complex , tab. pcm 500mg , tab. pcm 650 mg , tab. amoxycilline + clavulanic acid 375 mg , tab. cefixime 500 mg , tab. azithromycine 250 mg , tab. azithromycine 500 mg , tab. meteronidazole 200 mg , tab. meteronidazole 400 mg , tab. co trimoxazole ss tablets 80 / 400mg , tab. co trimoxazole ds 800mg / 160mg tablet , tab. ciprofloxacin250 mg , tab. ciprofloxacin 500 mg , tab. ranitidine + domporidom 150mg , tab. aceelofanac 100 mg + pcm 325mg , tab. ranitidine + domporidom 300 mg , tab. fluconazole 150 mg , tab. fluconazole 400 mg , tab. glimepiride 2 mg , tab. levocetrizine 5mg , tab. misoprost 200mg , tab. carbamazepine 200mg , tab. clomipramina 25 mg , tab. clonazepam0.5mg , tab. haloperidol 5mg , tab. olanzapine 7.5mg , tab. fluoxetine 10mg , tab. lorazepam 2 mg , tab. escitalopam 5 mg , tab. phenytoin sodium 100mg , tab. rispridone 2mg , tab. rispridone 4mg , tab. lithiumcarbonate 300mg , tab. sodium valproate 200mg , tab. sodium valproate 500mg , tab. donepezil 5mg , tab. zolpidem 10mg , tab. amitriptyline 25mg , tab. chloroquine 250 mg , tab. primaquine 2.5 mg , tab. primaquine 7.5 mg , tab. fluconazole 400mg , tab. fluconazole 200 mg , tab. dexamethasone , tab. thyroxine sodium 100mg , tab. thyroxine sodium 50 mg , tab. limcee , tab. calcium d3 , tab. fluoxetine 20 mg , tab. folic acid 5mg , tab. folic acid large , tab. furosemide 40mg , tab. glibenclamide 5mg , tab. glimepride ( 2 mg ) , tab. glyceryl trinitrate 0.5 mg , tab. griseofulvin 250mg , tab. hydrochlorothiazide 12.5 mg , tab. hydrochlorothiazide 25 mg , tab. ibuprofen 400mg , tab. ibuprofen 400mg + paracetamole 325mg , tab. imipramine25mg , tab. ketrolac ( 50 mg ) , tab. labetalol 100mg , tab. lanoxin0.25mg , tab. lasix 40 mg , tab. levitiracetam , tab. levocetrizine 5mg , tab. levofloxacin ( 500mg ) , tab. levofloxacine 250mg , tab. lithium carbonate 300mg , tab. lorazepam 2mg , tab. losartan potassium 50mg. , tab. metformin ( 500 mg ) sr , tab. methyl prednisolone 4mg , tab. methyl prednisolone 8mg , tab. metoclopramide 10mg , tab. metronidazole ( 200mg ) , tab. metronidazole ( 400mg ) , tab. mifepristone 200mg , tab. misoprostol 200?g , tab. naltrex1one , tab. nefedipine 20 mg , tab. nitrocontin ( 2.6 mg ) , tab. norfloxacin 400 mg+ tinidazole 600 mg , tab. ofloxacin100mg. , tab. ofloxacin 200mg , tab. ofloxacin 400mg , tab. ofloxacin 200mg + ornidazole ( 500mg ) , tab. olanzapine 5 mg , tab. olanzapine 10mg , tab. olanzapine 7.5 mg , tab. phenytoin sodium 100 mg , tab.resperidone 1 mg , tab.resperidone 2 mg , tab.resperidone 4 mg , tab. ondansetron ( 4 mg ) , tab. ondansetron ( 8 mg ) , tab. ornidazole 500mg , tab. p.c.m. d.t. ( 250 mg ) , tab. p.c.m. d.t. ( 500 mg ) , tab. p.c.m. d.t. ( 600 mg ) , tab. pantoprazole 40mg , tab. pheniramine maleate 25mg , tab. pheniramine maleate 50mg , tab. primaquine 2.5mg , tab. primaquine 7.5mg , tab. ranitidine ( 150mg ) , tab. risperidone 2mg , tab. risperidone 4mg , tab. roxythromycine 150mg , tab. roxythromycine 300mg , tab. salbutamol 4mg , tab. sorbitrate ( 5 mg ) , tab. stemetil m.d , tab. telmisarten ( 20 mg ) , tab. telmisarten ( 40 mg ) , tab. terbinaffine 250mg , tab. thiamine , tab. tinidazole 500mg , tab. tranaxaemic acid + mefenamic acid , tab. tranexamic acid 250 mg , tab. tranexamic acid 500 mg , tab. trihexyphenidyl 2mg , tab. voglibose ( 2mg ) , tab. voglibose ( 3mg ) , tab. wysolone 10mg , tab. wysolone 20 mg , tab. wysolone 5 mg , tab. zinc sulfate 20mg , tab. zinc sulphate ( 20 mg ) , tab. aceclofenac ( 100 mg ) , tab. acetyl salicylic acid 300mg , tab. aciloc, 150mg. , tab. alprazolam 0.25 mg , tab. aluminium hydroxide+ magnesium hydroxide 400mg , tab. amitriptyline 25 mg , tab. amlodipine ( 10mg ) , tab. amlodipine ( 5mg ) , tab. amoxy 250 mg dt , tab. amoxycilline + clavulanic acid ( 325 mg ) , tab. amoxycilline + clavulanic acid ( 625 mg ) , tab. anaspas , tab. antacid , tab. anti cold , tab. artesunate 100mg , tab. artesunate 200 mg , tab. artesunate 25 mg , tab. artesunate 50 mg , tab. ascorbic acid 500 mg , tab. atenolol ( 50mg ) , tab. avil ( chalpheniramin ( 25 mg ) , tab. bisacodyl5mg , tab. buprenorphine , tab. calcium carbonate 500mg , tab. calcium d3 500mg. , tab. cefadroxyl 250mg , tab. cefadroxyl 500mg , tab. cefixime ( 100mg ) , tab. cefixime ( 200 mg ) , tab. cefixime ( 50 mg ) , tab. cefuroxime axetil250mg , tab. cefuroxime axetil500 mg , tab. cepodoxime proxetil , tab. cetrizine 10mg. , tab. chloroquine 300mg , tab. chloroquine phosphate 150 mg , tab. chromostat , tab. cipro 500mg + tz 600mg , tab. ciprofloxacin hydrochloride 250mg , tab. ciprofloxacin hydrochloride 500mg , tab. ciprofloxacine ( 250mg ) , tab. ciprofloxacine ( 500 mg ) , tab. clobazam , tab. clomipramine 25mg , tab. clonazepam 0.5 mg , tab. compose , tab. co trimoxazole ( trimethoprim 80mg + sulphamethoxazole 400mg ) , tab. co trimoxazole ds , tab. co trimoxazole ss , tab. deriphylline 150 mg , tab. deriphylline 300 mg , tab. diamox 250 mg , tab. diazepam ( 2 mg ) , tab. diazepam ( 5 mg ) , tab. diclofenac sodium 100 mg , tab. diclofenac sodium 50 mg , tab. dicolofenc + paracetamol , tab. dicyclomine , tab. dicyclomine + paracetamol , tab. dicyclomine hydrochloride 10 mg , tab. diethylcarbamazine citrate 100 mg , tab. dilantoin sodium ( 100 mg ) , tab. domperidone 10mg , tab. doxycycline ( 100 mg ) , tab. drotaverine ( 40 mg ) , tab. ecospirin ( 75 mg ) , tab. escitalopram 5 mg , tab. escitalopram 10 mg , tab. carbamezapine 25 mg , tab. etophylline + theophylline 100 mg ( 77+23 mg ) , tab. etophylline + theophylline 150 mg sr , tab. etophylline + theophylline 300 mg sr , tab. famotidine ( 40 mg ) , tab. famotidine 20 mg. , tab.hyoscinebutylbromide10 mg , tab. ascorbic acid ( vitamin c ) 100 mg , tab. calcium carbonate 500 mg , tab. cholecalciferol 30000 iu , tab. furosemide40 mg , tab. salbutamol 2 mg , tab. glimepiride 2 mg , tab. metformin 500 mg , tab. misoprostol 200 mcg ( should be use with caution ) , tab. dicyclomine hydrochloride 10 mg , tab. aluminium hydroxide+ magnesium hydroxide 400 , tab. ondansetron4 mg , tab.domperidone 10mg , tab. amlodipine 10 mg , tab.amlodipine 5 mg , tab.enalapril5 mg , tab.telmisartan 40 mg , tab.atorvastatin 10 mg , tab.alprazolam 0.25 mg , tab. paracetamol250 mg, , tab. levocetirizine 5 mg , tab. amitriptyline ( 10 mg ) , tab. amitriptyline ( 25 mg ) , tab. acyclovir ( 200 ) mg , tab. acyclovir ( 400 ) mg , tab. acyclovir ( 800 ) mg , tab. anticold , tab. albendazole ( 400mg ) , tab. amoxicillin dispersible tablet 250 mg , tab. diazepam5 mg , tab. clot , tab. digoxin . ( 0.25 mg ) , tab.ifa ( l ) , 100mg elemental iron + 500 mcg folic acid ( red & blue ) , tab.ifa tab. ( s ) , 30mg elemental iron + 250mcg , tab.folic acid ( 5 mg ) , tab.glyceryl trinitrate sublingual ( 0.5mg ) , tab.glimepride ( 1mg ) , tab.glimepride ( 2mg ) , tab.glimepride ( 3mg ) , tab.glimepride ( 4mg ) , tab.levofloxacin ( 500 mg ) , tab.montelucast + levocetrizine ( 10mg + 5 mg ) , inj. amikacine 20 mg , inj. amikacine 40 mg , inj. amikacine 80 mg , inj. amikacine 100mg , inj. b complex amp , inj. dicyclomine hydrochloride 10 mg 2ml , inj. ondasetron4mg , inj. vitamin k1 1mg / 0.5 ml , inj. tramadol , inj. certriaxone 1gm + sulbactum 500mg , inj. ceftriaxone 1gm , inj. ranitidine amp , inj. ondem , inj. oxytocin , inj. tranexa , inj. prostodin , inj. methergine , xylocaine 2% jelly , inj. xylocaine 2% , inj. vitamin k1 , inj. a.r.v multi dose , inj. antisnake venum , metron iv 100ml , n.s 500 ml , d.n.s500ml , 5% dextrose , 10% dextrose , mannitol 100ml , inj. fluphenazine decanate 25mg / 5ml , inj. haloperidol l.a , inj. lorazepam 2mg , inj. promethazine 25mg , inj. e mall , inj. clot , inj. ceftriaxone ( 125g ) , inj.ceftriaxone ( 250g ) , inj.ceftriaxone ( 500g ) , inj.ceftriaxone vial 1 g , inj.cefotaxime ( 125 g ) , inj.cefotaxime ( 250 g ) , inj.cefotaxime ( 500 g ) , inj.cefotaxime ( 1 g ) , inj.ceftriaxone + salbectum ( 375mg ) , inj.ceftriaxone + salbectum ( 750mg ) , inj.ceftriaxone + salbectum ( 1.5g ) , inj.cefoperazone + salbectum ( 500mg + 500mg ) , inj.cefoperazone + salbectum ( 1000mg + 500mg ) , inj.cefepime ( 1g ) , inj.calcium gluconate ( 10 ml ) , inj.dizepam inj. ( 2ml ) 5mg / ml , inj.t.t inj ( 0.5 ml ) , inj.t.t inj ( 5 ml ) , inj. netromycin 10 mg , inj. netromycin 25 mg , inj. norad 2mg , inj. ondansetron ( 4 mg ) , inj. ondansetron ( 8 mg ) , inj. ondem 2mg , inj. ondem 4mg , inj. ondensetron ampl , inj. oxytocin ampl , inj. pam , inj. pantoprazole with watervial ( 40 mg ) , inj. perinorm ampl , inj. phenargan ampl , inj. phenobarbitone , inj. phenraminemaleate ampl , inj. phenytoinampl , inj. pilocarpine , inj. propofol , inj. prostadin , inj. ranitidine ampl , inj. sensrocain ( 30 ml ) vial , inj. sodium bicarbonate ampl , inj. sodium chloride ampl , inj. termin , inj. tetvac ampl. , inj. tetvac vial , inj. theophyillin + ethophyillin ampl , inj. thiamine , inj. tramadol ampl / vial , inj. vitamin k1 1 mg / 0.5 ml ( phytonadione ) , inj. xylocaine 2% ( plain ) , inj. xylocard 2 % , inj anti d , inj. a.r.v. ( anti rabies ) single dose , inj. adrenaline ampl , inj. amikacin ( 250mg ) vial , inj. amikacin ( 500mg ) vial , inj. amikacine ( 100mg ) , inj. amino phylline ampl , inj. ampicilin 250mg vial , inj. ampicilin 75 mg vial , inj. ampicillin500mg vial , inj. anafortan 2ml , inj. anamin , inj. anaspas , inj. anawin heavy , inj. anawin plain , inj. antitetanus human immunoglobulin , inj. arteether 2ml 50mg , inj. artesunate 1ml 60 mg , inj. atropin ( ampoule ) ampl , inj. avil ampl , inj. b complex amp , inj. botropase , inj. butodol , inj. caffeine , inj. calcium gluconate amp , inj. cefoperazone ( 1 gm. ) with watervial , inj. cefotaxime with water ( 1 gram ) , inj. cefotaxime with water ( 125 mg ) , inj. cefotaxime with water ( 500 mg ) , inj. ceftriaxone + salbatum with water ( 1.5 gram ) , inj. ceftriaxone 250mg with water vial , inj. ceftriaxone 500mg with water vial , inj. ceftriaxone inj 1gram with watervial , inj. chlorpheniramine , inj. chromostat amp , inj. citicholine , inj. compose 2ml , inj. deriphylin , inj. dexamethasonevial , inj. dexamethasone sodium phosphate 2ml / 4mg , inj. diazepam ( 5 mg ) 2ml , inj. diclofenac aqua ( 1 ml ) , inj. diclofenacc sodium 2ml ampl , inj. dicyclomine ampl , inj. dilantin sodium100 mg , inj. dizepam , inj. dobutamine , inj. dopamine ampl , inj. drotaverine , inj. e mal , inj. efcorlin 50mg , inj. endpoprost inj , inj. epitrate , inj. etophylline + theophylline 220mg ( 169.4+50.6 mg ) , inj. fluconazole 100ml , inj. fortwin ampl , inj. furosemide 2ml , inj. fusemide vial , inj. gardinal , inj. gentamicin 10 mg , inj. gentamicin 40 mg , inj. gentamycine 20 mg. vial , inj. gentamycine 80 mg. vial , inj. glycopyrrolate , inj. haloperidol 5mg , inj. hemsyl , inj. hydro cortisone , inj. hydrocort 100mg , inj. hynidase , inj. hyprosol 5ml , inj. i.v. ciprofloxacine , inj. immunoglobin ampl , inj. insulin primixed ( 30 / 70 ) , inj. iron sucrose , inj. kcl , inj. ketamin ( 2ml ) ampl , inj. ketamin inj. ( 10ml vail ) , inj. ketorolac ( 1 ml ) , inj. k nate ( phytomenadione ) 1ml , inj. labatalol , inj. lasix ampl , inj. levipil , inj. levitiracetam , inj. lignocaine adrenaline , inj. magnesium sulphate ampl , inj. megazid xp , inj. mephentermine , inj. meropenam 1gm , inj. meropenam 250 mg , inj. meropenem 125 mg , inj. methergin , inj. methyl ergometrine ampl , inj. metochlopramide ampl , inj. metoclopramide 10mg , inj. midazolam , inj. moxifloxacin , inj. multivitamin ampl , inj. nacphin 10 mg , inj. naloxone , inj. neostigmine ampl , inj. vitamin k1 mg / .5ml , inj.hydrocortisone succinate 100 mg , inj. adrenaline1mg / ml , inj.atropine1 mg / ml , inj.magnesium sulphate ( 50% solution ) , 2 ml ampoule , inj. diclofenac 25 mg / ml , water for injection 5ml , cough syrup child , cough syrup adult , antacide syrup 200ml , phenergan syrup 100ml , normate syrup , meteronidazole syrup 30ml , paracetamol syrup 125 mg / 5 ml , cough syrup child , ofloxacin syp ( 30 ml ) , ofloxacin + metronidazolesyp ( 30 ml ) , paracetamol syp ( 60 ml ) , vitamin b – complex syp ( 100 ml ) , enzyme syp ( 100 ml ) , levocetrizine syp ( 30 ml ) , montelucast + levocetrizine syp ( 30 m1 ) , multivitamin syp ( 100 ml ) , ondastiron syp , levipil syrup , anticold syp ( 60ml ) , amoxicillin dry syrup ( 30 ml ) , amoxicillin dry syrup ( 60 ml ) , amoxixillin + clavulinic acid syp ( 30 ml ) , cefixime dry syp ( 30 ml ) , cetrizine syp ( 30 ml ) , cough expectorant ( 100 ml ) , cough expectorant ( 60 ml ) , vitamin a syp ( 100000iu / ml ) , ofloxacin syp 30 ml , vitamin a syp ( 100ml ) 2 mg / 5ml , vitamin b complex syp ( 100 ml ) , ofloxacin + ornidazole syp ( 30 ml ) , ofloxacin + metronidazolesyp ( 30 ml ) , paracetamol syp ( 60 ml ) 125mg / 5 ml , paracetamol syp ( 60 ml ) 250mg / 5 ml , phenobarbitone syp ( 100 ml ) , domperadone syp. 30 ml , levocetrizine syp. 30 ml ( 2.5 mg / 5ml ) , montelukast + levocetrizine syp ( 30 ml ) ( 4 mg + 2.5 mg / 5 ml ) , metronidazole syp ( 60 ml ) 100mg / 5ml , metronidazole syp ( 60 ml ) 200mg / 5ml , multivitamin syp 100ml , iron & folic acid syp 100 ml ( ferroussalt ) , ciprofloxacin eye drop ( 5ml ) , gentamicin eye drop ( 5 ml ) , moxyfloxacine + dexamethasone eye drop ( 10 ml ) , ciprofloxacine eye / ear drop 10ml , moxifloxacin eye drop , eye drop chloramphenicol 5ml 0.50% ( 5 ml ) , eye drop occumox – p ( moxifloxacin + prednesolone ) ( 5 ml ) , eye drop ofloxacin + dexamethasone , eye drop, flurbiprofen plus ( 5 ml ) , eye drop, ofloxacin / moxifloxacin ( 5 ml ) , eye drop, tropicacyl plus ( 5 ml ) , ciprofloxacin eye drop ( 5ml ) , clotrimazole and lidocain ear drop ( 10ml ) , domperadone drop 10ml , gentamicin eye drop 5 ml , moxyfloxacine + dexamethasone eye ( 10ml ) , eye drop , ofloxacin / moxifloxacin 5ml , ear drop ( ciproflaxacine ) , wax ear drop , ciprofloxacin eye / eardrops 10ml , ear wax solvent drops ( combination of benzocaine, chlorbutol, paradichlorobenzene and turpentine oil ) , methylcellulose eye drops , multivitamin drop ( 15 ml ) , vitamin d drop , noscapine drop1.83 mg / ml , ofloxacin + dexamethasone ear drops , multivitamin drop , nasal normal saline drop ( 10 ml ) , iron drop , anticol drop ( 10 ml ) , paracetamol drop ( 60 ml ) 100mg / ml , ondansetron drop 10 ml , multivitamin drop 15 ml , susp levosalbutamol ambroxol , susp. albendazole 400mg 10ml , susp. amoxycilline 60ml , susp. antacid 170 ml , susp. antacid 200 ml , susp. azithromycin ( 200 mg ) 30 ml , susp. bromhexine hydrochloride 4mg / 5ml , susp. calciumcarbonate +vitamin d3 calcium 250 mg+vit d3 125 iu / 5 ml , susp. cefixime 50mg 30ml , susp. cephalexin 125ml / 30ml , susp. cetrizine 30ml , susp. co trimoxazole ( trimethoprim 40mg+ sulphamethoxazole 200mg ) 100 ml , susp. co trimoxazole 50ml , susp. cough syrup child , susp. dexchlorpheniramine maleate 0.5 mg / 5ml , susp. digene , susp. domperidone ( 30ml ) , susp. ibuprofen 100mg / 5ml , susp. iron folic acid 200ml , susp. levitiracetam , susp. levocetrizine , susp. methadone , susp. metronidazole 30ml , susp. montelukast , susp. ofloxacin + metronidazole 30 ml , susp. paracetamol 125mg 60ml , susp. pheniramine maleate 15 mg / 5ml , susp. phenobarbitone , susp. salbutamol sulphate 100ml , susp. vitamin a 100000 iu / ml , syusp. clobazam , susp levosalbutamol ambroxol , albendazole suspension ( 10 ml ) , azithromycin suspension ( 15 ml ) , azithromycin suspension ( 15ml ) 200mg / 5ml , bendicts solution 500 ml , betadine oint. , betadine lotion , spirit 1000ml , spirit 500ml , plain slide , lancet , temophos , pyrethrum 2% extract , bti ( polluted & non polluted water ) , jsb i , jsb ii , malathion , savlon , anti fungel skin cream 20 gm , bleaching powder 25kg bag , g.v paint lotion400ml , antifungal medicated soap ( 75gm ) , antiseptic liquid ( 100ml ) , act kit ( adult ) , act kit ( 9 14 years ) , act kit ( 5 8 years ) , actkit ( 1 4 years ) , act kit ( lessthan 1 years ) , atrovastatin ( 5 mg ) , atrovastatin ( 10 mg ) , atrovastatin ( 20 mg ) , cefixime 200mg , paracetamol kid dt ( 125 mg ) , paracetamol ( 250 mg ) , vitamin b complex , vitamin d3 satchet ( 1 gms ) , vitamin b 12 , providine lodione gargle ( 100 ml ) , tooth paste sensodent k 100gm , tooth paste hydent k 100 gm , manitol 20% ( 350 ) , dextrose 5% iv ( 500 ml ) , dextrose10 % iv ( 500 ml ) , ringer lactate inj ( 500 ml ) as per ip , hemacil ( 500 ml ) , antifungal / anti bacterial cream , antifungal / anti bacterial powder , 0.5% bupivacain ( heavy ) , 1% gama benzene hexachloride lotion , 3% nacl 100 ml , 5% lysole , abo & rh ( anti ab&d ) 10 ml , absorbent bandage than 18 m x 90 cm special , absorbent cotton i.p 400gm / roll ( net weight ) , absorbent gauze than 18 m x 90 cm special , adenosine , analgesic cream ( 30 mg tube ) , anti ab sera 30 ml , antifungal skin cream 20 gm , antihuman globulin serum 5 ml , asthalin respules , betadine ointment , betamethasone dipropionate cream , capillary tube , carbolic acid ( 500 gm ) , chloramphenicol eye ointment , chlorhexidine , clindamycin gel 30 gm , clobetasol fusidic acid cream , clotrimazole ear drops , clotrimazole ointment 30 gm , intestinal catgut 1 , intestinal catgut 1 0 , intestinal catgut 2 , intestinal catgut 2 0 , iodine test kit , isolyte p ( 500ml ) , itraconazole cream , iv ciprofloxacine ( 100 ml ) , iv mannitol ( 100ml ) , iv mannitol ( 300ml ) , iv metronidazole ( 100 ml ) , keratome 2.8mm disposable , lam / i gel 01234 , lancet ( 100 pcs ) , leclyete m ( 100 ml ) , leclyete p ( 100ml ) , leishmans stain ( 500 ml ) , lidfast jelly , loperamide , lotion. benzyl benzoate ( 1000 ml ) , lox 2%with adrenaline , luglos iodine solution ( 100 ml ) , luliconazole cream , m.c. lotion400ml , m.p pf / pv card antibody ( 100 pcs ) , m.p pf / pv card antigen ( 100 pcs ) , malaria pf / pv antibody card rapid test ( 50 kits ) , malaria pf / pv antigen card rapid test ( 30 kits ) , malecot catheter different sizes , maleria stain kit jsb ( i ) , maleria stain kit jsb ( il ) , memantine , miconazole ointment 10gm , miconazole ointment 30gm , morphine , n / 10 hydrochloric acid , n / 2 , n / 4 , thiopentone , thrombophob ointment , dextrose 25% ( 100 ml ) , diclofenac gel ( 30 gm ) , dicyclomine hydrochloride + activated semithicone drop 10 ml , diltiazem , edta powder 100gm , edta vial , formalin solution 500ml , fouchet reagent ( 500 ml ) , fradiomycin cream 15 gm , fusidic acid cream , galamantine , gentamicin dexamethasone ear drops , glacial acetic acid ( 500 ml ) , nasal prongs ( neonats ) ( cannula ) , neaomycineoint , neaomycinepowder , neomycin ( 5 mg + 500 iu / g ) 15gm , neospsrin powder 100gm , nitroglycerin , noscapine linct7mg / 5ml , ors adult 21 24 gm pack , ors ( pedartic pack ) , permethrin lotion 5% , phenylephrine , plasma volume expendore 500 ml , povidone iodine lotion 500ml , pregnancy kit ( b.p blaed, glups, corbolic shop, cuard clamp, parnncal sheet, cotton thread , pyromate , rivastigmine , salbutamol inhaler , silver sulfadiazine 1% cream 100gm , silver sulfadiazine 1% cream 20gm , silver sulfadiazine 1% cream 500gm , silverex ointmet ( burning ) ( 20gm ) , silverex ointmet ( burning ) ( 500gm ) , slide dying rack , sodium calcium hypochloride ( 5 litre ) , soframycin cream , sofratulle mesh , specimen collection bottle , spinal needle 25 g , stylet , sulphar powder 100 gm , tramadol , wbc diluting fluid , xylocain jelly 5% , xylocaine jelly2% , xylometazoline nasal drop adult , intravenous paracetamol , parafin liquid 1000 ml , syringe 50ml , t bact ointment , midazolam nasal spray* ( for emergency purpose ) , albendazole oral liquid 400 mg / 10ml , amoxicillin oral liquid 250 mg / 5 ml , norfloxacin 400+tinidazole600 , clotrimazole cream 1%30gm , clotrimazole vaginal tablet , miconazole ointment 30g , lactulose oral liquid 10 g / 15 ml , silver sulphadiazine cream 1% , calamine lotion , potassium permangnate ointment , lotion. benzyl benzoate ( 1000 ml , ethyl alcohol ( denatured ) solution 70% , hydrogen peroxide solution 6% , ear, nose and throat medicines , ispaghula granules / husk / powder ( herbal medicine ) , senna powder ( herbal medicine , budecort respules, , salbutamol respirator solution for use in nebulizer 0.5 mg / ml ( nebulizer essential ) , glucose powder 500 gm , glucose powder 1000 gm , activstart unobiotics with probiotic , enema...

Rajendra Institute Of Medical Science - Jharkhand

39466584 supply of chemical items at rims, ranchi , name of chemical goods , 20*c mini cooler (it should be made up of polycarbonate and non toxic gel, must contain atleast 12 places for 1.5ml tube. ) , 0.1 gparacetic acid other ingredients : corrosion inhibitors, surfactants, stabilising agents, excipients. hydrogen peroxide, acetic acid passes en 13624, en 13727, en 14348, en 14347, en 14476 standards, pack size: 5 litre jar , 0.5 % w/v chlorhexidine gluconate and 70 % v/v ethanol , 1% w/v available iodine in nonoxynol iodine surfactant500 ml , 1*tae buffer , 1,4 dithiotreytol (dtt) ()solid (powder) 25 gm , 100 g of gigazyme x tra contains: 7.7 g didecyldimethylammonium chloride, 0.4 g of polyhexamethylene biguanide (monomer: 1,5 bis(trimethylen) guanylguanidinium monohydro chloride) (phmb) contains subtilisin tridecylpolyethylenglycolether propan 2 ol, glycerol passes en 13624, en 13727, en 14561 and en 14562 standards, pack size: 2 litre bottle , 2* ab enzymatic reaction stop solution h2so4 paraformaldehyde glutaraldehyde solution,25% w/w 1 gm , 2.45% w/v glutaral dehyde with a powder activator completely free of surfactants 5ltrs , 20 40% phosphoric acid based scale remover ltr. , 2 mercaptoethanol (? me) liquid 100 ml , 2 methoxy ethanol (250mg) (purity (gc) > 99.75 %) , 2 propanol ip: 45 g / isopropanol, 1 propanol: 30 g /n propanol ethyl hexadecyl dimethyl ammonium ethylsulphate: 0.2 g emollient and moisturiser with skin protecting substances 500 ml bott with dispenser passes en 13727, en13624, en14476, en1500, en12791 standards, pack size: 500 ml bottle , 4 methylumbelliferone (100gm)(purity (hplc) =98 %, mol. wt 198.2) , 4 methylumbelliferyl ? d glucopyranoside (25mg)(to be used in prenatal diagnosis, analytical grade) , 4 methylumbelliferyl ? d galactopyranoside (1gm )(=99% (tlc)) , 4 methylumbelliferyl ? d galactopyranoside 6 sulfate sodium salt (5gm) (hplc purified, =90%) , 4 methylumbelliferyl 6 sulfo n acetyl ? d glucosaminide, potassium salt (25mg) (to be used in prenatal diagnosis, analytical grade) , 4mu beta d glucopyranoside (250mg)(purity (hplc) > 99 %) , 4 mu alpha d gluco pyronoside (100mg) (purity (tlc) > 99 %) , 50x tae 500 ml , 60%v/v ethyl alcohal with benzalkonium chloride, glycerine, dimethiconecyclopentasiloxane, c12 15 alkyl lactate, proylene glycol, methylparaben, phenoxythanol, stearyl alcohol, aminomethyl propanol, diazolidinyl propanol,diazolidinyl aurea with moisturizer 500 ml , 6 mercaptohexanoic acid (1gm)(laboratort reagent grade, 90.0%) , 7 colour setup 1000 pcs , a.s.o. titre (rapid test kit) 100 test , absolute acid 500 ml , absolute alcohol 2.5 ltrs should be 99.9 % boiling point = 78.3°c ( 1013 hpa) melting point = 117°c density = 0.7895 gm/cm3 ( 20°c ) flash point = 12°c ( closed cup ) ethanol content percent by volume at 15.6°c = 99.50 alkalinity = nil acidity as acetic acid percent by weight = max. 0.006 ( 60 ppm) residue on evaporation percent by weight = max. 0.005 ( 50 ppm ) copper as gm/100ml = max. 0.0004 ( 4 ppm ) ester as ethyl acetate gm/100ml = max. 0.02 ( 200 ppm ) aldehyde as acetaldehyde gm/100ml = max. 0.01 ( 1000 ppm ) , absolute alcohol 500 ml , ace control level 1 100 ml , acetamide agar 500 gm , acetic acid 500ml ( laboratory chemical ) only for industrial, institutional and research purposes, not for drug , acetic acid 2.5 ltrs , acetic acid 200 ml , acetic acid 250 ml , acetone 25 ml , acetone 5 l mol. wt. = 58.08 gm/mol density = 0.7845 gm/cm3 melting point = 94.7°c boiling point = 50.05°c smell = fruity , acetone 500 ml , acetonitrile (ico grade) liquid 100 ml , acid based liquid neutralizer concentrate to be used with dosing pump.nos. , acid fuchsin 1% 100 ml , acid fuchsin solid (powder) 25 gm , acid glycoprotein 100 gm , acid orthophoaphoric 500 ml , acid phosphatase 10x2ml , acp 100 ml , acrylic cold curve liquid 500 ml , acrylic cold curve powder 250 gm , acrylic colours 500ml a. black b. dark green c. maroon d. ultramarine blue can be used on variety of surfaces. stays permanent on paper earth ware, wood, thermocot, stone etc., wash proof rich in colour value, quick drying and ready to use and requires no separate medium , actidione with agar 500 gm , activated charcol 500 gm , ada control 100 ml (compactible with dirui cst240) , ada enzymetic 25ml , ada with calibrator 100 ml (compactible with dirui cst240) , adenovirus, stool, antigen, premiere adenoclone, ridascreen; r.biopharma , adrenaline hydrochloride 500ml , af media 100ml bottle (ready to use, media should contains fetal bovine serum (fbs), gentamicin, and l glutamine.) , afp 1 ml , afst disc fluconazole amphotericin itraconazole 100 disc , agar powder 500 gm , agarose 500 gm , agarose powder 250gm(to be used for nucleic acid separation, tested dnase and rnase free, high grade) , ahg 5 ml , albert’s stain – a – 250 gm each , albert’s stain – b – 250 gm each , albumin bcg 100 ml , albumin kit 3x150ml , alcian blue 500ml , alcian blue 8gx 100 ml , alcian blue satain ( ph 2.5, 100ml/ pack size) , alcian blue solid (powder) 5 gm , alcohol 90% 2 ltrs , alcohol ethyl 500ml , aliquote cup (centrifuge tab 1.5 ml) 500 pc , alizarin red s 100 ml , alkalian blue 100 ml , alkaline peptone water 25 x 5 ml , alkaline phosphatase kit 20x15ml , alkyl alcohol ethoxilate 20 40%, sodium benzoate, 5% based emulsifier ltr. , alkyl dimethyl benzyl ammonium chloride (in house) (2.37 %) alkyl dimethyl ethyl benzyl ammonium chloride (in house) (2.37 %) inert ingredients (95.26 %) , alkyle dimethyle benzile ammonium chloride (in house) (2.37%) inert ingrediets 95.26% , alp 100 ml , alpha nepthyl butyrate 500 ml , alt (sgpt) 2x150ml , altl/sgpt 2x150 ml , aluminium ammonium sulphate 500 ml , aluminium foil each pack , aluminium potassium sulphate [ potash alum] f. wt. = 474.39 assay nlt = 99.0% ph (10% solution at 20°c) = 3.0 4.0 chloride ( cl ) nmt = 0.0005 ammonia ( nh4 )nmt = 0.005% iron (fe)nmt = 0.005% lead (pb)nmt = 0.0005 % , amacr 1 ml , amdinocillin 10 mcg , amh elisa kit 96 tests , amikacin (antibiotic disc)30mcg (250 disc) , amikacin(antibiotic disc) 10 mcg (250 disc) , ammonia solution 2.5 ltrs about 25% m = 17.03 g/mol ( 1l = 0.90 kg ) specification: assay ( nh3 ) = 25 % non volatile substance = 0.002 % , ammonia solution extrapure ar, 25% liquid 500 ml , ammonium acetate solid (powder) 100 gm , ammonium chloride 500 gm , ammonium citrate – 500 ml , ammonium hydroxide 500 ml , ammonium molybdate 100 gm , ammonium molybdate 500 gm , ammonium oxalate 250gm , ammonium oxalate 500ml , ammonium persulphate, solid (powder) 25 gm , ammonium solution 500 ml , ammonium sulfonate 500g bottle (acs reagent, 99.0 100.5%) , ammonium sulphate 250 gm , ammonium sulphate 500 gm assay = 98.5 % nvm = 0.2 % chloride = 0.005 % iron = 0.002 % lead= 0.002 % 10 % aqueous solution clear and colourless specification: specific rotation ( [ ? ] 20°/d; c = 10 water ) = +51 to +53° melting range = 145°c 150°c chloride = 0.005 % sulphate = 0.01 % sulphites = passes test arsenic = 0.0001 % iron = 0.0005 % heavy metals ( as pb ) = 0.0005 % loss on drying ( 105°c )= 0.5 % sulphated ash = 0.1 % , amoxicillin 10 mcg(antibiotic disc) (250 disc) , amoxicillin 2 mcg + clavulanic acid 1 mcg (antibiotic disc) (250 disc) , amoxicillin 25 mcg(antibiotic disc) (250 disc) , amoxicillin clavulanate disc 20 mcg (antibiotic disc) (250 disc) , amoxycillin clavulanate (antibiotic disc) 10mcg (250 disc) , amphetamines 100 ml , amphotericinb powder (solubilized powder, g irradiated ) 50 gm , amphotericin b (mic e test strip) , ampicillin (antibiotic disc)10 mcg (250 disc) , ampicillin 2 mcg (antibiotic disc) (250 disc) , ampicillin 25 mcg (antibiotic disc) (250 disc) , ampicillin sulbactum(antibiotic disc)10mcg(250 disc) , amulgeum pluger , amyl of isoamy alcohal 500ml , amylase 100 ml , amylase kit 2x30ml , ana screening elisa kit 96 tests , anaerobic indicator strip , ? naphthol 500 gm , andrades indicator 100 ml , anhydrous ammonium bicarbonate anhydrous liquid 500 gm , anhydrous anhydrous aluminum chloride 100 ml , anhydrous anhydrous ferric chloride 30% 100ml , anhydrous anhydrous sodium hydroxide( naoh) pellet 250 gm , anhydrous anhydrous sodium hydroxide( naoh) pellet 500 gm , anhydrous anhydrous sodium phosphate monobasic (nah2po4) 500 gm , anhydrous calcium carbonate anhydrous , anhydrous dextrose anhydrous purified 500 gm specification: specific rotation ( [ ? ] 20°/d; c = 10 water ) = +51 to +53° melting range = 145°c 150°c chloride = 0.005 % sulphate = 0.01 % sulphites = passes test arsenic = 0.0001 % iron = 0.0005 % heavy metals ( as pb ) = 0.0005 % loss on drying ( 105°c )= 0.5 % sulphated ash = 0.1 % should be 99.9 % histopathology grade , anhydrous diethylenediamine anhydrous (piperazine ) , anhydrous di sodium hydrogen phosphate anhydrous , anhydrous lithium chloride anhydrous , anhydrous phenol anhydrous , anhydrous potassium phosphate di basic anhydrous 5 kg [ di potassium hydrogen phosphate anhydrous ] assay nlt = 98.0 % ph ( 5 % aqueous solution ) = 8.5 9.6 maximum limits of impurities • chloride = 0.005 % • loss on drying ( 105°c ) = 1.0 % , anhydrous potassium phosphate di basic anhydrous 500 gm ( di potassium hydrogen phosphate anhydrous ) k2hpo4mol. wt. = 174.17 , anhydrous sodium acetate anhydrous 500 gm , anhydrous sodium carbonate anhydrous 500ml minimum assay ( acidimetric ) after drying = 99.5 % maximum limit of impurities moisture = 1.5 % chloride = 0.01 % silicate = 0.02 % sulphate = 0.02 % lead = 0.03 % , anhydrous sodium phosphate dibasic anhydrous assay nlt = 99.0 % ph ( 5 % aqueous solution ) = 8.7 9.4 maximum limits of impurities • loss on drying ( 105°c ) = 0.5 % • heavy metals ( pb ) = 0.001 % • chloride = 0.01 % , anhydrous sodium sulphate anhydrous 500 gm , anhydrous sodium thiosulphate anhydrous , anhydrous tetra sodium pyrophosphate anhydrous , anidulafungin (mic e test strip) , anidulafungin powder (solubilized powder, g irradiated ) , aniline blue solution 500 gm , anti – a 10 ml , anti – b 10 ml , anti – d 10 ml , antisera for escherichia coli o157:h7 2 ml , anti a1 lactin 10 ml , anti ab serum 10 ml , anti d igm 10 ml , anti d rhofinal 10 ml , anti h lactin 5 ml , anti hcv ab elisa 1 x 96 , anti human globin 5 ml , anti sera for salmonella typhi poly h 2 ml , anti sera for salmonella typhi poly o 2 ml , anti sera for shigella species 2 ml , anti sera for vibrio cholerae classical 2 ml , anti sera for vibrio cholerae eltor 2 ml , anti streptosylin 100 ml , antigen v.d.r.l. 250t , antitrypsin 100 ml , apo cal 5 point 100 ml , apo calibrator 100 ml , apo a 100 ml , apo b 100 ml , apt broth 500 gm , aptt reagent 3ml , aptt reagent 5 ml , aq potassium permanganate 0.25% 100 ml , aqua peg 40 hydrogenated castor oil, glycerin, aroma, sodium gluconate, sucralose, octinidine hcl, citric acid, bht , aqua winth apip 500 ml , aqua, cocanidopropylamine oxide peg 7 glyceryl cocoate, glycerin hydroxyethyl cellolose, lactic acid, octenidine hcl, allantion , aqua, glycerine cocamidopropylamine oxide, sodium lactate, allantion, octenidine hcl ethylhexyl glycerine , aqueous citric acid 0.5% 100 ml , aqueous phenol 5% 500 ml , aqueous silver nitrate 5% 100 ml , aqueous sodium metabisulphite 1% 100 ml , aqueous sulphuric acid (h2so4) 3 % 250 ml , arginine decarboxylase broth , asparagine proline broth , asparagine 100gm , ast (sgot) 100 ml , ast (sgot) kit 2x150ml , ast sensitivity disc 5x250 d , astrovirus,stool, antigen, ridascreen, drg international r.biopharma , atropine 500 ml , atropine sulphur 500 ml , au consumables kit 1 kit , auramine o 1000 ml , auramine o 250 ml , auramine o 500 ml , australia antigen (0.3 ng/ml) 100 test , automated rapid mycobacterium culture differentiation and sensitivity system (liquid culture) , available iodine (1.0 % w/v) in water soluble base (contains sodium iodide and surfactants) ( ) , available iodine (1.0% w/v) and watersoluble base (contain sodium iodide and surfactant) manufacturer / marketing company should be certifying according to din en iso , available iodine 1% w/v in an aqueous <5 sodium iodide, <1 surfactant base, <88 water shelf life of 5 years, pack size: 500 ml bottle , azithromycin (antibiotic disc) 15mcg (250 disc) , azlocillin(antibiotic disc)75mcg (250 disc) , azlocillin 30 mcg (antibiotic disc) (250 disc) , aztreonam (antibiotic disc)30mcg (250 disc) , bacitracin 20 mcg (antibiotic disc) (250 disc) , bacitracin disc (antibiotic disc)16mcg 100 disc , bacterial antigen rapid latex agglutination test for meningitis 100 test , bag autoclavable bags 900g (size 12x24, transparent bags ) , bag autoclavable bags, size s (8x12) (should be high grade plastic, for autoclavable, for laboratory use) , bag autoclavable bags, size l (14x19) (should be high grade plastic, for autoclavable, for laboratory use) , bag b bag double – each , bag b bag paediatric each , bag b bag penta – each , bag b bag quadruple – each , bag b bag triple – each , bag biohazard bag medium (discarding pouch (red – black) sizes 12 x 12 for syringe & needle discarding (100 pieces/pack)) , bag biohazard bag small (discarding pouch (red – black) sizes 8 x 12 for gel & tips discarding) , bag biohazard bags large (autoclaveable) , bag biohazard bags medium (autoclaveable) , bag blood bag single – each , bag sample bags 96w , bag top to bottom each , bag top to top each , bag zip lock bags each , band aid round , baramathymol blue 500 ml , barbitone 500 ml , barbiturates 100 ml , barbituric acid, solid (powder) 25 gm , barium carbonate 500gm , barium chloride 500 gm , barrit reagent a 250 ml , barrit reagent b 250 ml , basic fuchsin 0.15% 500 ml , basic fuchsin 0.5% 500 ml , bd facc lysing solution 1pc , bd facs permebilizing solution 1 pc , b d glucan test for aspergillus each kit , beaker 100 ml , beaker 1000 ml , beaker 250 ml , beaker 500ml each , beaker 2000ml each , beef extract powder 250 gm , beef extract powder 500gm , benedict’s reagent 5l qualitative laboratory reagent for detection of sugar in urine. , benedict’s solution 500ml appearance = clear pale blue liquid odourless melting point = 0°c ( 32°f ) water boiling point = 100°c ( 212°f ) water evaporation rate < 1 vapour pressure ( mmhg ) = 14 water vapour density ( air ) =1 = 0.7 water specific gravity = 1 ( water ) solubility complete , benzalkonium chloride solution ip (0.5 % v/v), equivalent to benzalkonium chloride (0.25 % w/v) , benzidine powder 100 gm , benzidine powder 25 gm , benzidine powder 250 gm , benzidine powder 500gm melting range = 127°c 129°c solubility in ethanol to pass test sulphated ash = max. 0.05 % sulphate to pass test. , benzodiazepines 100 ml , benzoic acid 500 ml , beta mercaptoethanol 200 ml , beta 2 macroglobulin 100 ml , betadine 10% 250 ml , betadine 10% 500 ml , betaxolol 25% , betaxolol 85% , bicarbonatecalibrator 100 ml , bile esculin azide agar 500 gm , bile esculin disc pack of 100 disc , bile esculin powder 250 gm , bile esculin powder 500 gm , bilirubin kit 2x250ml , billirubin d 100 ml , billirubin total 100 ml , biotin 4 amidobenzoic acid sodium salt50mg (purity (tlc) > 95 %, mol wt. 385.4) , bismarck brown 1 kg 100gm glan bottle dye content 50 % solubility = h20 : 10mg/ml clear to turbid red orange to red form = powder grade = certified by biological stain commission quality level = 100 , bismarck brown 25 gm , bismuth sulphite agar , blade blade for cryostat (frozen) , blade cryostat blade for leica – 50 pcs( proprietary item)low profile made of stainless steel with high durability. disposable blades819 80 mm long x 8 mm high x 0.25 mm thick blades , blade microtome blades – 50 pcs ( proprietary item)high profile disposable blades818 stainless steel , bleach hydrogen peroxide of minimum 30% and oxygen based bleaching agent 5 ltr. , bleach sodium hydroxide maximum 5% based bleaching agent 5 ltr. , blood agar base – 250 gm , blood agar base 500 gm , blood free campylobactor agar , blood urea nitrogen 2x150ml , bolton broth (base) , bolton selective supplement , bone marrow aspiration needle – metal,reusable , salah type with component includingtrocar , cannula & adjustable side guard size –no 14 , no – 16 & no – 18 g , 5 cm longneedle , bone marrow biopsy needle ergonomic handle. material : stainless steel remover guide provided with indicators to facilitate the sample expulsion and that allows samples lenght check. provided with a special lock for a safe removal of the sample , boric acid 500 gm , bottle blood culture bottle (conventional) adult each , bottle blood culture bottle 100ml , bottle blood culture bottle 125ml , bottle blood culture bottle 30 ml , bottle blood culture bottle(conventional) pediatrics each , bottle brown bottle reagent 1000 ml , bottle brown bottle reagent 250 ml , bottle brown glass bottles 100 ml , bottle clear glass bottles, volume 1000ml (clear glass bottle with screw cap for laboratory use ) , bottle clear glass bottles, volume 250ml, (clear glass bottle with screw cap for laboratory use ) , bottle clear glass bottles, volume 500ml (clear glass bottle with screw cap for laboratory use ) , bottle clear glass bottles, volume 2000ml (clear glass bottle with screw cap for laboratory use ) , bottle drop bottle each , bottle mc cartney bottle 30ml each , bottle myco f bottle each , bottle reagent bottle – 100 ml (silicate with droper cap – 100 pc) , bottle reagent bottle 1lit , bottle reagent bottle 500ml , bottle reagent bottle 100ml , bottle reagent bottle 250ml , bottle spray bottles each , bottle sprey gun with bottle (500 ml) nos. , bottle sqeeze bottle each , bottle universal bottle 30 ml with screw cork , bottle universal bottle glass withrubber washer and cap 500 pcs , bottle wash bottle 500ml , bottle wash bottle 250ml , bovin serum albumine 10mg (agarose electrophoresis > 96 %cell culture test pass) , bovine albumin 22% 10 ml , box autoclave biological indicator box (geo.atropheus ) 50 x 1 ml , box bowie – dick compact box , box cap box each , box cryo box(1 ml)(each pack 500 vials) , box cryo box 1.8ml box of 04pcs , box cryo boxes (5ml) each , box eto indicator box , box gluffs boxeach , box micro pore box each , box plasma casset box , box slide box , box softner water kit box each , box steam emulating indicator box , box sterilization indicator box , box tip box 0.2 10?l ( 10pcs ) , box tip box 200 1000?l (10pcs ) , box tip box 2 200?l ( 10pcs ) , brain heart infusion agar 250 gm , brain heart infusion agar 500 gm , brain heart infusion broth 250 gm , brain heart infusion broth 500 gm , brain heart infusion broth powder 250gm , brain heart infusion broth powder 500gm , bramathymol blue 125ml , bramathymol blue 500 ml , brilliant cresyl blue solution 100gm , brilliant cresyl blue solution 25gm dark green colour powder absorption maxima = 623 628 specific absorptivity of 1%/1cm ( ?max = 0.005 gm/l ) melting point = 233 236°c , brilliant green bile broth 2% , bromine sample 250 gm , bromo phenol blue 500 ml , bromo phenol blue powder 10 gm , bromothymol blue 125gm , brush cyto brush – material plastic color white packaging type box to minimize trauma , brush test tube brush each , brush washing brush 12” , brush washing brush 6” , buffer saline sodium citrate buffer 500 ml , buffer for seroprotin electrophoresis each , buffer solution hemoglobin 1000 ml , buffered formal acetone 500 ml , buffered peptone water , butane gas , c reactive protein kit (rapid test kit) 100 test , c3control level 1 100 ml (compactible with dirui cst240) , c3with calibrator 100 ml (compactible with dirui cst240) , c3 100 ml , c4control level 2 100 ml (compactible with dirui cst240) , c4 100 ml , c4 with calibrator 100 ml (compactible with dirui cst240) , ca125 1 ml , calamine powder 250 gm , calcium arsennazo111 100 ml , calcium chloride powder 500 ml , calcium choride solution for aptt 10ml , calcium kit 2x150ml , calcium oxide 250 ml , calcium phosphate dibasic dihydrate , calcium sulphate 500 ml , calcium sulphate dihydrate , calcoflour white 100 ml , calcoflour white 25 ml , calcoflour white 50 ml , calibrator ldl ( us ) 100 ml , calponin 1 ml , calretinin 1 ml , candida albicans , candle jar 5 ltr. , carbamezapine 100 ml , carbenicillin 100 mcg (250) , carbo red 500 ml , carbohydrate consumption broth base , carbolfuschin 250 ml , carbol fuschin 500 ml , carbol fuschin 125ml , carbolic acid 500 ml , cardiac controls 5 ml , carmine powder 250 gm , casein 500 ml , caspofungin (mic e test strip) , caspofungin powder (solubilized powder, g irradiated ) , ccda selective supplement , cd 10 10 ml , cd 10 apc 1 pc , cd 10 pe 1 pc , cd 100p , cd 117 1 ml , cd 117 apc 1 pc , cd 13 cy 7 1 pc , cd 15 10 ml , cd 19 1 ml , cd 19 pe cy 7 1 pc , cd 20 1 ml , cd 20 fitc 1 pc , cd 3 1ml , cd 3 cy 5.5 1 pc , cd 3 per cp cy5.5 1 pcs , cd 30 1 ml , cd 31 1 ml , cd 33 pe 1 pc , cd 34 apc 1 pc , cd 34 endothelial cell marker 1 ml , cd 38 c 5.5 , cd 4 pe cy 7 1 pc , cd 45 1 ml , cd 45 apc h7 1 pc , cd 5 1 ml , cd 5 pe 1 pc , cd 56 1 ml , cd 64 fitc 1 pc , cd 7 apc 1 pc , cd 79 a pe 1 pc , cd 8 fit c 1 pc , cd 99 1 ml , cd k4 1 ml , cdna synthesis kit (50 reactions) , cea 1 ml , cedar wood oil –100ml , cedar wood oil 25 ml , cefaclor (antibiotic disc)30mcg(250 disc) , cefadroxyl 30 mcg (antibiotic disc) (250 disc) , cefamandole (antibiotic disc) 30mcg(250 disc) , cefazoline (antibiotic disc)30mcg (250 disc) , cefdiniar 5mcg (antibiotic disc) (250 disc) , cefepime (antibiotic disc) 30 mcg (250 disc) , cefixime 5 mcg (antibiotic disc) (250 disc) , cefmatazole (antibiotic disc) 30mcg (250 disc) , cefoaximen + sulbactam (antibiotic disc) 10 mcg (250 disc) , cefoaximen + sulbactam (antibiotic disc) 30 mcg (250 disc) , cefonicid (antibiotic disc)30 mcg (250 disc) , cefoperazone (antibiotic disc)75 mcg (250 disc) , cefoperazone 30 mcg (antibiotic disc) (250 disc) , cefoperazone salbactum 10mcg (antibiotic disc) (250 disc) , cefotaxime (antibiotic disc)30 mcg (250 disc) , cefotaxime 5 mcg (antibiotic disc) (250 disc) , cefotaxime clavulanic acid (antibiotic disc) 10mcg (250 disc) , cefotaxime clavulanic acid (antibiotic disc) 30 mcg (250 disc) , cefotetam (antibiotic disc)30mcg (250 disc) , cefoxitin(antibiotic disc)30mcg (250 disc) , cefoxitin 10 mcg (antibiotic disc) (250 disc) , cefperazone 75 mcg +sulbactum 30 mcg (antibiotic disc) (250 disc) , cefpodoxime(antibiotic disc)10mcg (250 disc) , cefprozil 30 mcg (antibiotic disc) (250 disc) , cefsulodin 30 mcg (antibiotic disc) (250 disc) , ceftaroline(antibiotic disc)30mcg (250 disc) , ceftazidime 10 mcg (antibiotic disc) (250 disc) , ceftazidime clavulanic acid(antibiotic disc)30mcg (250 disc) , ceftazidime clavulanic acid 10mcg (250 disc) , ceftazidime(antibiotic disc)30mcg(250 disc) , ceftazidime avibactum (antibiotic disc)20 mcg (250 disc) , ceftazidime avibactum (antibiotic disc)30 mcg (250 disc) , ceftiofur 30 mcg (antibiotic disc) (250 disc) , ceftizoxime(antibiotic disc)30mcg (250 disc) , ceftriaxone (antibiotic disc) 30mcg ( 250 dics) , ceftriaxone + sulbactam (antibiotic disc) 10 mcg ( 250 dics) , ceftriaxone + sulbactam (antibiotic disc) 30 mcg ( 250 dics) , ceftriaxone 30mcg+ sulbactam 15mcg+ edta 100mcg(antibiotic disc) ( 250 dics) , cefuroxime (antibiotic disc)30 mcg ( 250 dics) , cefuroxime 5 mcg (antibiotic disc) (250 disc) , cell clean 50 ml , cell pack 20 ltrs , cellulose acetate strip 25 x 130 , cellulose acetate strip 57 x 130 , cellulose powder , cephalexin 30 mcg (250 disc) , cephalothin(antibiotic disc) 30mcg ( 250 dics) , cephradine 30 mcg (antibiotic disc) (250 disc) , cepodoxime (antibiotic disc) p. size 5 x 250 , c erb2 onco proton her2neu 3 ml , cerbenicillin (antibiotic disc) p. size 5x 250 , ceruloplasmin 100 ml , cetrimide agar , chamber dark humidity chamber , chamber multipurpose staining chamber body yype – plastic size – 46x25x4 cm slide capacity – 24 , chamber neubuers chamber with silver lining each , chaps (cholamidopropyl)dimethylammonio] 1 propanesulphonate}) , charcol , chart marker pen each , chemical indicators class6 steam strips , chemistry controls (more than 30 parameters) 5 ml , chikungunya igm elisa kit ( 1 x 96) , chikungunya igm, igg rapid kit single , chloramphenicol (antibiotic disc)30 mcg (250 disc) , chloramphenicol 10 mcg (antibiotic disc) (250 disc) , chloramphenicol yeast extract glucose agar , chlorhexidine gluconate and cetrimide antiseptic 500 ml (equivalent tosavlon) , chlorhexidine gluconate and cetrimide antiseptic lotion pack 1l (like savlon) , chlorhexidine gluconate solution ip 10% v/v equivalent to chlorhexidine gluconate2% w/v ethanol ip 70% v/v 500 ml , chlorhexidine gluconate solution ip 20 % v/v, (equivalent to chlorhexidine gluconate 4 % w/v) , with isopropanol<10%, ethoxylated alkylphenol<10%, fatty acid diethanolamide<10%, acetic acid glacial<1%, cellulose and fragrance<10% emollient & moisturising agents passes en 1499 standards, pack size: 500 ml bottle , chloroform 1000ml (molecular bio use only, molecular weight 119.38) , chloroform 200 ml , chloroform 2.5 ltrs , chlorophenol red 500 ml , chloroxylenol 4.8 % w/v(equivalent todettol) 1 ltr , chocolate agar plate , cholesterol hi co 100 ml , cholesterol kit 2x250ml , cholinesterase 24 ml , chopping board – each( grossing boards ) features measurement guides printed onto board made of heavy duty, stain resistant, thick polyethylene will not dull fine surgical blades features a drain groove, carved into the edge to contain fluids durable design will make the board last for years, without changing shape, bending, or swelling , christensen’s urea , chrom agar 500 gm , chromium (iii) chloride hexahydrate , chromium oxide 5% 100ml , chromogenic agar listeria (listeria ottaviani agosti agar base) , chromogenic carbapenem resistant gram negative bacterial screening agar , chromogenic colistin resistant gram negative bacterial screening agar , chromogenic esbl producing gram negative bacterial screening agar , chromogranin a 1 ml , cinoxacin(antibiotic disc)100 mcg (250 disc) , ciprofloxacin (antibiotic disc)5 mcg (250 disc) , ciprofloxacin 1 mcg (antibiotic disc) (250 disc) , circular chart recorder each , citric acid (c6h8o7) 500 ml , ck –mb kit 75 ml , ck mb with calibrator 100 ml (compactible with dirui cst240) , ck 20 1 ml , ck 5 / ck 6 1 ml , ck 7 1ml , ck mb calibrator 100 ml , ck nac 100 ml (compactible with dirui cst240) , clarithromycin (antibiotic disc) 15 mcg (250 disc) , clarithromycin 2 mcg (antibiotic disc) (250 disc) , cleaning & disinfecting sol ( like lysol) 5 ltrs , cleaning solution 1 kit , cled cystine lactose electrolyte deficient (cled) agar 500 gm , clindamaycin (antibiotic disc)2 mcg (250 disc) , cloxacillin 1 mcg (antibiotic disc) (250 disc) , cmpo fitc 1 pc , cmv igg elisa 1 x 96 (1 pack) , cmv igm elisa 1 x 96 (1 pack) , coagulas plasma , cocaine 100 ml , colchicine powder , colcimed 5 mg , coliform agar , colistin 10 mcg (250 disc) , colistin 25 mcg (250 disc) , colistin disc(antibiotic disc )( 1x100) each , colistin sulphate salt powder1 gm , combistrix 100 t , complete haemacytometer set (neubeur blood counting chamber brightlined) number of memory sticks ?1 item weight ?100 g package dimensions ?5 x 3 x 1 cm; 100 grams country of origin ?germany , congo red 100 ml , container autoclavable biohazards waste container large , container autoclavable biohazards waste container medium , container microtube container 1000ml(it should be madeup of medical grade polypropylene or polycarbonate, confirming to us fda code of federal regulations title 21, and should be autoclavable) , container microtube container 500ml (it should be madeup of medical grade polypropylene or polycarbonate, confirming to us fda code of federal regulations title 21, and should be autoclavable) , contains subtilisin tridecylpolyethylenglycolether propan 2 ol, glycerol passes en 13624, en 13727, en 14561 and en 14562 standards, pack size: 2 litre bottle , cooked meat broth , coomassie brilliant blue g250 , coomassie brilliant blue r250 , coplin jar –made of polypropylene microwave safe can hold 10 slides (slide size: 25 x 75 x 1.0mm) & 50 slides interior is grooved to hold slides vertically domed and shallow thread screw cap , coplin jar plastic , copper acetate 500 gm , copper sulphate crystal 500 gm , corn meal agar 500 gm , cotrimoxazole(antibiotic disc)1.25 mcg (250 disc) , cotrimoxazole(antibiotic disc)23.75mcg (250 disc) , cotton tip applicator , covid 19 igg , cpk kit 2x75ml , creatinine 100 ml , creatinine enzymatic 100 ml (compactible with dirui cst240) , creatinine kinase (ck – nac) 100 ml , creatinine kinase (ck) kit 2x75ml , creatinine kit 2x500ml , creatinine powder 25 gm , creatinine zinc chloride 500 gm , cresyl blue powder 250 gm , cronobacter isolation agar , cronobacter sakazakii , cronobactor selective broth , crplatex high sensitative calibrator 100 ml , crplatex normal calibrator 100 ml , crp 100 ml , crp quantitative 100 ml (compactible with dirui cst240) , crp quantitative (range 0 100) 100 ml (compactible with dirui cst240) , crp reagent (rapid test kit) 100 test , crp latex , cryo globes large – 100 pc , cryo globes medium – 100 pc , cryo globes small – 100 pc , cryo tags each , cryptococcal latex agglutination test 50 tests , crystal blue powder 500 gm , crystal sulphate 125ml , crystal sulphate 500 ml , crystal violet , crystallin phenol powder 250 gm , crystalline phenol powder 500 gm , ctla 4 (monoclonal ab) 100ug , ctla 4 (polyclonal ab) 200ul (0.5 1.5 ug/ul) , cuprous chloride (cu ii chloride) , cylinder glass measuring cylinder 250 ml , cylinder glass measuring cylinders 100ml , cylinder glass measuring cylinders 1000ml , cylinder glass measuring cylinders 2000 ml , cylinder glass measuring cylinders 25ml (it should be madeup of polymethylpentene, confirming to us fda code of federal regulations title 21, and should be autoclavable) , cylinder glass measuring cylinders 500ml , cylinder glass measuring cylinders 50ml , cystatin 1 ml , cyto fix 125 ml , cytomegalovirus, serum, igm, biorad, drg international , dapi 10 mg , dapi dihydrochloride (4,6 diamidino 2 phenylindole dihydrochloride) , d biotin , dca media 250 gm , dca media 500 gm , d dimer 100 ml , d dimer control level 1 100 ml (compactible with dirui cst240) , d dimer control level 2 100 ml (compactible with dirui cst240) , d dimer with calibrator 100 ml (compactible with dirui cst240) , decarboxylase base 500 gm , decotrorising reagent destainer (german) electrophoresis each , dengue igg elisa , dengue igm elisa 1 x 96 , dengue ns1 elisa 1 x 96 , dengue nsi igm, igg, rapid kit 50 tests , dental cement 1 kg , deoxycholate citrate agar , deproteinising solution 1000ml , desmin 1 ml , destainer & clearing solution 500 ml , d gluconic acid , di sodium hydrogen phosphate dihydrate purified 500 gm , di sodium hydrogen phosphate dihydrate purified 250 gm , diaectyl monoxime 25 gm , diamond pencil marker 50 in no.(used for marking slide or test tube etc.diamond pencil for writing information onto histological and cytological slides.suitable for most laboratory glass surface, metal and ceramic. thin diamond tip for a perfect writing.) , diastic 100 t , dichloro phenol 2 6 – 10 gm , dichloro phenol indo phenols 2 6 – 10 gm , diethyl ether (hplc grade) 500 ml , differential reinforced clostridial broth (drcm) , digitoxin ( tdm calibrator ) 100 ml , digoxin 100 ml , dimethyl sulfoxide (dmso) , di potassium hydrogen ortho phosphate (k2hpo4) 500 gm , dipotassium hydrogen phosphate 500 gm , disinfectant 100 g of granules contain the following active ingredients: 43 g sodium per carbonate, 22 g tetraacetylethylenediamine. passes en 13624, en 13727, en 14348, en 14561, en 14562, en 14563, en 13704 and en 14476 standards, pack size: 1.5 kg box , disinfectant chlorhexidine gluconate solution ip 20 % v/v, equivalent to chlorhexidine gluconate 4.0 % w/v 1) en 13624 yeasticidal 2) en 13727 bactericidal500 ml , disinfectant ortho – phthalaldehyde 0.55% w/wwith test strip & deactivator quantitative suspension test for the evaluation of mycobactericidal activity of chemical disinfectants in the medical area including instrument disinfectants test method and requirements (phase 2/step1) , disinfectant ortho phthalaldehyde – 0.55% non corrosive, high level instrument disinfectant surfactant free, pack size: 5 litre jar , disinfectant polymeric biguanide hydrochloride (in house) (< 10 %) alkyl dimethyl benzyl ammonium chloride & didecyl dimethyl ammonium chloride) (in house) (< 10 %) quantitative non porous surface test for the evaluation of bactericidal and/or fungicidal activity of chemical disinfectants , disinfectant sodium parborate monohydrate in house 50% w/w quantitative suspension test for the evolution of sporicidal activity of chemical disinfectant of used in food industrial domestic & institutional , disinfectant sodium perborate monohydrate (in house) (50 % w/w) quantitative suspension test for the evaluation of sporicidal activity of chemical disinfectants used in food, industrial, domestic and institutional areas , disinfectant 500 ml , disinfectant powder disinfectant powder for surface cleaning containing potassium monopersulphate 40 50 % sodium c10 – 13. alkybenzen sulphonate 10 20 % sodium ( like virkon) 5 kg , disinfectant solution 4.25% ahp based surface disinfectant concentrate. ltr. , disinfectant solution 5th generation qac based disinfectant having didecyl dimethyl ammonium chloride and n alkyl dimethyl benzyl ammonium chloride ltr. , disinfectant solution aldehyde surface & environmental disinfectant – 5 ltr. , disinfectant solution aldehyde surface & environmental disinfectant – 500 ml , disinfectant solution disinfectant containing electrolysed water with neutral ph, hypochlorous acid, sodium hypochlorite – 5 ltr. , di sodium hydrogen orthophosphate dodecahydrate , di sodium hydrogen phosphate 500 gm , di sodium metasilicate upto 30%, nonionic surfactant and anionic surfactant based powder with optical brightner kg. , di sodium tetraborate decahydrate (borax) , disposable fluid collection system each , distilled water/ di water / deionised water 5 l appearance density = 999.972 melting point = 0°c ( 32°f ) thermal conductivity = 0.58 w/mk 1 refractive index = 1.3325 viscosity = icp specific heat capacity = 75.375 ± 0.05 j/mk 1 , dixon agar 250/ 500 gm , dmso (dimethyl sulfoxide)100/250/500 ml , dna extraction kit 250 r , dna extraction kit 50 test , dna isolation kit from 200 ul blood sample 100 tests , dna ladder (100 bp) 100 ul (0.5 ug/ul) , dna ladder (50 bp) each vial , dna loading dye 20 ml , dna zap pcr dna degradation solutions 5 x 1ml , dnase inhibitor (50 reactions) , dnph (2 4, dinitrohphenylhydrazine) 500gm laboratort reagent grade, >97.0% , dntps (10 mm) each 10 ml , documentation hand labeler gun nos. , doripenam(antibiotic disc)10 mcg (250 disc) , doxycycline (antibiotic disc) 30 mcg (250 disc) , dpx mountant 500 ml , dropper each , dulcitol discs each , dulcitol powder 25gm , dutp 2 gm , e.s.r fluid 500ml , each 100 g contains didecyldimethyl ammonium chloride: 7.0 g corrosion inhibitors, fragrance, excipients q.s. (alcohol free, aldehyde free), pack size: 500 ml bottle , each 100 g contains ethanol ip: 10.0 g, 2 propanol ip: 9.0 g/ isopropanol 1 propanol: 6.0 g/ n propanol provided with convenient hand sprayer, pack size: 250ml bottle , each 100 gm contain dodecylbiyspropylene triamine 9.2 gm and didecyldimethyl ammoinum chloride 13 gm , each 100 gm containes 1.6 dihydroxy 2.5 dioxyhexane (chemically bound formadehyde) in house 11.2gm, glutadehyde 5gm, benzalkonium chloride 5gm, alkyle urea derivative in house 3 gm test report from reputed indian or international lab , each 100 gm contanes true propanol 40 gms 1 propenol 22 gm saniocid , each 100 gms contains : sodium salicylate ip0.46 g sodium benzoate ip 0.59 g water soluble baseq.s , each 100 gms contains 2 propanol (63 gm) benzalkonium chloride (0.025 gm) , each 100 gms contains: 2 propanol40 gm1 propanol22gm saniocid250ml , each 100 gms contains: 1,6 dihydroxy,2 5 dioxyhexane (chemically bound formaldehyde), (in house) (11.2 gm) glutaraldehyde (5.0 gm), benzalkonium chloride (5.0 gm), alkyl urea derivative (in house) (3.0 gm), test report from reputed indian or international labs against viruses as per dvv guideline , ec broth , e cadherin 1 ml , e check 123 1pc , ecoshield solution – 1 ltr. , edta, disodium salt 2 hydrate , egfr 1 ml , ehrlich’s aldehyde reagent 100 ml , ehrlich’s aldehyde reagent 125 ml , ehrlichs aldehyde test 250 ml , ehtnol ip 10gm, truepropenol 9gm, 1 propenol 6 gm , electric ph metre , electrical digital timer , electronic cell counter with 10 keysfor dlc digital blood cell counter bcc 10 is a feature loaded cell counter with perfect quality no. of cells: 10 no. of keys: 12 body material: abs power source: 2 x 1.5v (aa) , electronic cell counter with 9 keys for dlc , electrophoresis hemoglobin & protein buffer 500 ml , elelay (gel) 1 kg , elisa kit neurocysticercosis igm/igg 1 x 96 , ellners broth , ema 1 ml , enoxacin 10 mcg (250 disc) , enrofloxacin 5 mcg (250 disc) , enterobacter aerogenes / klebsiella aerogenes , enterococcus faecalis , eorin 0.1%– 500 ml , eosin & nigrosin stain: ( twin pack)specification: a.. 0.5% eosin y , 290 mosm/kg nacl 1x 30mlb. 10% nigrosin , 290 mosm/kg nacl 1x 30ml , eosin yellowish indicator for microscopy 25 gm specification: assay ( on dried substance ) = 90% ph (1%, water ) = 6.5 7.5 adsorb on maxima (in water) = 515 518 nm absorption ratio ( max 15nm/max+15nm ) 1.21 1.77 specific extinction ( e1% 1cm; ? = 516nm, water ) [ on dried substance ] = 1230 1280 tlc analysis passes test loss on drying ( 105°c ) = 8% suitability for microscopy passes test , epson (ribbon cartridge) nos. , epstein barr virus igm (ab) 1 x 96 , equivalent to cetrimide ip (15 % w/v) chlorhexidine gluconate solution ip (7.5 % v/v) equivalent to chlorhexidine gluconate (1.5 % w/v , erg 1 ml , ertapenem (antibiotic disc)10mcg (250 disc) , erythromycin (antibiotic disc)15 mcg (250 disc) , erythromycin 10 mcg (antibiotic disc) (250 disc) , erythromycin 2 mcg (antibiotic disc) (250 disc) , erythromycin 5 mcg (antibiotic disc) (250 disc) , estrogen receptor 3 ml , etbr– 100 r each , ethambutol/myambutol 25 mcg (antibiotic disc) (250 disc) , ethambutol/myambutol 50 mcg (antibiotic disc) (250 disc) , ethanol 100% (molecular grade) 500 ml , ethanol 1000 ml , ethanol 250 ml , ethanol 500 ml , ethanol ip (10 gm) 2 propanol (9 gm), 1 propanol (6 gm) , ethanol ip (3.0 % v/v) benzalkonium chloride solution ip (0.5 % v/v), equivalent to benzalkonium chloride (0.25 % w/v) , ethidium bromide solution 10ml (hplc purified, suitable for use in gel electrophoresis) , ethionamide/trecator 25 mcg (250 disc) , ethnol ip 10 gm to propanol 9gm 1 propanol 6 gm, bottle manufacturer / marketing company should be certifuing accourding to din en iso 9001, 14100 & 13485 certificate , ethyl acetate 250 ml , ethyl alcohol 500ml (high grade, for use in molecular biology experiments, purity =99.99%, should contain isoamyl alcohol =0.05, 2 propanol =0.01, and higher alcohols =0.01. ) , ethyl violet azide broth (eva broth) , ethylacetate(1 litre) (laboratort reagent grade, =99.0%) , ethylenediaminetetraacetic acid powder (500gm) (acs grade, for molecular biology use) , ethyl hexadecyl dimethyl ammonium ethylsulphate 0.2 gms (mecetronium ethylsulphate) each 100 gms contains 2 propanol 45 gms, 1 propanol 30 gms, with third party test report from reliable lab, or indian or european norm certificates , eto cartridge nos. , external quality contro immunology controls (immno tubidimetric methods > 5 parameters) , external quality control clinical chemistry (more than 30 parameters) , external quality control hba1c and a2f , external quality control immunoassay (more than 20 parameters) , fail safe pcr pre master mix kit 60 units (should capable of amplify high gccontent or secondary structure template, must contain all 12 premixes,) , faropenem (antibiotic disc) 5mcg (250 disc) , fast blue bb salt – 500 gm , fast gernet bgbc salt 500 gm , febrile antigen set (widal tube test) 10 pieces , ferric alum 2% 500 ml , ferric alum 99% 250 gm , ferric chloride 25 gm , ferric chloride 5% 100 ml , ferric nitrate , ferritin 100 ml , ferrous ammonium sulfate , ferrous chloride , fetal bovine serum gold 500 ml , ficoll , fixative solution , flask conical flask 1000ml , flask conical flask 125ml , flask conical flask 250 ml , flask conical flask 500ml , flask round bottom flask 250ml , flask round bottom flask 1000ml , flask round bottom flask 125ml , flask t 25 flask , fli 1– 1 ml , floater (3 4) , flouride powder 500 gm , fluconazole (mic e test strip) , fluconazole powder (solubilized powder, g irradiated ) 50 gm , flucytosine (mic e strip) , flucytosine powder (solubilized powder, g irradiated ) 50 gm , fogging kit – each , forcep blunted dissecting , forcep pointed , forcep ptfe pointed , formaldehyde solution 1 ltr , formaldehyde solution 250 ml , formaldehyde solution 5 ltrs hcho [ mol. wt. = 30.08 ] solubility = miscible with water and absolute alcohol forming colourless solutions. weight per ml at 20°c=1.085 1.095g assay = 37.0 41.0 w/v hcho maximum limits of impurities acidity 3 ml ash = 0.02% chloride (cl) = 0.001 % , formaldehyde solution 500 ml , formaline tab 100 pcs , formic acid 500 gm , fosfomycin (antibiotic disc) 200 mcg (250 disc) , fosfomycin 50 mcg (antibiotic disc) (250 disc) , fosfomycin with glucose 50 mcg (antibiotic disc) (250 disc) , fouchet’s reagent 250 ml for bile pigment bilirubin for lab use only , fouchet’s reagent 500 ml , fraser broth , fraser listeria selective supplement , fructose powder 500 gm , fuchsine acid 500 ml , furaxone 100 mcg (250 disc) , furazolidone 100 mcg (250 disc) , fusidic acid 10 mcg (250 disc) , g.v. lotion 100ml , g.v. powder 500 gm , g 6 pdh 100 ml (compactible with dirui cst240) , galactomannan lateral flow assay – 50 t , galactose 1 phosphate (40 units) (purity (hplc) > 98 %) , gatifloxacin (antibiotic disc) p. size 5x 250 (250 disc) , gcdep 1 ml , gds e coli , gel red 1 x 0.5 ml , gel scoup each , gelatin agar , gelatine powder 500 gm , gentamicinhs (antibiotic disc)120 mcg (250 disc) , gentamicin (antibiotic disc) 10 mcg (250 disc) , gentamicin 30 mcg (antibiotic disc) (250 disc) , geobacillus stearothermophilus ampoules , geobacillus stearothermophilus spores (biological indicator) 50 x 1 ml , gfap 1 ml , ggtp 10x2ml , giemsa powder 25 gm appearance = dark green to black crystal or powder melting point = 300°c ( lit ) solubility = 10mg soluble in 10ml of methanol to give clear blue solution with greenish fluorescence. loss on drying at 110°c nmt = 8.0 % , giemsa powder 250 gm , giemsa powder 500 gm , giemsa stain 250 ml , giemsa stain 500 ml , glacial acetic acid 2.5 l boiling point = 116 118°c assay ( acidimetric ) = 99.7 colour = 10 hazy titratable base = 0.0004 meq/gm acetic anhydride = 100 ppm chloride = 1 ppm heavy metal ( as pb ) = 0.5 ppm sulphate = 1 ppm iron = 0.2 ppm evaporation residue = 10 ppm , glacial acetic acid 500 ml , glacial acid/glocalic acid 500ml , glasspetridish (90 mm) , glasspetridish(100 mm) , glasspetridish(120 mm) , glasspetridish(90 mm ) , glass beads (small size) 1000 gm , glass beads (small size) 250 gm , glass beads (small size) 500 gm , glass cover silips 22 x 22 mm 10 gm , glass cover silips 22 x 24 mm 10 gm , glass cover silips 22 x 60 mm 10 gm , glass cover slip square shape (18 mm x 18 mm) 10 gm , glass cover slip square shape (22 mm x 40 mm) 10 gm , glass innomer cement grade , glass marking pencil each , glass wool , glove cryo gloves 1 pair , glove nitrile gloves (large) (disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) , glove nitrile gloves (medium) (disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) , glove nitrile gloves (small) (disposable nitrile gloves, for use in chemical labs, thickness should be =5mil ) , gloves autoclave/ microwave gloves , glucofuranose , glucose ( hexokinase) 100 ml (compactible with dirui cst240) , glucose hk 100 ml , glucose kit 1 kit 1000 ml , glucose powder 500 gm , glucose salt teepol broth , glutaraldehyde (2.45 % w/v) with test strip & activator , glutaraldehyde 2.45 % w/v purified water 3 7% butylated hydroxyanisole, pack size: 5 litre jar , gluteraldehyde solution 5 ltrs , glycerine 2.5 ltrs , glycerine 400ml , glycerine 500 ml98% w/w min. aqua and rose flavour , glycerol 500 ml , glycine powder(ar) 250 gm (acs reagent, =98.5%, analytical grade) , glycocylated hemoglobin kit 25 t , glycogen kit , glycolic acid 500 ml , glycosylated kit 100 ml , gold chloride 0.1% 100 ml , gold chloride 0.2% 100 ml , gram stain kit 250 ml , gram stain kit 500 ml , grams iodine(crystal) 100 gm , griess assay reagent 500 ml , guanidine hydrochloride , guanidinium thiocyanate , h.c.v. kit rapid 50t , h.i.v. rapid kit50 t , h2o2 250 ml , h2so4 (sulphuric acid) conc 500ml , haematoxylin powder 1 kg , haematoxylin powder 25gm appearance = yellow to brown to tan colour form = powder dye content = 80% solubility in alcohol passes test water 8 % max. spectroscopy peak at 253, ratio 0.98 @ 508/538nm density @ peak 0.519qu , haematoxylin powder stain 125 ml , haemocystin 100 ml , haemocyto meter (german) pcs , haemoglobin estimation , hand rub alcoholwith moisturizer 500 ml 2.5 % v/v chlorhexidine gluconate solution i.p equivalent to 0.5% w/v chlorhexidine gluconate 70 % v/v ethyl alcohol, skin emollients, perfume, fast green as fcf colour. , hand wash solution scrub 500 ml , handrub ethanol 70% v/v handcrub 250 ml , haptoglobin 100 ml , hardness testing kit (for water analysis) each , harris haematoxylin solution ( papanicolaou solution ) 25 gm density = 1.04 gm/cm3 ( 20°c ) ph = 2.3 2.8 ( 20°c ) ci75290 5.3 gm/l al2(so4)3 18h2067gm/l , hav + hev igm elisa 96w , hav igm elisa – 1 x 96 test , hba1c 100 ml , hba1c calibrator 100 ml , hbdh 100ml , hbsag elisa 1 x 96 test , hcv dna extraction kit , hdl cholesterolcalibrator 100 ml , hdl cholestrol direct 100 ml , hdl cholestrol kit 10ml , hdl control 50 ml , hdl cholesterol 100 ml , heamatoxlene powder 250 gm , heamoglobin denatarant 1000 ml , heat block , hektoen enteric agar , hematology external quality control , hematology controls(compatible within sysmex xn 1000) 3 ml , hematoxylin monohydrate 82% , hematoxyllin powder 5 gm , hemo dialysis solution 10 ltrs , hemoglobin electrophoresis kit 100 tests , hemoglobin set – each , hemoglobino meter(0 30 g/dl)(german) pcs , hemoglobinometer calorimetry set , hepatitis a, serum, igm, wantai, dia pro, srl, italy, hepavase (gbc taiwan) , hepatitis b, serum, hbsag, j mitra, biorad , hepatitis c rpd kit (detects core, ns3, ns4 ns5 all hcv genotypes ) – 50 t , hepatitis c, serum, total antibody, j mitra, ortho hcv 3.0, biorad , hepatitis d virus, serum, total antibody, dia pro, srl, italy, gbc taiwan (for research use only) , hepatitis delta each , hepatitis e, serum, igm, wantai, mp diagnostics,dia pro , hepes sodium salt , hev igm elisa 1 x 96 test , hexane 500 ml , hini elisa 96w , hippurate broth , hla dr cy5.5 1 pc , hla b27 pcr kit 96 tests , hma 45 1ml , hmb 45 1 ml , holdar vacutainer holder – each , holder test tube holder each , homocysteine with standard 100 ml (compactible with dirui cst240) , hsv i + iiigg (ab) elisa 1 x 96 , hsv i + ii igm (ab) elisa 1 x 96 , hsv i igg (ab)elisa 1 x 96 , hsv i igm (ab) elisa 1 x 96 , hsv ii igg (ab) elisa 1 x 96 , hsv ii igm (ab) elisa 1 x 96 , hugh leifson medium , hydrated disodium hydrogen phosphate 250 gm , hydrochloric acid ( 35 % ) 500 ml , hydrochloric acid 500 ml , hydrochloric acid 500ml , hydrochloric acid hcl conc 500ml , hydrochloric acid n/10 500 ml , hydrogen peroxide 500 ml , hydrogen peroxide of minimum 30% and oxygen based bleaching agent 5 ltr. , hydrogen peroxide solution 2.5 ltrs contains 6.5% w/v hydrogen peroxide ( non medicinal ) , hydrogen peroxide solution 500 ml , hydrophobic barrier marker pen – reagent blocker (pap pen) use in immunohistochemical applications , hydroquinone 250 gm , hydroquinone buffer 500 ml , hydroxylamine hydrochloride (500gm) (laboratory grade, 99%) , hypochloride 10 % 500 ml , hypochlorite (l) , hypochlorous acid (hocl – 0.003%) + sodium hypochlorite (naocl – 0.004%) + electrolysed water – 99.97% (wound care spray) – 500 ml , hypochlorous acid (hocl – 0.008%) + sodium hypochlorite (naocl – 0.002%) + electrolysed water – 97.64% (wound care gel) – 60 gm. , ice bucket each , iga 100 ml , ige calibrator 100 ml (compactible with dirui cst240) , ige reagent 100 ml (compactible with dirui cst240) , igg 100 ml , igm 100 ml , imidazole , imipenem (antibiotic disc)10mcg (250 disc) , imipenem relebactum(antibiotic disc)10 mcg (250 disc) , imipenem relebactum(antibiotic disc)25mcg (250 disc) , immunoassay controls (more than > 30 parameters) 5 ml , immunohistochemistry (ihc) estrogen receptor kit (a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents.) , immunohistochemistry (ihc) her2 receptor kit( a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents.) , immunohistochemistry (ihc) progesterone receptor (pr) (a all in one kit for immunohistochemical staining for tissues, it must contain primary antibody, secondary antibody, conjugates, buffer and all necessary reagents.) , immunology controls including (crp/aso/rf) 5 ml , india ink – 100 gm , india ink 100 ml , indian ink 250 ml , inhibin 1 ml , innovative tenside system containing 5 15% anionic surfectants, < 5 % nonionic surfectants, <5% polycarboxylate, enzymes.other excipients: solubiliser, corrossion inhibitors sodium cumenesulfonate, sodim etasulfate, 2 aminoethanol, alcohols, c13 15 branched and linear, butoxylated ethoxylated, alkylpolyethylen glycol polybutylen glycolether, subtilisin, glucerol, pack size: 5 litre jar , iodine 500 gm , iodine apex 100 gm , iodoacetamide (iaa) , iron alum 5% 100 ml , iron binding kit 150ml , iron sulfite agar , iron tibc 100 ml , iso amyl alcohol 500 ml , iso butanol , isoniazid / isonicotinyl hydrazine 1mcg (250 disc) , isopropanol 1000ml(acs purity 69 71 %) , isopropyl alcohol 2.5 ltr c3h80 [ mol. wt. = 60.10 ] specification: assay ( gc ) nlt = 99.0% weight per ml at 20°c = 0.784 0.786 maximum limits of impurities. residue after evaporation = 0.002% water = 0.2% , isopropyle alcohol(molecular grade)2.5 ltrs , itraconazole (mic e test strip) , itraconazole powder (solubilized powder, g irradiated ) 1 mg (250 disc) , japanese encephalitis igm elisa 1 x 96 , kanamycin(antibiotic disc)30mcg (250 disc) , karyotyping media (500ml) (ready to use liquid media, to be used to culture peripheral blood lymphocytes, 1x preparation, must supplemented with fetal bovine serum, l glutamine, and phytohemagglutinin, media use must be certified for “in vitro diagnostic use”. it should be manufactured at fda registered cgmp compliant facility only.) , kel 500ml , ketoconazole powder (solubilized powder, g irradiated ) 1 mg (250 disc) , ketone bodies ( blood) with calibrator 100 ml (compactible with dirui cst240) , ki67 antigen 1 ml , kovac’s indole reagent 250 ml , kovacs reagent – 100 ml , l spreader , l arginine hydrochloride 10 gm , l j media slant (solid media) 250 gm , l j media slant each , l lysine hydrochloride 10 gm , l shaped wire each pack , l.d test kit (rk39) – 100 tests , l.d test kit (rk39) – 25 tests , l.d test kit (rk39) – 50 tests , lab coat , lab goggles each , lab shoes size 10 , lab shoes – size 7 , lab shoes size 8 , lab shoes size 9 , laboline , laboratory deodorizing pearls , lactate control 100 ml (compactible with dirui cst240) , lactate with calibrator 100 ml (compactible with dirui cst240) , lactic acid , lactophenol cotton blue 250 ml , lactose 500 gm , lactose broth , lactose powder250 gm , lactose ttc agar with tergitol 7 , large ruler metallic scales each , l arginine hydrochloride 10 gm , lavofloxacin 5 x 250d , lb broth (lennox) , lb broth with agar , ldh kit – 2x25ml , ldl cholesterolcalibrator 100 ml , ldl control 50 ml , lead acetate 500 gm , leeming notman agar 250 gm , leeming notman agar 500 gm , leica freezing media for cryostat ( 125 ml ) leicapack size 40z ( 118 ml ) optimal cutting temperature ( oct ) compound is formation of clear, water soluble glycols and resin, providing a solid matrix to specimen holder for consistent sectioning in a cryostat working temperature of 10°c below. specification: mol. formula = na2s2o4 mol. wt. = 1/4.11 assay ( iodometric ) = 85 87.5 iron ( fe ) = max. 0.002 % ( at the moment of batch analysis ) , leishman powder 25gm form = powder colour = dark green solubility solution in methanol turbidity 0.1 % clear solubility colour solution in methanol 0.1 % blue with green fluorescence loss on drying = max. 8 % absorbance ( a ) in 1 % solution in methanol in a 1cm cell at 650nm = min. 950 , leishman stain 500ml , leishman stain powder 100gm , leishman stain powder 250 gm , lens cleaner , leptospira igm elisa 1 x 96 (1 pack) , levofloxacin(antibiotic disc) 5mcg (250 disc) , liapase 100 ml , light green 2% 100 ml , light green for microscopy 25 gm absorption maximum ( ? max. water ) = 629 634 nm specific extinction ( e1% / 1cm ) ? max. = 0.0005 % water = 830 1130 loss on drying ( 110°c ) = 12% , light green powder 500 gm , light green sf yellow 25 gm , lignocaine hydrochloride 10 ml injection ip = 2% lignocaine hydrochloride ip 2% w/v sodium chloride = 0.45% w/v methyl paraben = 0.2% w/v water for injection ip q.s , lignocaine hydrochloride 20 ml , lincomycin 15 mcg (250 disc) , lincomycin 2 mcg (250 disc) , linezolid(antibiotic disc)30mcg (250 disc) , linezolid 10 mcg (antibiotic disc) (250 disc) , lipase, amylase, protease, cellulase, biodegradability 3.785 liter , lipid controls 5 ml , lipoporotein (a) – 5 ml , lipoprotein 100 ml , liquid paraffin (heavy) 500 ml , liquid paraffin light 500 ml guarantee analysis weight per ml at 20°c = 0.84 0.89gm refractive index at 20°c = 1.480 identification ( by ir ) = passes test , liquor ammonia 500 ml , listeria enrichment broth (base) , listeria innocua , listeria monocytogenes , lithium carbonate 100 ml , liver broth , l lysine hydrochloride 10 gm , l mould brass – specimen holder used for holding the wax block for taking sections on the microtome.( size – 7.5 × 3 × 1.9 cm pair) , l mould brass – specimen holder used for holding the wax block for taking sections on the microtome. (size – 4.5 x 2.5 x 0.5 cm pair) , lomefloxacin 10 mcg , loop (1 mm) each pack , loop (10mm) each pack , loop (2mm) each pack , loop (4mm) each pack , l ornithine hydrochloride 10 gm , lpa 100 ml , l threonine , l tyrosine , lugols iodine 100 ml , lugols iodine 250 ml , lugols iodine 500 ml , l valine , lysozyme , m.p. test kit (pv, pf) –100 tests , m.p. test kit (pv, pf) –50 tests , m.p. test kit (pv, pf) – 25 tests , mac cartney bottle with screw cork , mac conkey agar 500 gm , macconkey broth , macconkey sorbitol agar500 gm , magnefying glass 3 each , magnesium chloride (mgcl2) 100 gm , magnesium chloride (mgcl2) 500 ml , magnesium chloride hexahydrate , magnesium powder 500 gm , magnesium sulphate 500 gm , magnesium sulphate heptahydrate , malachite green 100 gm , malaria elisa 96 w , malt extract , maltose 500 gm , mangenese chloride , mannitol egg yolk polymyxin (myp) agar , mannitol salt agar , manual cell counter with 9 keys for dlc – differential blood cell counter 9 windows total of keys8 or 9 keys total of windows 2 (totalaizer) each window figure range:0 999 number of buttons 8 number of windows 9 dimensions (mm)w320xd80xh50 , masson trichrome stain reagent , mathicilin : 5x50 t , mayer’s hemalum solution 1 ltrs specification: density = 1.05/cm3 ( 20°c ) ph = 1.8 2.2 ( 20°c ) ci752904.4gm/l al2(so4)3 18h20 = 28gm/l c6h8o7h2o = 0.5 gm/l , mayer’s hemetoxylene solution 1 gm , mc cal a ( mastercurve calibrator a ) 100 ml , mc grunewald stain 500 ml , mdm 2 1 ml , measles igm (ab) elisa 1 x 96 , measuring jar 500 ml , measuring scoop each , mecillinam 10 mcg (250 disc) , melan a 1 ml , m endo agar , mercuric chloride 500 gm , mercuric oxide red 100gm inorganic chemical assay = 99 % appearance ( form ) = solid colour = red purity = 99 % mol. wt. = 216.59 grade ar/gr melting point = 500°c , mercuric oxide red 500gm , mercuric sulphate 500 gm , meropenem (antibiotic disc)10mcg (250 disc) , metanil yellow 500 gm , methanamine 3% 500 ml , methanamine silver 100 ml , methanol – 500 ml , methanol ( methyl alcohol ) 2.5 ltrs minimum assay 99.8 % maximum limit of impurities • colour = 10 hu • water = 0.1 % • acidity ( hcooh ) = 0.001 % • alkalinity ( nh3 ) = 0.0002 % • non volatile matter = 0.001 % • aldehydes and ketones = 0.005 % • ethanol = 0.1 % • copper = 0.00005 % • lead = 0.00005 % • iron = 0.0001 % • permanganate = 0.00025 % , methyl alcohol 5 ml , methyl blue 25 gm , methyl green 250 gm , methyl red indicator – 250 ml , methyl violet/ crystal violet powder 250 gm , methyl violet/ crystal violet powder 500 gm , methyl violet/ crystal violet solution 100 ml , methyl violet/ crystal violet solution 250 ml , methyl violet/ crystal violet solution 500 ml , methylene blue (aqueous) 100 ml , methylene blue 100 gm , methylene blue 250 gm , methylene blue 500gm , methylene blue new 100 ml , methylene chloride 250 ml , methylene green 100 gm , metronidazole 5 mcg (250 disc) , metronidazole 80 mcg (250 disc) , mezlocillin 30 mcg (250 disc) , mezlocillin 75 mcg (250 disc) , m fc agar , mg powder 500 g , micafungin (mic e test strip) , micafungin powder (solubilized powder, g irradiated ) 1 mg , michel’s transport media , micro albumin control level 1 100 ml (compactible with dirui cst240) , micro albumin csf/urine 100 ml , micro albumin with calibrator 100 ml (compactible with dirui cst240) , micro clean 1 ltr. , micro protein control level 1 100 ml (compactible with dirui cst240) , micro protein kit , micro protein with calibrator 100 ml (compactible with dirui cst240) , milk agar , minocycline(antibiotic disc)30mcg (250 disc) , modified charcoal cefoperazone deoxycholate agar (mccd) , modified dixon agar 250 gm , modified dixon agar 500 gm , modified mha500 gm , molecular grade h2o – 500 ml , molecular ladder 100bp , mollecular ladder 1kb , molybdic acid 500 ml , motility test media , moxalactum(antibiotic disc)30mcg (250 disc) , moxifloxacin 5 mcg (antibiotic disc) (250 disc) , mpo staining reagent – benzidin power 250 gm , mr reagent 100 ml , msa (mannitol salt agar) media 250 gm , msa (mannitol salt agar) media 500 gm , mtt tetrazolium , mueller hinton agar 500 gm , mueller kauffman tetrathionate novobiocin broth base (mkttn) , multi calibrator antibiotic tdm 100 ml , multi enzyme cleaner with neutral ph containing5 15% non ionic surfactants, enzymes (amylase, lipase & protease), fragrancessolubilisers, corrosion inhibitors, colouring agents. declared conformity as medical device according to mdd93/42/eec.alcohol, c13 c15 branched and linear, butoxylated ethoxy, ethanol, alkyl polyethylenglycol polybutylenglycolether, sodium cumenesulfonate, pack size: 2 litre bottle , multidet kit 1000ml , multienzymatic cleaner, jar manufacturer / marketing company should be certifying according to din en iso 9001, 14100 & 13485 certificate , multipurpose labelling tape , mumps igm (ab) elisa 1 x 96 , mupirocin 200 mcg (250 disc) , mupirocin 5 mcg (250 disc) , myo d1 1 ml , myogenin 1 ml , myoglobin 1 ml , myoglobin 100 ml , myoglobin calibrator 100 ml , n acetyl l cystine (nalc) 10 gm , n,n dimethyl form amide (sigma d 4551) – 500 ml , n,n,n,n tetramethylethylenediamine (temed) , n,n’ methylene bis acrylamide , n.a. agar , n 1 nepthyl ethylenediamine dihydrochloride (100g) (acs reagent, >98.0%) , na + k standard solution 100 ml , na+ & k+ standard solution 500ml , nadp 100mg (purity (hplc) > 95 %/spectrophotometric purity > 95 %) , nadph 100mg (powder, =97% (dry weight), mol wt.833.4) , nafcillin 1 mcg (antibiotic disc) (250 disc) , nalc 10 gm , nalidixic acid (antibiotic disc) 30mcg (250 disc) , naphthol a s phosphate (sigma n 5625) – 500 ml , natidixic acid (antibiotic disc) p. size 5x 250 , n butanol 500 ml , n butyl alcohol 500ml , negative calibrator dau 100 ml , neomycin 30 mcg (antibiotic disc) (250 disc) , neomycin 5 mcg (antibiotic disc) (250 disc) , netilmicin(antibiotic disc)30mcg (250 disc) , neubauers counting cover slip each , neuron specify enalase , neutral red (0.62% aquor solution) – 500 ml , neutrophil alkaline phosphate reagent , nh3 control 1 100 ml (compactible with dirui cst240) , nh3 control 2 100ml (compactible with dirui cst240) , nh3 reagent 100 ml (compactible with dirui cst240) , nigrosin powder–250 gm , nigrosin powder– 100 gm , ninhydrin 10 gm , nitric acid 500 ml , nitric acid (conc) 500 ml , nitrofurantoin (antibiotic disc)300mcg (250 disc) , nitrofurantoin 100 mcg (antibiotic disc) (250 disc) , nitrofurantoin 200 mcg (antibiotic disc) (250 disc) , nitrofurantoin 50 mcg (antibiotic disc) (250 disc) , nlgrosln stain – 25 gm , no foam reagent 100 ml , norfloxacin 2 mcg (antibiotic disc) (250 disc) , norfloxcin (antibiotic disc)10mcg (250 disc) , normal saline 500 ml , norovirus, stool, antigen, ridascreen; r. biopharma , novacastralhc detection kit 1250 x 1 , novobiocin disc (antibiotic disc)10mcg (250 disc) , novoline polymer 1kit , nse 1 ml , nuclear fast red 100ml , nuclease free water or diethylpyrocarbonate (depc) 5 ml , nutrient agar 500 gm , nutrient agar 1000 gm , nutrient broth , nutrient gelatin , o. toluidine – 200 gm , o.g.6 powder 25 gm , occult blood test kit immunochromatography 25tests , octenidine based wash lotion with neutral ph, tested as per european norms containing octenidine hcl, aqua, cocamidopropylamine oxide, peg 7 glyceryl cocoate, glycerin, hydroxyethyl cellulose, lactic acid, contains allantoin, for full body wash head to toe, pack size: 500 ml bottle , octenidine based wash mitts with pratical hand dimension, tested as per european norms containing octenidine hcl,aqua, glycerine, cocamidopropylamine oxide, sodium lactate, allantoin,ethylhexyl glycerine, pack size: 100 pcs per packet , ofloxacin (antibiotic disc) 10mcg (250 disc) , ofloxacin 5 mcg (antibiotic disc) (250 disc) , oilminth peperment , oleandomycin 10mcg (antibiotic disc) (250 disc) , oleandomycin 15 mcg (antibiotic disc) (250 disc) , oleic acid (5g) ()purity (gc) > 99 % _cell culture test pass , onpg disc100 disc (250 disc) , ophyde 5 ltrs , optochin disc (antibiotic disc) 5mcg (250 disc) , orange g 100gm , orange g 25gm appearance = orange coloured powder form solubility ( turbidity )0.1% aqueous clear solution loss on drying = max. 10 % absorbance of 1 % aqueous solution in a 1cm cell vs h20 @478nm = 380 500 , orange serum agar , orcein 200 ml , ornithine dec arbovylace test reagent , ortho phosphoric acid , orthotoluidine 20 ml , oxacillin(antibiotic disc)1mcg (250 disc) , oxacillin 5 mcg (antibiotic disc) (250 disc) , oxalate powder 250gm , oxalic acid 500 gm , oxalic acid 2% 500 ml , oxford listeria selective agar , oxford listeria selective supplement , oxidase reagents disc 1 pack (pack of 100 discs) , oxidase reagents powder 250 gm , oxidative/fermentative medium with “ferric chloride” reagent 250 ml , oxolinic acid 2 mcg (250 disc) , oxytetracycline 30 mcg (250 disc) , p 120 1 ml , p 53 1 ml , p 63 1 ml , p.h. liquid handicator , p.p.d. 10 tu 5ml , p.p.d. 2 tu 5ml , p.p.d. 5 tu 5ml , p.t kit prothrombin kit (isi value = 1.1 liquid stable) 5ml , palcam listeria selective agar , palcam listeria selective supplement , pals solution 100 ml , pan cytokeratin 1 ml , panta 15 ml , pap staining kit , paper auto clave print paper sheets , paper butter paper each , paper cellulose acetate paper for electrophoresis each , paper eto thermal printing paper sheets , paper filter paper – 25 pcs. , paper litmus paper blue – each , paper litmus paper red – each , paper ph indicator paper pack of 100 , paper r.a. printing paper each , paper sample appicafor for cellulose acetate paper electrophoresis each , paper thermal paper 4.2” 50 mtrs , paper tissue paper – the tissue paper is hygienic, soft to touch, and highly absorbent. disposable 100 pcs/ pack , paper water filter papers 100 leaves , paper whatman filter paper no2 , paraffin liquid 500ml , paraffin sealing strip/tapeeach pack , paraffin wax (granules) – 500 gm. , paraffin wax = 2 kg 58 t0 60°c specification: alkaline/acid reacting substance passes test solidification point = 58 60°c ulphated ash =0.05% suitability for histopathology passes test. , parafilm dispenser with cutter each , paraformaldehyde , parvo b 19 igm (ab) elisa 1 x 96 , pas and diastase enzyme 100 ml , pasture pipette with rubber , pax 5 1 ml , pbs buffer 1x 500 ml each , pbs buffer 1x 6ml , pcr – primer for thalassaemia & sickle cell anamia – 500 ml , pcr buffer 2x 25ml each , pcr buffer 2x 500 ml each , pcr buffer 5x 500 ml each , pcr buffer 5x 25ml each , pcr grade water 100 ml , pcr microplate with septa 48 well (polypropylene pcr microplate compatible with standard pcr machine, non skirted, clear, should be supplied with compatible plastic septas) , pcr microplate with septa 96 well (polypropylene pcr microplate compatible with standard pcr machine, non skirted, clear, should be supplied with compatible plastic septas) , pcr plate 0.1 ul , pcr plate 0.2 ul , pcr plate 96 well , pcr plate clear sealing films 96 well (100 per pack) (functional temperature range 40 to +104 °c) , pcr plate cover 0.1ul , pcr plate cover film 0.2 ul , pcr plate flexi – 96 well , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with fam (fam dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with hex (hex dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with rox (rox dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) labelled with tamara (tamara dye labelled customized oligonucleotidess for pcr reaction) , pcr primer (100 oligonucleotides, average 20b/oligo) unlabelled (unlabelled customized oligonucleotidess for pcr reaction) , pd 1 50ul(40ug) , pda agar , peflox(imported) 5mcg (250 disc) , pefloxacin (antibiotic disc) 5 mcg (250 disc) , penicilin g(antibiotic disc)10 units (250 disc) , pepsin 1 gm , peptone 500gm , peptone water media 500gm , perchloric acid schiff(pas) kit , perfumed liquid based softening agent with anti static property and biodegradable having ph of 6.5 7.5 ltr. , periodic acid: 25gm specification: ph 1.2 ( 100gm/l, h2o,20 degree celsius bulk density – 1400kg/m3, assay( iodometric) >98.0%melting point (lower value) >124 degree celsius melting point (upper value) >129 degree celsius , periodic acid 0.5% 100 ml , periodic acid 1% 100 ml , peripheral blood karyotyping readymade culture media rpm1 16501 , peripheral blood karyotyping readymade culture media rpmi 1640 , perl’s staining reagent – potassium feno 250 ml , perls iron stain1 & 2 ( twin pack)specification a. perls 1 potassium ferrocyanide 250ml b. persl2 hydrochloric acid 250ml , petri disc 4” glass – each , petri disc 4” pvc – each , petri plate 100mm each , petroleum ether 250 ml , ph meter each , phenobarbital 100 ml , phenol red indicator 100ml , phenotoin 100 ml , phenyl hydrogen hydrochloride 95 % , phenyl phosphatedisodium salt , phenylalanine agar , phosphate buffer saline 120 ml , phosphate buffer saline 500 ml , phosphomolybdic acid 25 gm , phosphoric acid 500 ml , phosphorus 100 ml , phosphorus kit 50 t , phosphotungstic acid 100 gm , phosphotungstic acid 500gm specification: physical state at 20°c = solid appearance = white to yellowish powder or crystal odourless melting point / freezing point = 95°c solubility in water ( % weight ) = 200gm/100gm water substance insoluble in water = max. 0.01 % chloride = 0.01 % sulphate = max. 0.01 % total nitrogen = 0.005 % loss on ignition at ( >50°c ) = max.17 % , picric acid (lyctophenol )250 ml , picric acid 500 gm , picric acid(saturated) 100 ml , pilocarpine 2% & 4% , pipemidic acid 20 mcg (antibiotic disc) (250 disc) , piperacillin (antibiotic disc)100mcg (250 disc) , piperacillin + tazobactum (antibiotic disc)100 (250disc) , piperacillin 100 mcg + tazobactam 10 mcg (antibiotic disc) (250 disc) , piperacillin 30 mcg (antibiotic disc) (250 disc) , piperacillin 30 mcg + tazobactam 6 mcg (antibiotic disc) (250 disc) , piperacillin 50 mcg (antibiotic disc) (250 disc) , piperacillin 75 mcg (antibiotic disc) (250 disc) , piperacillin 75 mcg + tazobactam10 mcg (antibiotic disc) (250 disc) , piperazine n,n’ bis(2 ethanesulfonic acid) , pipette –westerngren esr , pipette – autopipette 0.1 10 ul , pipette – autopipette 1 200 ul , pipette bulb each , pipette – disposable pipette single , pipette – graduated pipettes 10 ml , pipette – graduated pipettes 1ml , pipette – graduated pipettes 2 ml , pipette – graduated pipettes 5 ml , pipette – hemoglobin pipette each , pipette – pasteur pipettes with rubber blubs each , pipette – pipette stand(it should be madeup of polymethyl methacrylate, atleast 5 places for pipettes) , pipette – r.b.c. pipette (german) pcs , pipette sterilized pasture pipette each , pipette – sterilized pasture pipette with rubber each , pipette variable pipette: micropipette, adjustable volume, fully autoclavable eight channel : 05 50 ul, 30 300ul & 100 1000ul , pipette variable pipette: micropipette, adjustable volume, fully autoclavable single channel : 01 10ul, 02 20ul, 05 50ul, 10 100ul, 20 200ul, 100 1000ul spring loaded tip cone for connecting tips very tightly, adjustment opening for adjusting pipettes to a specific liquid and volume. control button with very low operating force, color indication for pipette volume. tip ejector with very low operating force, positioned for perfect ergonomics. volume display: 4 digits with magnifier. to provide thermal, mechanical and chemical stability piston should manufactured from fortro material very easy removable lower part for cleaning pipette no discoloration upon uv irradiation. confirmation to specification must , pipette w.b.c. pipette (german) pcs , plastic cassettes for automatic tissue processer – 500 ml , plate elisa plate 96 well , plate microtitre plate with lid 96 well flat bottom , plate microtitre plate with lid 96 well round bottom , plate count agar , platelet count fluid 2.5 ltrs , platelet count fluid 500 ml , platelet diluting fluid 125ml/bottle , poatato dextrose (pda)agar , poivceu red staining solution 500 ml , pollyf (cement) , polyclonal rabbit anti human c1q complement/fitc one kit(2ml concentrated) (the reagent should be used for demonstration of human c1q in tissues, and may also be used for other immunofluorescence techniques. the anti human c1q complement conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order.) , polyclonal rabbit anti human c3 complement/fitc one kit(2ml concentrated) (the reagent should be used for demonstration of complement c3 in tissues, and may also be used for other immunofluorescence techniques. the complement c3 conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum conjugated with fluorescein isothiocyanate isomer 1. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. the antibody should react with human c3 c part of c3 and c3b. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity.) , polyclonal rabbit anti human fibrinogen/fitc one kit (2ml concentrated) (the reagent is intended for demonstration of human fibrinogen in tissues, and may also be used for other immunofluorescence techniques. the fibrinogen conjugate should be prepared from a purified protein fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order.) , polyclonal rabbit anti human iga/fitc one kit(2ml concentrated) (the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human iga conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order.) , polyclonal rabbit anti human igg/fitc one kit(2ml concentrated) (the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human igg conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order) , polyclonal rabbit anti human igm/fitc – one kit(2ml concentrated) (the reagent is intended for demonstration of human immunoglobulins in tissues, and may also be used for other immunofluorescence techniques. the anti human igm conjugate should be prepared from a purified immunoglobulin fraction of rabbit antiserum. protein concentration must be labeled in g/l. antibody titre must be so that it could provide f/p ratio: e495 nm/e278 nm = 0.65 ± 0.05 corresponding to a molar fitc/protein ratio of >2.0. it should be compatible for frozen section and paraffin embedded tissues. should have high sensitivity and specificity. the shelf life must be 7 9 months at the time of delivery. the antibody should be compatible with manual and automated system. demonstration should be performed before supply of purchase order. , polyethylene glycol 6000 , poly l lysine 100mlsolution. 0.1% (w/v) in h20 p8920 , polymerase , polymeric biguanide hydrochloride inhouse greated then 10% alkyle dimethyle benzyle ammonium chloride and didecyle dimethyle ammonium chloride in house greater then 10% quantative nonporous surface test for the evolution of bactericidal and or fungicial antvity of chemicals , polymeric bigunide hydrocholide 10 % alkyl dimethyle benzyl ammonium chloride and dodecyl dimethyle ammonium , polymixin b 50 mcg (antibiotic disc) (250 disc) , polymixinb (antibiotic disc)300mcg (250 disc) , posaconazole (mic e test strip) , posaconazole powder (solubilized powder, g irradiated ) , pot urinary urine collector – material plastic colour blue/ white closure type screw pattern solid capacity 50 milliliters product dimensions 8w x 5h centimeters shape round , pot urine pot sterile, graduated, screw capped , potassium acetate 500 gm , potassium almunium sulphate 500 gm , potassium aluminium sulphate 100 gm , potassium carbonate (khco3) 500 gm , potassium chloride (kcl)500 gm (reagentplus®, =99.0%) , potassium citrate , potassium dichromate (powder) , potassium dihydrogen diphosphate 5 kg [ potassium po4 mono basic ) assay ( after drying ) = 99.0 101.0 % ph ( 5 % aqueous ) = 4.1 4.5 maximum limits of impurities • chloride = 0.01 % • sulphate = 0.05 % • iron = 0.002 % • heavy metals ( pb ) = 0.002 % • sodium ( na ) = 0.2 % , potassium dihydrogen orthophosphate , potassium dihydrogen phosphate gr (kh2po4) 500 gm , potassium ferrocyanide 2% 500 ml , potassium ferrocyanide 99% 500 gm , potassium hydroxide (koh) 250gm , potassium hydroxide (koh) 500gm , potassium iodide 500 gm , potassium iodide crystal 100 gm , potassium iodide crystal 200 gm , potassium nitrate – 500 gm , potassium oxalate 500 g , potassium periodate , potassium permanganate (acidified) 100 ml , potassium permanganate 500 gm , potassium peroxomono sulphate 5 kg (in house) (50% w/w) with 3rd party test report from reliable lab, or indian or european norm certificates , potassium phosphate di basic (k2hpo4) (250g)(bioultra, for molecular biology, =99.0%) , potassium phosphate monobasic(kh2po4) (500g) (acs reagent, =98%) , potassium thiocyanate 99% 500 gm , potassium thionate 100 gm , potato dextrose agar 500 gm , potato dextrose agar with chloramphenicol , povidone iodine ip (7.5 % w/v) 100 ml i.e. available iodine (0.75 % w/v , povidone iodine solution ip 5% w/v 250 ml available iodine 0.5 % w/v purified water ip q.s , povidone iodine ip 10 % w/v , (1.0 % w/v available iodine) u.s.p equivalent to 1% available iodine, <10% nonylphenol, <10% ethoxylated, <10% polyethylene glycol 400, <10% citric acid, <10% sodiumphosphate, 30 70% water, pack size: 500 ml bottle , povidone iodine ip 7.5 % w/v, (equivalent to 0.75 % w/v available iodine), 0 10% ammonium nonoxynol sulfate, 0 10% glycerol, 0 10% , sodium lauryl sulfate, 0 10% sodium phosphate dibasic, 0 10% hydroxyethylcellulose, 0 10% potassium iodide, >20% , water with emollient & moisturiser, pack size: 500 ml bottle , ppd 10 tu 10 ml , pre albumin 100 ml , pre albumin calibrator 100 ml , progestone receptor 3 ml , protease inhibitor , protein kit per kit , protein mw marker , protein, rust, coffee and ink spotting kit kit , proteinase k (powder) 100mg (100mg powder, to be used in dna isolation, molecular biology use only, source from pichia pastoris or tritirachium album activity unit per mg =30 ) , proteolytic enzymatic cleaner , proteolytic enzyme (proteas ) , instrument compatibility 1 ltrs , proteus mirabilis , prulifloxacin (antibiotic disc) 10mcg (250 disc) , prussian blue 500 ml , psa 1 ml , psa stain 100 ml , pseudomonas aeruginosa , pseudomonas agar base , pseudomonas cfc selective supplement , pseudomonas cn selective supplement , pseudomonas selective agar (cfc agar) , p toluidine , pt pcr zika rt pcr kit , pumic stone 500 gm , purified mercury 100 gm , qc for clinical chemistry 100 ml , quality control for clinical chemistry high , quality control for clinical chemistry normal , quinpristine dalfopristine(antibiotic disc)15mcg (250disc) , r.a. factor test(r.a. latex 100 t) 100 test , r.b.c diluting fluid 500ml appearance = clear colourless solution , r.b.c lysis solution 200 ml , r.c.m. media 250 gm , rack 96 well rack for mct tubes (for 2ml tube) (it should be made up of polycarbonate, must contain 96 places (8x12) for 1.5ml tube. ) , rack pcr rack with cover , rack pcr tube rack 96 set , rack pipette rack 6 pcs capacity , rack sample racks for sample tube each , rack sample racks for sample tube each , rack somersault rack universal each , rack staining rack staining jarincluding lids – 8 numbers slide rack 1 body type – stainless steel size – 47.5 x12.0x12.0 cm , rack steelrack – formicroscope slides slide staining rack is made of aluminium and stainless steel staining rack comes with movable handle. stainless steel slide rack is resistant to staining solutions. hinged rack handle allows easy insertion and removal of the microscope slides. slide staining rack holds up to 25 microscope slides. , rack steel rack – to hold 50 slides , rack test tube rack 24 tube , rack test tube rack (36 holes) alumunium , rack universal combi rack , rack test tube rack 36t , raffinose pentahydrate , rapid kit for c.difficile , rapid kit for h pylori 100 tests , rapid test kit for clostridium difficile pack of 50 test , rapid test kit for salmonella species pack of 50 test , rappaport vassiliadis soya peptone broth , rat repallent each , ravuconazolepowder (solubilized powder, g irradiated ) 1 mg , ready plate chromogenic coliform agar , reagent reservoir 200ml , reagent reservoir/ troughs autoclavable (polypropylene, 75ml, ) , reaty to use for drug assay methotrexate assay – 3.0 ml , reaty to use for drug assay phenobarbital assay 28ml with calibrator , reaty to use for drug assay phenobarbital assay 14 ml with calibrator , reaty to use for drug assay phenytoin assay 14 ml with calibrator , reaty to use for drug assay phenytoin assay 28ml with calibrator , reaty to use for drug assay valporic acid assay 14 ml with calibrator , reaty to use for drug assay valporic acid assay 28ml with calibrator , reaty to use for drug assay carbamazepine assay 14 ml with calibrator , reaty to use for drug assay carbamazepine assay 28ml with calibrator , rectangular staining jar – 10 in no. , red mercuric oxide 100 , red nucleic acid gel stain liquid (non mutagenic, non hazardous for disposal,highly stable and environmentally safe fluorescent nucleic acid dye for agarose gel electrophoresis) , reels auto clave tape reels , reels sterilization packaging reels 200 mtr 40 cmsreels , reels sterilization packaging reels200 mtrs 10 cmsreels , reels sterilization packaging reels200 mtrs 20 cmsreels , reinforced clostridial agar , resorcinol 50 g , ret search ii 1 ltr , reticulin stain kit 500 ml , reticulocyte counting fluid 250 ml blue coloured fluid solubility = miscible with water solubility test = passes test , rf 100 ml , rf latex calibrator 100ml , rhamnose disc , rhodamine b , riboflavin , rifampicin(antibiotic disc)5mcg (250 disc) , rifampicin 2 mcg (antibiotic disc) (250 disc) , rifampicin 25 mcg (antibiotic disc) (250 disc) , rifampicine 30 mcg (antibiotic disc) (250 disc) , rna extraction kit100 test , rna extraction kit50 test , rna extraction kit 250 test , rna zap pcr dna degradation solutions500 ml , rna later , rnase free water , rnase inhibitor 30 ml , rnase zap (250ml), cleaning agent for removing rnase , robo levels , rod glass rod each , roll bc robo 888 (thermal paper) 50 mm x 30 mm (robo roll) , roll tissue paper roll 15 mtrs , roll tissue paper rolls ( laboratory grade, 2 ply, 50 meter) , roll tsc priater carbon roll 5 (1/2) , roll tyvek roll – 10 ” rolls , roll tyvek roll – 15.5”rolls , roll tyvek roll – 6” rolls , rota virusfecal ag elisa 1 x 96 , rotary sealer nos. , rpmi 1640 for fungal testing 500 ml , rpr test kit – 100 test , rt pcr covid 19 rt pcr kit , rt pcr dengue serotyping rt pcr kit each , rt pcr h1n1 rt pcr 1 x 96 (1 pack) , rt pcr h3n2 amplification rt pcr 1 x 96 (1 pack) , rt pcr hpv rt pcr kit 1 x 96 t , rt pcr respiratory syncytial virus rt pcr 96 test , rt pcr rt pcr hbv dna viral load100 test , rt pcr rt pcr hcv rna viral load100 test , rt pcr superscript iii one step rt pcr kit – 100 r each , rt pcr zika rt pcr kit , rt pcr hbv dna viral load100 test , rt pcr hcv rna viral load100 test , rubber cork each , rubber for burette 3/8” , rubber teat round and large each , rubber teat each , rubber tubing 5/8” – each , rubella igg elisa 1 x 96 , rubella igm elisa 1 x 96 , ruler metallic scale inch and cm marking exactly on the ends measurement can begin at zero and scale at end for rule, stainless steel and round safety edge grinding and polishing and thicker side great value as 1 set of 3 length 6 inch to 24 inch material?stainless steel colour ?silver graduation range ?0 60 centimeters product dimensions ?61l x 2.5w centimeters , s 100 1 ml , sabroud dextrose agar 500 gm , sabroud dextrose agar with cap , saccharomyces cerevisiae , saccharose , safety goggle each , saffranin( prepared solution) 500 ml , saffranine 250 gm , safranine staining , salicylic acid 500 ml , salmonella poly o antiserum , salt1 kg. , sample cup 100 pc , sample processing cup each , sanidex opa withtest strip & deactivator, biodegradibility ,instrument compatibility report 5 ltr , saponin extra pure 100gm specification: mol. formula = na mol. wt. = na insoluble matter in water max. 0.1 % loss on drying ( 150°c ) = max. 10 % sulphated ash = max. 10 % microbial limits = passes test , saturated tartragine 500 ml , scaald mucosa sampler each , schiff reagent: 500ml specification : appearance clear colorless to slight pink colored physical state at 20 degree celsius liquid, ph<2density 1g/cm3,solubility in water(% weight) completely soluble , scrub typhus igm elisa 1 x 96 (1 pack) , sda 500 gm , sda 1000 gm , sda with cycloheximide 500 gm , selective enrichment secondary supplement for listeria , selective enrichment supplement for listeria , selective supplement for chromogenic listeria agar , selenite cysteine broth , selenite cystine broth base , serum copper kit 25ml , serum protein caibrator 100 ml , shelf life of 5 years 500 ml bottle , shikata orcein 100 ml , shoes cover 100 pc , sickle test kit 100 tests , sickle test kit 50 tests , silica gel for column chromatography 500 gm grade 60 120 mesh size, grade 100 200 mesh size, grade 230 400 mesh size, , silver allow 100 gm , silver nitrate 10% 100 ml , silver nitrate 5% 500 ml , sim media 250 gm , sim media 500 gm , slanetz and bartley medium , slide cavity slide for vdrl (24 wells) , slide concavity slide (one cavity) each , slide concavity slide (two cavity) each , slide double frosted slide 50pcs pkt , slide glass monocavity slide 25 mm x 75 mm x 1.3 mm each pack , slide glass slide – ground edges, refractive index isi 50 slides , slide microscope slides –(plain) 50 pcs clear glass ground edges 26x76 + 0/ 1 mm thickness – 1.35+ 0.1 mm 50 pcs/ pack , slide microscope slides –for i.h.c. each positively charge slides & positively charge slides hydrophilic treating with reagents such as aminosilane,poly l lysine or others , slide warming table , sma 1ml , sms wraps sheets 120 x 120cms sheets , sms wraps sheets 75 x 75cms sheets , soda lime 5 kg , sodium acetate 100 ml , sodium alphanaphthy phosphate 250 ml , sodium azide (nan3) 100 gm , sodium bicarbonate 500 gm • magnesium phosphate • deionized water • tungsto phosphoric acid hydrate • pas stain • pearl’s stain • mpo stain , sodium bicarbonate (nahco3) 150 gm , sodium carbonate (na2co3) 500gm(powder, =99.5%, acs reagent) , sodium chloride [ nacl ] 5 kg assay nlt = 99.9 % ph ( 5 % aqueous solution ) = 5.0 8.0 maximum limits of impurities • water insoluble matter = 0.003 % • bromide & iodide = 0.005 % • ferrocyanide = 0.0001 % • phosphate = 0.0005 % • sulphate = 0.002 % • total nitrogen = 0.001 % • arsenic = 0.00004 % • barium = 0.001 % • calcium = 0.002 % • iron = 0.0002 % • lead = 0.0002 % • potassium = 0.01 % • magnesium = 0.002 % • loss on drying = 0.5 % , sodium chloride 500 gm , sodium citrate500 gm , sodium citrate 3.2 % 500 ml , sodium citrate agar 500 gm , sodium deoxycholate 100 gm , sodium dichloroisocynanurate 500mg. excipeent q.s available chlorine 300mg, pack size: 50 tablets per bottle , sodium dichromate dihydrate , sodium dihydrogen phosphate 500gm , sodium dithionate 85 % extra pure 1 kg specification: mol. formula = na2s2o4 mol. wt. = 1/4.11 assay ( iodometric ) = 85 87.5 iron ( fe ) = max. 0.002 % ( at the moment of batch analysis ) , sodium dodecyl sulphate (sds) , sodium fauro cholate 500 ml , sodium fluoride powder 500 gm , sodium hydrogen sulphite , sodium hydroride 500 gm , sodium hydrosulphite(dithionite) 100 gm , sodium hydroxide (naoh) 500 ml , sodium hydroxide (naoh) 500 gm , sodium hydroxide based liquid alkali booster concentrate. ltr. , sodium hydroxide maximum 5% based bleaching agent 5 ltr. , sodium hydroxide pellets purified 500 gm , sodium hydroxide pellets purified 250 gm , sodium hydroxide(naoh) 500 ml , sodium hypochlorite solution 5 ltrs , sodium hypodiphosphate , sodium lauryl sulphate solution fo 94.haemoglobin estimation , sodium meta bi sulphate 500gm [ na2s2o5 , mol. wt. = 190.13] minimum assay ( iodometric ) = 95.0 % maximum limits of impurities • chloride = 0.1 % • iron ( fe ) = 0.01 % , sodium meta bi sulphate 65% based rinsing aid kg. , sodium nitrite 500gm(acs reagent, =97.0%) , sodium nitrite 500gmpowder or crystals (acs reagent, >96.99.0%) , sodium nitroprusside 100 gm , sodium nitroprusside 500 gm , sodium nitroprusside dihydrate for analysis 500 gmm = 297.95 g/mol specification: assay = 99.0 102.0 % substances soluble in water = 0.01 % chloride ( cl ) = 0.02 % sulphate ( so4 ) = conforms hexacyanoferrate ( iii ) = 0.02 % , sodium parborate monohydrate 50% w/w saniscop, 1 en 14561 bactericidal 2 ) en14562 pesticidal 3 ) en 13704 sporicidal 4 ) instrument compatibility report 5 ) en 14348 microbectericidal , sodium perborate monohydrate 50% w/w saniscop, 1) en 14561 bactericidal 2) en 14562 yeasticidal 3) en 13704 sporicidal 4) instrument compatibility report 5) en 14348 micobactericidal810 gm , sodium perchlorate (500gm) (acs reagent, >98.0%, in powder or chunk form) , sodium perchlorate monohydrate 500 gm , sodium phosphate dibasic (na2hpo4) (acs reagent, =99.0%) 500 gm , sodium phosphate dibasic dihydrate (na2hpo4) (250 gm) (acs reagent, =99.5%) , sodium phosphate monobasic dihydrate[ nah2po4 h2o ] assay nlt = 98.5 % ph ( 5 % aqueous solution ) = 4.2 4.6 maximum limits of impurities • chloride = 0.01 % • sulphate = 0.02 % • arsenic = 0.0001 % • iron = 0.002 % • heavy metals ( as pb ) = 0.0005 % • loss on drying ( 130°c ) = 21.0 24.0 % , sodium pyruvate , sodium taurocholate 500gm , sodium thiocyanate , sodium thioglycollate salt , sodium thiosulphate250 ml , sodium thiosulphate500 gm , sodium thiosulphate 2% 100 ml , sodium thiosulphate 5% 100 ml , sodium tungstate 250 gm , sodium tungstate dihydrate , solica get for thin layer chromatography 500 gm , soyabean casein digest agar (scda) , sparfloxacin(antibiotic disc)5mcg (250 disc) , spatula ayre”s spatula for cervical pap smear – sterile ayre spatula wood / plastic lenght: 18 cm / 18.8 cm individually packed in sterile pouch, in box of 100 , spatula sazaly – spatula with cyto brush (ratable 360deg) , spatula spatula chattaway 5” , spatula spatula one end flat , one endspour 12” , spatula spatula one end flat, one endspour 6” , spatula spatula both side 8” , spectinomycin(antibiotic disc) 100mcg (250 disc) , spiramycin 100 mcg (antibiotic disc) (250 disc) , spirit (burning ) 1 ltr , spirit (rectified) 500 ml , spirit alcohol5 ltrs , spirit lamp each , spirit lamp ss each , spirit(methylated) 500 ml , ssc 20 x buffer , stabilized formulation of hydrogen peroxide 10% v/v,silver 0.01% w/v for critical area fumigation and surface disinfection, non toxic, non irritating, eco friendly, pack size: 1 litre bottle , stabilized hydrogen peroxide (11 % w/v) diluted silver nitrate solution (0.01 % w/v) , staining reagent red panceaus stainer each , staining solution 500 ml , staining trough glass trough with cover, approx. 9 x 7 x 6.5 cm glass cover staining tray made of stainless steel staining tray made of stainless steel with extended handle staining trough , staining trough glass trough without cover glass cover staining tray made of stainless steel staining tray made of stainless steel with extended handle staining trough , staining trough( for bulk staining ) , staining trough plastictrough with cover, approx. 9 x 7 x 6.5 cm plastic cover staining tray made of stainless steel staining tray made of stainless steel with extended handle staining trough , stand e.s.r. stand 10 tube , stand loop stand each , stand pcr tube stand 48 pc , stand pipette stand 6 pcs capacity , stand test tube stand 12 tubes , stand test tube stand 24 tubes , stand tripod stand each , stand universal test tube stand 6 pcs capacity , staphylococcus aureus , starch 500 gm , starch sluble (acs grade) , steri pette xl , sterile connector for connnecting device each , sterilized yellow – 1000 pcs. , sticker 1500 sticker pack , stop watch – square design, plastic construction and lcd display show hour, minute, second, am / pm indicator, month, data, and day of the week select 12 or 24 hour user with chronograph stopwatches 1/100 second chronograph up to 23hours, 59 minutes, 59 seconds timer stopwatches alarm with 4 minutes snooze powered by one ag13 button cell (included) hourly chime function and alarm function are included nylon fabric neck strap for easy carrying split / reset, mode and start / stop buttons for convenient operation dial window material type: plastic dial display: digital , straight wire each pack , strains 250 ml , streptomycin (antibiotic disc)10mcg (250 disc) , streptomycin 300 mcg (antibiotic disc) (250 disc) , streptomycin 50 mcg (antibiotic disc) (250 disc) , strip tube retainer (should be certified dnase and rnase free, must hold 0.2ml 96 tubes or 12 strip tubes at a time ) , stromato lyser fba 5 ltrs , stromato lyser ffs 42 ml , stromatolyser fourth dl(4dl) 5 l , stroptozotocinz 500 gm , substrate for alp conjugated 2 ab tmb (3,3,5,5 tetramethylbenzidine) dab (3,3 diaminobenzine)tetrahydrochlor 5 gm , substrate for alp conjugated 2* ab nitro blue tetrazolium chloride (nbt) 1 gm , sucrose 500 gm , sucrose powder 250 gm , sucrose powder 500 gm , sudan black 500ml , sudan black b powder 250 gm , sudan black: 10gm specification: colour dark brown black, appearance (form) powder molar extinction coefficient @ 596nm ,min20,000 loss on drying max 5% , sudan black: 100gm , sudan black: 25 gm , sugar disc cellotrise 4% , sugar disc dulcitol 4% , sugar disc fructose 4% , sugar disc glucose 4% , sugar disc inositol 4% , sugar disc lactose 4% , sugar disc maltose 4% , sugar disc melibiose 4% , sugar disc ruffinose 4% , sugar disc sucrose 4% , sugar disc trehalose 4% , sugar disc xylose 4% , sulfadiazine 0.25 mcg (antibiotic disc) (250 disc) , sulfamethoxazole 23.75mcg (antibiotic disc) (250 disc) , sulfamethoxazole 23.75 mcg + trimethoprim 1.25 mcg (antibiotic disc) (250 disc) , sulfathiazole 0.25 mcg (antibiotic disc) (250 disc) , sulfisoxazole 0.25 mcg (antibiotic disc) (250 disc) , sulfolyser 5l , sulphosalic acid 500 gm , sulphosalicylic acid 500 gm , sulphur powder 500 gm , sulphuric acid (h2so4) 20 % 500 ml , sulphuric acid (h2so4) conc 500ml , sultax (cefoaximen + sulbactam) (antibiotic disc) p. size 5 x 250 , super mix 25ml each , supersensitive wash buffer 500 ml specification: concentrated wash buffer dilute 1 part with 19 parts deionised water. , swab stick – for pap smear 100 pcs , swab stick sterile swab stick with cover 100 pcs , syaptophysin 1 ml , syber safe(gel stain , dna) , sybr green pcr mix (500 reactions) , synaptophysin 1 ml , syphillis card , syphillis elisa 96 w , syringe filter (0 2) ul , system calibrator 100 ml , tank serological pipette tank , taq dna polymerase 500u (to be used in pcr reaction (500u minimum)) , taq polymerase each , tartaric acid 500 ml , t butyl alcohol 500ml , tcbs media 250 gm , tcbs media 500 gm , teicoplanin(antibiotic disc)30mcg (250 disc) , telithromycin 15 mcg (antibiotic disc) (250 disc) , tellurite cefixime supplement , temocillin 30 mcg (antibiotic disc) (250 disc) , temperature thermometer , ten parameter multistix for urinalysis 10 pack (100 strips/pack) specification 1. the pack size should be of 100 reagents strips per pack. 2. each reagents strips should be measure ph, specific gravity, protein, sugar, blood (both hemolyzed and non hemolysed), bilirubin, ketone, urrobilinogen, leukocytes, nitrite with or without ascorbic acid. 3.the reaction priniciple for each test should be accouding to the latest and validated testing method and as per recent advancement like peroxidase test for glucose, ehrlich test for urobiligone, fauchet test for bilirubin etc.4. each strips should be of long expiry.5. maximum analysis time for each reagent strips must be less than 2 minutes.6. the color production for every reaction will be bright enough so that analyzed adequately.7. the readings for every test must be provided in both semi quantitative and standad units.8. the color comparator provided with the pack should of standard quality with color shades exactly matching with what appears on the strips so that no discrepency between color of reagent strip and comparator will occur. , tetra methyl phenylene 250 ml , tetracycline (antibiotic disc) 30mcg (250 disc) , tetracycline 10 mcg (antibiotic disc) (250 disc) , tetracycline 5 mcg (antibiotic disc) (250 disc) , tetrathionate broth 500 gm , tetrazolium salt , thc 100 ml , thermofisher automated rna extraction kit , thiamin hydrochloride , thio urea 500gm , thioacetamide , thiosemicarbaxide 0.5 % 100 ml , thiosulfate citrate bile sucrose (tcbs) agar , thymol 1 kit , thymol blue 500 gm , tibc 150ml , ticarcilin (antibiotic disc)75mcg (250 disc) , ticarcilin –clavulanic acid (antibiotic disc)10mcg (250 disc) , ticarcilin –clavulanic acid (antibiotic disc)75mcg(250 disc) , tigecyclin (antibiotic disc)15mcg (250 disc) , tincture benzoin , tincture iodine , tips blue tips 500 pcs , tips filter tips 10 ul 100 ul , tips filter tips 10?l 96 tipes , tips filter tips 100 ul 1000 ul , tips filter tips 2 ul 10 ul , tips filter tips 20 ul 200 ul , tips filter tips 1000?l 96 tipes , tips filter tips 20?l 96 tipes , tips filter tips 200?l 96 tipes , tips filteredtips200 1000ul 96 t , tips sterilefiltered tips 01 10ul , tips sterilefiltered tips 02 20ul , tips sterilefiltered tips 100 1000ul , tips sterilefiltered tips 10 100ul , tips sterilefiltered tips 20 200ul , tips sterile filtered tips 1 50ul 96pc , tips sterile microtips (0.5 10ul) (clear pre sterile, nonfilter microtips) , tips sterile microtips (1000ul) (clear pre sterile, non filter microtips) , tips sterile microtips (20 200ul) (polypropylene, pre sterile, non filter, yellow microtips without tip box) , tips yellow tips – 1000 pc pack , tissue capsule /embedding cassette (large) , tissue capsule /embedding cassette (small) , tissue cassate leica 1000 pc , tissue embedding cassette – (large ) made from acetyl polymer resistant to histological solvents non cytotoxic, non metallic colors storage temp. room temp eachmeasures: 3x2.5x0.4 cm. , tissue embedding cassette – (small)made from acetyl polymer resistant to histological solvents non cytotoxic, non metallic colors storage temp. room temp each slot measures: 1 x 5 mm, total 128 slots per cassette , tissue freezing media 200 ml , titriplex , tobidine blue 250 gm , tobramycin (antibiotic disc)10mcg (250 disc) , toluene 250 ml , toluidine blue 100ml , torniquate 1 meter , total iron kit 150ml , total protein kit3 x 150ml , total protien csf / urine 100 ml , total rna isolation from blood(50 reactions) , tough spots assorted colours , toxo igg elisa 1 x 96 (1 pack) , toxo rapid igg/ igm 50 tests , transferin 1 kit , tray draining tray it should be madeup of polycarbonate, autoclavable, dimention should be (mm) 400x300x100 (lbh) , tray ice tray each , tray slide tray , tray tray 3000ml , tray utility tray each , tri sodium citrate dihydrate purified 250 gm , tri sodium citrate dihydrated purified 500 gm , tributyrin agar , trichlorgacetic acid 500 ml , trichloro acetic acid (250g) (acs reagent, =99.0%) , trichrome stain( masson kit): specification : aniline blue solution 250mlbiebrich scarlet acid fuschin solution 250ml phosphomolybdic acid solution 250ml phosphotunngstic acid solution 250ml , trifluoroacetic acid , triglyceride kit 2x150ml , triglycerides 100 ml , trimephoprim(antibiotic disc)5mcg 250 disc , trimolol 0.25% , trimolol 5% , triphicasepepten 250 gm , triple sugar iron agar 500 gm , tripple enzymatic cleaner , tris base 500 gm , tris buffer 500 g , tris buffer (0.2 mol/l)plt 9.0 – 500 ml , tris hydrochloride 100 gm , tris hydrochloride 250 gm , tris powder (500gm) (acs grade, for molecular biology use) , tris chloride 500gm , tris saturated phenol , triton x 100 , trizol (500ml) (to be used for isolation of rna, dna, and protein ) , troporine i stripe 10 t , trypsin powder 250 gm , tryptic soya broth , tryptone broth , tryptone soya yeast extract agar , tsi 1000 gm , tsi 250 gm , tsi 500 gm , tube 15 ml falcon tubes(sterile, conical bottom, autoclavable,medical grade pp/hdpe confirming to usp class vi) , tube 50 ml falcon tubes (sterile, conical bottom, autoclavable,medical grade pp/hdpe confirming to usp class vi) , tube acd buffer tubes (9ml yellow capped tube filled with acd buffer (anticoagulant) to be used for blood collection) , tube blood rna tube (blood transport tubes for rna stability, containig 50 tubes per pack) , tube capillary tube 100pcs pack , tube centrifuge tube 10 ml , tube centrifuge tube 15 ml , tube conical falcon graduated 15 ml each , tube conical falcon graduated 50 ml each , tube culture tube 10 x 100 mm – each , tube cylindrical glass tubes for column chromatography each , tube dreyers tube 500pcs , tube durhams tube 1inch size 1000 pcs , tube felix tube 500 pcs , tube hemoglobin round tube each , tube hemoglobin square tube – each , tube hemoglobin tube (german) pcs , tube id sample tube 96w , tube kahn test tube 100 pcs pack , tube mcfarland tube with autoclavable cork , tube microcentrifuge tube 0.5ml (sterile, clear, should have frosted cap surfaces for labeling) , tube microcentrifuge tube 1.5ml (sterile, clear, should have frosted cap surfaces for labeling) , tube microcentrifuge tube 2.0ml (sterile, clear, should have frosted cap surfaces for labeling) , tube microcentrifuge tube amber microcentrifuge tubes 1.5ml (sterile, brown color mct tubes) , tube pcr 0.2 ml strip tubes with cap (8 tube strip)(it should be madeup of polypropylene, each strip should contain 8 tubes, must supplied with separate domed cap strip ) , tube pcr strips tubes (200 ul) with flat caps [500 strips]( packs)(polypropylene pcr tube, 0.2ml, 8 tubes/strip, dome caps should be supplied separately (not attached to the tubes)) , tube pcr tube with cap 0.1ml– 100 pc , tube pcr tube with cap 0.2ml – 100 pc , tube pcr tube with caps 0.1ul strip , tube pcr tube with caps 0.2ul strip , tube robo tube each , tube test tube size – 12 x 75 mm 100 pc pack size , tube test tube size – 12x 100 mm 100 pc pack size , tube test tube size – 13 x100 mm 100 pc pack size , tube test tube size – 15 x125 mm 100 pc pack size , tube test tube size – 16 x150 mm 100 pc pack size , tube test tube size – 18 x150 mm 100 pc pack size , tube test tube size – 20 x150 mm 100 pc pack size , tube test tube size – 25 x150 mm 100 pc pack size , tube tissue carrier rna tube , tube treated tubes , tube tube with transparent label 1000 each , tube wintrobetube , tube leveler , tween 20 100ml , tween 80 100 ml , typhidot igm test kit 50 tests , typhidot test (rapid test kit) for typhoid fever 50 test , udp glucose (250mg) (% purity (hplc) > 98) , uibc 100 ml , uracil dna glycosylase(1 vial of 1 unit/ ul 200 ul) , urea 100 ml , urea 250 gm , urea 500 gm , urea kit 2x150ml , urea solution 40 %5ml , uric acid 100 ml , uric acid kit 2x150ml , urinalysis control 5 ml , urine calibrator 100 ml , urine chemistry control 5 ml , urinometer each , uristrix 100 t , uv safety goggles 96w , valproic acid 100 ml , vancomycin(antibiotic disc)35mcg (250 disc) , vancomycin powder 50gm , varicella zoster igm (ab) elisa 1 x 96 , vial bomin vial 10 ml each , vial cryo vial 1.0 ml 1000 pcs 1pkt , vial cryo vial 1.8ml (each pack 500 vials) , vial cryo vial 5ml 500 pc , vial disposable vial – 100 pcs. , vial edta vial (vaccum) 100 pcs. , vial edta vial(non vaccum) 100 pcs , vial fluid vial 100 pcs , vial lithium heparin vacutainer (green) 100 pcs , vial plain (red non vaccum) 100 pcs , vial plain vial 100 pcs pack , vial plain vial 5 ml glass 100 pcs , vial plain vial(white) 5 ml 100 pcs pack , vial proteinase k 20 mg ( vial) , vial ria vial each , vial s.s.t tubes (yellow/ gold) 100 vials , vial sodium citrate 3.8% vial (e.s.r non vaccum) 100 pcs (black) , vial sodium citrate 3.8% vial (e.s.r vaccum) 100 pcs (black) , vial vacutainer with transparent level(yellow): gel 100 pcs , vial vacutainer with transparent level: oxo – flo/glucose (grey) 100 pcs , vial vacutainer with transparent level: plain (red) (clot activator) 100 pcs , vial sodium citrate 3.2 % vial (ptinr) 100 pc (sky blue) , victoria blue 1.5 % 500 ml , vimentin 1 ml , violet red bile glucose agar , von kossa stain 100 gm , voriconazole powder (solubilized powder, g irradiated ) , vortex , vp reagent 100 ml , vtm / utm 96 w , w.b.c diluting fluid 500ml appearance = bluish violet coloured physical state @ 20°c = liquid odourless ph = 2.5 3.5 absorption max. 588 594 nm absorption ( ? max. diluted 1.25, 1cm ) = 0.450 0.600 , wash concentrate 100 ml , wash solution 5 ltr , weigerts iron hematoxylin 25 gm , west nile igm elisa 1 x 96 , white petroleum jelly (white vaseline) 100 gm , white petroleum jelly (white vaseline) 250 gm , whole blood extraction kit 250 test (1 pack) , widal antigen( for tube method ) 4x100ml , widal antigen (for slide test) 4x100ml , wipes 0.5% ahp based high level surface disinfectant tuberculocidal wipes wipes , wipes kim wipes each , wipes tissue wipes ( big towels packs) (size 37cm x 42cm. should be made from 100% virgin fiber,low lint and low extractable. for sensitive instrument/lens cleaning.) , wipes tissue wipes ( small towels packs) (size 21cm x 11cm. should be made from 100% virgin fiber,low lint and low extractable. for sensitive instrument/lens cleaning.) , x ray developer 1 kg , x ray fixer 1 kg , xld media 500gm , xtum (ceftriaxone + sulbactam) (antibiotic disc) p. size 5 x 250 , xylene 2.5 ltrs (specification: boiling range (95%) = 137°c 142°c weight per ml at 20°c = 0.850 0.865 nvm = 0.01% max. solution in alcohol = clear) , xylene 250 ml , xylene 500 mlc6h4(ch3)(specification: boiling range (95%) = 137°c 142°c weight per ml at 20°c = 0.850 0.865 nvm = 0.01% max. solution in alcohol = clear) , xylene cyanol 10 gm , xylocaine 2% 25 ml , yeast nitrogen base 500 gm , zinc chloride , zinc oxide 500gm , zinc powder 500gm , zinc sulphate 500gm , zn stain fast kit 250 ml , zymokeen ltr. , list of reagents (dedicated system pack for erba em 360) fully automatic biochemistry analyzer (instruction : all parameters should be quotedby bidder) , glucose 100 ml , urea 100 ml , creatinine (enzymatic) 100 ml , uric acid 100 ml , total bilirubin 100 ml , direct bilirubin 100 ml , sgpt 100 ml , sgot 100 ml , lipase 100 ml , amylase 100 ml , alkaline phosphatase 100 ml , total protein 100 ml , albumin 100 ml , calcium 100 ml , phosphorus 100 ml , total cholesterol 100 ml , hdl cholesterol 100 ml , triglyceride 100 ml , direct ldl cholesterol 100 ml , iron 100 ml , ferritin with calibrator 100 ml , ferritin control level 1 100 ml , ferritin control level 2 100 ml , uibc/tibc 100 ml , ck nac 100 ml , crp quantitative with calibrator 100 ml , rf quantitative with calibrator 100 ml , ldh 100 ml , gamma gt 100 ml , micro albumin with calibrator 100 ml , micro protein with calibrator 100 ml , quality controll1 100 ml , quality controll2 100 ml , system multi calibrator 100 ml , crp/rf c(quality control , crp, rf) 100 ml , list of reagents dedicated system pack for dirui cst240 fully automatic biochemistry analyzer(instruction : all parameters should be quotedby bidder) , glucose 100 ml , urea 100 ml , creatinine (enzymatic) 100 ml , uric acid 100 ml , total bilirubin 100 ml , direct bilirubin 100 ml , sgpt 100 ml , sgot 100 ml , lipase 100 ml , amylase 100 ml , alkaline phosphatase 100 ml , total protein 100 ml , albumin 100 ml , calcium 100 ml , phosphorus 100 ml , total cholesterol 100 ml , hdl cholesterol 100 ml , triglyceride 100 ml , microalbumin with calibrator 100 ml , microprotein with calibrator 100 ml , quality controll1 100 ml , quality controll2 100 ml , system multi calibrator 100 ml...

Bharat Coking Coal Limited - Jharkhand

39448927 bids are invited for boq bid item1 bag polyprope lene, 30 x 20in, f by cement item2 rope 8mm, nyln item3 siren elec 3 point 25 km range item4 mesh wire, 1inx1inx3ft item5 life jacket, part no 800293 total quantity : 8704...

Health Department - Jharkhand

39447878 purchase of items for hwcs purchase items for hwcs , functional refrigerator 195 ltr. , boiler or autoclave small size , dressing drum with lid , mattress , kellys pads , torch / torch box type pre focused ( 4 cell ) , examination lamp , wall clock with all hands , iv stand , sunction machine electric / foot operated suction apparatus , oxygen cylinder with troly , oxygen set ( mask with tubing ) , bp apparatus , adult stethoscope , fetoscope / doppler , basin 825 ml ss , hub cutter , needle destroyer , digital thermometer , gauze cutting scissor stratight , weighing machine ( infant ) , weighing machine ( adult ) , thermometer rectal , dental probe , nebulizer , measuring tape , tallquist hb scale , snellen vision chart , near vision chart , stadiometer ( height measurement ) , sims retractor / depressor , kellys heamostat forceps straight 140 mms , vulsellum uterine forceps curved 25.5 cm , cusco’s / graves speculum vaginal bi valve small, , cusco’s / graves speculum vaginal bi valve medium , cusco’s / graves speculum vaginal bi valve large , plain forceps , tongue depressor , mouth gag , dental probe , mouth mirror , cheatle forceps , dressing tray with lid , suturing tray with lid ss small , suring needle curved , suturing thread , round slit ( hole ) towel , ambu bag , mask neonatal size ( 0 ) , mask neonatal size ( 1 ) , baby weighing scale , new born thermometer , oxygen hood ( neonatal ) , designated new born tray ss with lid , ss tray with cover , scissors , artery forceps , sims speculum veginal double ended iss mediam , cord cutting scissor / surgical blade for cutting cord , bowl for antiseptic solution , kidney tray ( small ) , kidney tray ( big ) , episiotomy scissor , allis forceps , toothed forceps , thumb non toothed forceps , needle holder , suture needle straight 10 , suture needle curved , cuscoss / graves speculum vaginal ( large ) , cuscoss / graves speculum vaginal ( medium ) , cuscoss / graves speculum vaginal ( small ) , sponge holding forceps / cheatle forceps , ppiucd insertion forceps , uterine sound ( for iucd ) , airway , labour table , rack / table for keeping trays, fluids , delivery troly , foot step , stool , screen seperator with stand , almira , rack for keeping sleepers / shoe covers outside labour room , cot , pillow , pillow cover , side locker , bed sheets , blankets , office table , chair , examination table , mattress for examination table , bucket big , bucket small , mugs , chairs for waiting area ( three in one set ) , led tv for iec , white wrighting board , syringes ( 20 cc , syringes 10cc , syringes 5cc , syringes 2cc , ad syringes ( 0.5ml , ad syringes ( 0.1 ml ) , disposable masks , sterile surgical gloves , gown / apron , shoe cover , caps , mucous extractor , disposable cord clamp , heavy duty gloves , foleys catheter , disposable sterile urethral catheter ( rubber plain 12 fr ) , disposable lancet ( pricking needles ) , routine immunization monitoring chart , blank immunization cards / joint mch card ( one per pregnant mother ) and tally sheets ( one per immunization session ) , interdental cleaning aids , chlorine tablets , sanitary napkins , 200 watt bulb ( 2 ) , salt – iodine test kit , wooden spatula , dry cell / battery , partograph in case sheets , iv cannula 16 , iv cannula18 , iv cannula 20 , iv cannula 22 , iv set , sanitary napkins , mackintosh sheet 5 meter , disposable delivery kit for delivering hiv patients ( emergency ) , disposable delivery kit for normal delivery , 5 l plastic tub for keeping chlorine solution , bucket for keeping 1% chlorine solution ( for spillage ) , colour coded bins yellow , colour coded bins red , colour coded bins black , colour coded bins blue , colour coded plastic bags ( yellow, red, blue and black ) , insecticide treated nets , mopping stick , micropore tape , urine bags , sheets for drying and wrapping baby , feeding tube , cleaning material and detergents , insectiside treated net , window screens , chlorine tablets , inter dental cleaning aid , 200 watt bulb , online ups 1 kva with 60 minute backup , fire extinguisher , hand towels , soap , towel , gauze piece ( roll ) , cotton swab ( roll ) , tuning fork , ice pack box , vaccine carrier , floor mopping stick , dari with room size. , mats for yoga , curtains , micropore tapes* , urine bags* , slide drying rack , specimen collection bottle , spirit lamp , test tube holding clamp , test tube rack , test tubes , wooden spatula , glass rods , glass slides , kit for testing residual chlorine in drinking water , rapid pregnancy testing kit , rapid test kit for dengue , rapid test kit for malaria , n / 10 hydrochloric acid , reagents such as hydrochloric acid, acetic acid, benedict’s solution, bleaching powder, hypochlorite solution, methylated spirit etc. , acetic acid solution , micropippette , yellow tips for micropipette , dipsticks for urine test for protein and sugar ( 1 container of 25 strips ) , whole blood finger prick hiv rapid test and sti screening test each , h2s strips test bottles for water testing , salt iodine tesitng kit , talquish hb scale....

Central Coalfields Limited - Jharkhand

39436983 bids are invited for push on straight through cable jointing kit for 3x35sq mm cable , push on straight through cable jointing kit for 3x50sq mm cable , push on straight through cable jointing kit for 3x70sq mm cable , push on end termination pole mounting outdoor cable jointing kit for 3x35sq mm cable , push on end termination pole mounting outdoor cable jointing kit for 3x50sq mm cable , pg clamp for dog conductor , pg clamp for rabbit conductor , greeper suspension for bolt type , fibre glass discharge rod 11 33kv 3x5ft with rubber grip wire and convas carrying bag total quantity : 343...

South Eastern Railways - Jharkhand

39407109 supply of 29168326 m 48 kit for air dryer of trident make to model no. ld 2000120, m 48 kit for air dryer of trident make to model no. ld 2000120 consisting of 14 items. ( 1 ) filter element ( trident part no.ad433 ) =01 no. ( 2 ) cup top filter ( trident part no.cd668 ) =01 no. ( 3 ) cup bottom filter ( trident part no.cd669 ) = 01 no. ( 4 ) spare kit filter bottom ( trident part no.as443 ) =01 no. ( 5 ) spare kit valve double poppet ( trident part no.as444 ) =01 no. ( 6 ) filter element m250y ( trident part no.ac077 ) =01 no. ( 7 ) spare kit valve shuttle ( trident part no.as445 ) =01 no. ( 8 ) spare kit for purge valve ( trident part no.as446 ) =01 no. ( 9 ) bag cartridge desiccant ( trident part no.cd671 ) =02 nos. ( 10 ) spring compactor ( trident part no.cd673=02 nos. ( 11 ) spare kit seals tower ( trident part no.as447 ) =01 no. ( 12 ) sub assly humidity indicator 3 r 1 ( trident part no.ad925 ) =02 nos. ( 13 ) gasket pad amisco solenoid valve ( trident part no.as079a ) =02 nos. ( 14 ) spare kit seals controller box ( trident part no.as709 ) =01 no. [ warranty period: 30 months after the date of delivery ] electic loco shed stores / bksc , jharkhand 5.00 set ser electric loco in stores / bksc , ser jharkhand 3.00 set electric loco shed stores / bndm , odisha 24.00 set ser electric loco shed stores / kgp , west bengal 12.00 set ser...

Nagar Panchayat - Jharkhand

39380567 tender for supply of alum(20kg per pics) bleaching(25kg per bag.) oil immersed manually operated star delta starter (bentex skn 30hp, 3phase, 415 volts., 42amp.) ....

Nagar Panchayat - Jharkhand

39349381 tender for supply of basic equipment and stationary: pulse oximeter gluco meter hemoglobin meter stethoscope bp machine digital weight machine digital height meter thermometer digital register large register medium bed side screen emergency drug tray nebulizer machine fire extinguisher ambu bag iv stand tongue depression mouth gag inverter with battery tobler dust bin color coded bin sharp container towel suction machine foot step nebulizer torch mop a4 paper pen bucket mug baby weight machine digital...

Jharkhand State Forest Development Corporation Limited - Jharkhand

39329713 tender for netlump sum amount ( shuddh ek musht rashi ) basisfor sale of old kendu leaf lots of 2022 and before. 1 old stock of kendu leaf 2 m.f.p.p. range lohardaga 3 rr lohardaga a / 2021 4 m.f.p.p. range ranchi 5 rr burmu / 2021 6 m.f.p.p. range simdega east 7 rr simdega east a1 / 2021 8 rr simdega east e / 2021 9 m.f.p.p. range chandwa 10 rr balumath c2 / 2021 11 rr chandwa c / 2021 12 m.f.p.p. range chaibasa 13 seized / 2022 14 m.f.p.p. range chakradharpur 15 seized / 2023 16 m.f.p.p. range kundri 17 hd kundri d2 / 2020 18 hd kundri c1 / 2021 19 hd kundri c2 / 2021 20 hd kundri d1 / 2021 21 m.f.p.p. range manatu 22 hd manatu c1 / 2021 23 hd manatu c2 / 2021 24 hd manatu d1 / 2021 25 hd manatu e2 / 2021 26 m.f.p.p. range daltonganj 27 hd patan a2 / 2021 28 hd patan c / 2021 29 m.f.p.p. range manika 30 hd manika d1 / 2021 31 m.f.p.p. range latehar 32 hd latehar a / 2021 33 hd latehar b / 2021 34 hd latehar c / 2021 35 m.f.p.p. range bhandaria 36 hg kutku b / 2019 37 m.f.p.p. range nagar 38 hg nagar e / 2021 39 m.f.p.p. range ranka 40 hg ranka east ( p ) b / 2021 41 m.f.p.p. range bhawanathpur 42 hgbhawanathpur b / 2021 43 hgbhawanathpur c2 / 2021 44 hgbhawanathpur d / 2021 45 m.f.p.p. range mohammadganj 46 hgmohammadganj a1 / 2021 47 hgmohammadganj b / 2021 48 m.f.p.p. range chauparan 49 hh barhi b / 2021 50 hh barhi c / 2021 51 m.f.p.p. range koderma 52 hh domchach b / 2021 53 m.f.p.p. range hazaribagh i 54 hh mandu / 2021 55 m.f.p.p. range hazaribagh ii 56 hh tandwa a / 2021 57 hh barkagaon a1 / 2021 58 hh barkagaon b2 / 2021 59 m.f.p.p. range partappur 60 hh partappur c / 2021 61 hh partappur e / 2021 62 m.f.p.p. range chatra 63 hh rajpur a / 2021 64 hh rajpur b / 2021 65 m.f.p.p. range kunda 66 hh kunda b / 2021 67 hh kunda c1 / 2021 68 m.f.p.p. range pakur 69 hgd hiranpur a / 2019 70 m.f.p.p. range sahebganj 71 hgd rajmahal damin ( p ) a / 2017 ( 854.560 st. bag ) hgd rajmahal damin ( p ) c & mandro / 2017 ( 557.700 st. bag ) 72 m.f.p.p. range jamua 73 hgd doranda / 2021...

East Central Railway - Jharkhand

39288373 supply of loco pilot tool kit pocket type bag with cover , belt and cover lock , size 14 x 9 high quality semi water proof lather [ warranty period: 30 months after the date of delivery ] ...

Rural Works Department - Jharkhand

39278153 bids are invited for patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold beedsheet screen , bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , iv stand , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , scessior medium , a 4 paper white , pen , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register or book , pillow , pillow cover , floor wiper rubber , floor wiper jut , door mat , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , garbage poly bag black 10 kg , garbage poly bag red 10 kg , hand wash liquid , hand wash soap , water bottle 1 ltr. , tiolet cleaning brush , bed sheet , plastic chair , led tube light , led bulb t shape , desktop computer , webcame , speaker total quantity : 776...

South Eastern Railways - Jharkhand

39272854 supply of spare parts, seal kit bag for telescopic jack low construction model no.rtj65 250 2 ( 65 / 27t ) , as per drawing attached with part no. : d600200141. [ warranty period: 30 months after the date of delivery ] , seal kit bag for telescopic jack high construction model no.rtj139 415 2 ( 139 / 65t ) , as per drawing attached with part no. : d100020141. [ warranty period: 30 months after the date of delivery ] , seal kit bag for telescopic jack low construction model no.rtj139 250 2 ( 139 / 65t ) , as per drawing attached with part no. : d100020141 [ warranty period: 30 months after the date of delivery ] , seal kit bag for displacing jack model no.rsj17 09 720 ( traversing jack ) , as per drawing attached with part no. : f171100071. [ warranty period: 30 months after the date of delivery ] , seal kit bag for telescopic jack high construction model no. rtj65 415 2, ( 65 / 27t ) , as per drawing attached with part no. : d600200141. [ warranty period: 30 months after the date of delivery ] , seal kit bag for pulling / haulage jack model no.rpdp 23 450, as per drawing attached with part no. : g230100281. [ warranty period: 30 months after the date of delivery ] , seal kit bag for tilting jack ? model no.rtlt 400, as per drawing attached with part no. : f171600091 [ warranty period: 30 months after the date of delivery ] , seal kit for axle pusher, as per drawing attached with part no. : f101800100. [ warranty period: 30 months after the date of delivery ] , seal kit for step jack model no.rsj 1090 1, as per drawing attached with part no. : e351100122. [ warranty period: 30 months after the date of delivery ] , spares list for control console / control table model no.: pcd490 4, as per drawing attached with part no. : b000000100. [ warranty period: 30 months after the date of delivery ] , spares list for hand pump model no: hp 02 49 / 2.8, as per drawing attached with part no. : a100300100. [ warranty period: 30 months after the date of delivery ] , spares list for 5.5 hp power pack pump set with petrol engine, as per drawing attached with part no. : pep5500010. [ warranty period: 30 months after the date of delivery ] ...

Rural Works Department - Jharkhand

39272407 bids are invited for patient bed , patient bed mattress , bed side locker , revolving stool steel , examination table , foot step , wheel chair , office table , office chair , 3 seater running chair steel , almira , iron self rack , 3 fold beedsheet screen , bp machine digital , bp machine mercery , thermometer digital , weight machine adult , weight machine infant , stethoscope , hub cutter , medicine tray , cotton roll , leukoplast tap 1.25 cm , leukoplast tap 5 cm , iv stand , gloves 6.5 , register 4 , register 6 , register 10 , register 12 , scessior medium , a 4 paper white , pen , fly leaf , stapler with pin small , stapler with pin big , panching machine , paper weight , wall clock , stamp pad medium blue , fevi stick big , plastic scale , link lock 45 , link lock 55 , opd register , opd slip , attendance register , stock register , visitor register or book , pillow , pillow cover , floor wiper rubber , floor wiper jut , door mat , harpic 1 ltr. , colin spray , broom phul , broom nariyal , phenyl , phenyle goli , dustbin with cover , plastic bucket big , plastic bucket medium , plastic bucket small , plastic mug , colour coded bin waste disposable buckets , garbage poly bagblack 10 kg , garbage poly bag red 10 kg , hand wash liquid , hand wash soap , water bottle 1 ltr. , tiolet cleaning brush , bed sheet , plastic chair , led tube light , led bulb t shape , desktop computer , webcame , speaker total quantity : 776...

Rural Development - Jharkhand

39266505 tender for supply of aajeevika pasu sakhi kits 1 small castrator (burdizo) 26 2 thermometer 26 3 surgical scissor 26 4 surgical forceps (tissueforceps) 26 5 teeth cutter (teether) for pigs) 26 6 hoop cutter 26 7 vaccine box 26 8 saree for pashusakhi 26 9 bag for medicine 26 10 measuring tape – 5ft 26 11 identity card holder 26 12 cap 26 13 torch 26 14 electronic weigh balance, hanging type(50kg) 26 15 electronic weigh balance, non hanging type (4 5 kg) 26...

East Central Railway - Jharkhand

39266453 supply of discharge / earthing rod for 25kv ac traction with top clamp ( suitable for 36 to 50mm bus bar ) and 10 mtrs, cable with earthing clamp complete as per rdso specification no. et1 / ohe / 51 ( 9 / 87 ) with a & c slip no.1 with rugged canvas bag for each discharge rod. [ warranty period: 30 months after the date of delivery ] ...

Welfare Department - Jharkhand

39132329 request for quotation for partner empanelment for supply of nicu nursing infrastructure 1. infant baby warmer with stand (supply, installation and demonstration) micro controller based electronics controls: servo skin/manual mode pre warm: use the equipment with 30% heater output in manual mode. no need of calibration required for temperature probe. high intensity quartz/calrod heating element for effective radiation halogen observation lamp parabolic reflector design to send uniform heat to the bed surface. memory backup to restore set temperature and previous mode, in case of power failure. optimum bed dimensions ensure optimum work space for the nursing staff. comprehensive alarms and safety cut offs. instant warming and uniform heating & short wave heater ensures instant warming automatic safety heater cut off at 39 c in any mode controller electronics: high speed micro controlled mode of operation: servo skin, manual skin mode control range: 30.0 38.0°c. manual mode timer: 1 min 15 min (selectable) percentage of heater output: 10% 100% in 10% increments memory back up: equipment restores the previous settings programmable mute time: the user can select the mute time safety heater cut off: if the skin sensor is removed from the babys skin over temperature heater cut off: if the skin temperature is>39°c in any skin/manual mode temperature sensor (probe): thermistor sensor accuracy of skin sensor: ±0.1°c accuracy of skin probe interchangeability: ±0.2°c power rating : ~230v, 50 hz max. heater wattage: 600 watts max. power requirement : 700 watts examination lights : 12v, 50w halogen lamp 2 castor 4 nos (2 with brake & 2 without brake) monitor shelf : 1 no should have provision to keep undersurface phototherapy light. height adjustable operating noise level : <50dba alarms skin sensor is removed from the babys skin skin temp high : >1.0°c.from the set temperature, skin temp low : < 1.0°c.from the set temperature, skin temp probe fail: if the skin probe is short or fail over temperature: if the skin temp. is >39°c, heater fail system fail: electronic component defect environment operating temp: 15.0°c to 35.0°c, storage temp : 20.0°cto 60.0°c, operating humidity: 5% to 90% rh, non condensing storage humidity : 0% to 99% rh, non condensing altitude: sea level to 1.9 miles quality: iso 13485:2016 electrical & product safety : : iec 60601 1 & iec 60601 1 2 , iec 60601 2 21 , iec 60601 2 50 should have complied with european ce 93/42 eec standards certification from a notified body. preferred make: make: dre/neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care/ibis/kenmark/david/trimpeks/frontline/fanem. 2.baby incubator for nicu(supply, installation and demonstration) thermal performance: consistent air temperature. bi directional air flow. internal noise level: low operating sound levels assure a developmentally supportive environment for infants. double wall hood: double wall hood is designed to decrease radiant heat transfer between the baby and the incubator wall. the inner wall can be easily removed for cleaning without the use of tools. air screen: the air screen creates a barrier of warm air when the access panel is open. electrical electrical connection : ac 230 v, 50 hz, max power rating : 370va max incubator with fixed/variable height heater power rating: 300w, electronics : micro controller with sell test function mute time: 2 min 20 min programable, incubator control modes : servo air and servo skin co2 level with in the hood : less than 0.8% when mixture of co2 in air is delivered at 750ml/min at a point 10cm above the center of mattress temperature accuracy skin /air mode : accuracy ± 0.2 c max temperature : 39°c warm up time : 25 35 min per 10°c (at 23°c ambient temperature) initial temp overshoot : <1.0°c.temperature uniformity : <0.8°c sensor : thermistor probe interchangeability : accuracy ± 0.2°c (calibration not required) noise level inside incubator : <60 db) air velocity over the bed : <10 cm/sec (at 10cm above the center matress) relative humidity : >80% at 10 cm over bed center air filter capacity : 99% (0.5) air intake volume with filter: 25 l/min μ & without filter 250l/min bed tilting (tilting by c clamp) :± 8°up/down set temperature range air mode : 20°c to 37°c, 37.1°c to 39°c temperature override mode skin mode : 30°c to 37°c, 37.1°c to 38°c temperature override mode oxygen concentration oxygen input 5 lpm : 25% to 45% 0₂ oxygen input 15 ipm : 45% to 70% 0₂ humidification : low/high <80% skin temperature low/ high air temperature high / low alarms failure of air, air flow, heater, skin probe, air probe, system, power temperature 39 in any mode safety heater is electronically cut off if air/skin temperature inside the incubator exceeds 39.0°c iec 60601 1 specification type of protection against electric shock: class 1 mode of operation: continuous electrical safety: iec 60601 1 & iec 60601 1 2 , iec 60601 2 19, weight : min 50 kg height of bed from floor : 900 mm dimensions of bed : 700 mm x 400 mm castors : 4 diameter antistatic (2 locking and 2 non locking) iv maximum load : 1.5 kgs maximum monitor load : 3.0 kgs maximum baby weight to be: 5.0 kgs should have complied with ce> preffred make: neotech/zeal/v care/ibis/kenmark/frontline/sst/electromeg/comen/bistos/fanem/vng/phoenix/ziraffe/bpl/dragor 3. baby bassinet / baby cradle for nicu (supply, installation), to be used with phototherapy light. the system should be detachable fire retardant enclosure for light source adjustabble height should have provision to undersurface phototherapy can be used with standing phototherapy the unit can also be usable as observation trolly. bed size approximate: 50x75 cm height : adjustable from 400 to 600 cm the units should have anti static 2” castor 4 nos, 2 with brakes. 4. phototherapy unit(standing with stand) , moveble with 2 4 wheels the leds of each unit should be therapeutic high wattage blue & white leds, min 12 nos the wavelength should be between 455 to 465nm the high irradiance at skin level should be > 45μw/cm2/nm at a distance of 30 cm should have an uniformity ratio of > 0.40 the led lamps used should be rated to last up to 20,000 hrs should have dual digital cumulative hour timer for led usage and patient exposure the light source system should have overheat protection with power cutoff for temperature uniform light distribution led unit tilt up to 90 degree and allowing use with warmer iec 60601 1 specification type of protection against electric shock : class 1. 5. undersurface phototherapy light the leds of each unit should be therapeutic high wattage blue & white leds, min: 12 nos the wavelength should be between 455 to 465nm the high irradiance at skin level should be > 45μw/cm2/nm at a distance of 30 cm should have an uniformity ratio of > 0.40 the led lamps used should be rated to last up to 20,000 hrs treatment timer ensures auto cut off when elapsing the set time no infrared rays ensures minimize the water loss should have dual digital cumulative hour timer for led usage and patient exposure the light source system should have overheat protection with power cutoff for temperature uniform light distribution led unit can be usesable with warmer iec 60601 1 specification type of protection against electric shock : class 1. 6 neo ventilator (hfo) (supply, installation and demonstration) 1. invasive, non invasive , o2 theraphy(hfnc) 2. min 13 large color touch display 3. basic modes: vc ac, vc simv, pc ac, pc simv, cpap psav + advance mode ( prvc, aprv, bipahasic , mmv) 4. ncpap, nippv modes for neanates 5. inbuilt nebuliser 6. 3 wave forms/ 3 loos/trends 7. 32 patient parameter 8. inspiratory hold/expiratory hold/po.1 /intrinsic peep, lung recruitment maneuver (p v tool), proportional pressure support cerification: ce certified, iso and iec certified prefferred make: acutronics/bpl/hamilton/schiller/maquet servo/ge/comen/philips/drager/siemens/medisys/vyaire/tecme/metran/fanem/getinge/briovent/advin/narang/skanray/lifeline/billicare/magnamed/sle/medi/ honmed/ medtronic/resmed/smith/becton/mindray/trivitron/medtronic/resmed/newport/ 7 bubble cpap (supply, installation and demonstration) should have latest technology and capable of giving bubble cpap therapy to neonates for preterm and term babies weighing from 400 gms , also capable of giving hfnc therapy to neonates and pediatric cases. machine should have options to be used as bubble cpap, hfnc, nasal cpap and t piece resuscitator should have lcd touch screen 4” & above graphical display should have digital real time airway pressure monitoring and displayed on screen should have digital real time fio2 monitoring and displayed on screen should have built in compressed air source & no external air compressor should be required or mounted on trolly or taken from central air source should work with low flow oxygen input with maximum input flow of 15lpm and 1 bar input pressure should have inbuilt blending mechanism for fio2. should have good quality calibrated blender for mixing of air and oxygen with selectable fio2 (21% to 100%). the machine should have loss less blending mechanism & fio2 monitoring. equipment should also work without oxygen input should have builtin saftey valve with preset mode specific safety cutoff should have universal connections for circuit and attachements should have inbuilt battery back up upto 2 hours should have settable audio & visual alarm for low pressure, high pressure & safety pressure cutoff limit should be able to be mounted on the mobile stand for easy moving, and the stand should be equipped with bubble generator holding clamps with easy fixation. should be able to set output flow of 1 10 lpm can set fio2 from 21 100 % accuracy of flowmeters should be +/ 4%accuracy of pressure measurement should be +/ 1 cmh2o accuracy of fio2 should be +/ 3% should be able to set cpap pressure in bubble cpap mode from 3 10 cmh2o should be able to set cpap pressure in nasal cpap mode from 0 15 cmh2o setable pressure in auto t piece mode should be peep: 0 15 cmh2o & pip: 10 40 cmh2o should have settable as well as inbuilt safety over pressure valve up to 40cm h2o should be supplied by manufacturing company having iso 13485 certifications & ce for medical devices manufacturer should be an indian company with product made in india should be provided with single use nasal prongs (small, medium, large) single use nasal masks (small, medium, large), single use head bonnet (small, medium, large, xl) single use rams cannula (small, medium), single use neonatal patient circuit with single heater wire and humidifier chamber with autofeed should have audio visual alarm should be provided with us fda certified servo humidifier temperature sensor probe and heater wire adaptor humidifier specification mode – should have auto mode servo controlled for invasive, noninvasive ventilation & high flow default setting – should be 37 °c (invasive), 31 °c (noninvasive) should have an automatic temperature setting in invasive & non invasive mode temperature display should have the following alarms: temperature sensor, limb failure, chamber & patient end temperature alarm silence facility electrical specs. – input voltage 220 240 v / 110 127 v / 100v; 50/60hz standards – iec 60601 1, iec 60601 1 2, en iso 8185, ce certified, usfda preferred make: fisher & paykel/drager/biomed/hamilton/electrogenics/fanem. 8 pulse oxymeter (supply, installation and demonstration) hand held pulse oximeter with enhanced spo2 accuracy during motion artifacts and waveform and numeric value display 2.4 oled color display 96 hours data memory suitable for adult, pediatric and neonatal application mains as well as battery operation visual alarm indicator hand held unit with standard accessories: spo2 sensor with extension cable adapter for mains connection adaptor for mounting hand held unit operating manual manufacturer should be iso 13485 certified 9 multipara monitor (supply, installation and demonstration) should have facility to display ecg, rr, hr, pr, spo2, nibp, single temperature as standard parameters with in built rechargeable battery back up of at least 6 hrs of operation. display: touchscreen color tft lcd display of size 8” or more. should display at least 4 waveforms or more of dual trace ecg (cascaded ecg), spo2 and respiration simultaneously. should have st analysis & arrythmia analysis should have digital technology to sense the spo2 in hypotensive, shivering & motion condition. should have facility for displaying different screen configurations. should have audio visual alarms for all parameters & should be user selectable should have audio alarm silence selectable for 60 sec / 120 sec should have volume adjustable for audio alarms should have different color visual alarms as per set priority should have audio for qrs beep and volume should be adjustable should be able to store & display at least 72 hrs of graphical trends of all parameters. should be suitable for monitoring adult & pediatric patients. should be able to give visual & audible alarms with three levels of volume adjustment on violation of any monitored parameter. the monitor should be european ce approved. should be iso 13485 certified. power input to be 220 240vac, 50hz fitted with indian plug warranty: should have minimum 1yrs. of manufacturer warranty. make: niscomed/philips/ge healthcare/medtronic/mindray/cms/siemens/choicemmed/nidek/bpl/biotronic/honeywell/nihon/spacelabs/schiller 10 syringe pumps ((supply, installation and demonstration) display should be 3.5 inch backlit color lcd or touch 1. should have multiple infusion modes ( rate mode, weight mode ,time mode, sequence mode) 2. should have 9 occlusion levels 3. should be support syringes of all standard brands 4. should have auto detection of syringe size 5. should compatible with 5, 10, 20, 30 and 50(60)ml syringe 6. built in drug library (100 drugs) 7. should have infusion rate:0.1 2000ml/h,0.01ml/h (0.01ml/h increment till 100 ml/hr , 0.1ml/h increment from 100 1000ml/h and 1ml/h increment from 1000 2000ml/h) 8. should have bolus rate:0.1 2000ml/h 9. should have kvo 0.1 5ml/h 10. backup power for minimum 6 hours (optional 12 hours) 11. quoted item should be usfda/ european ce with 4 digit notified body. 12. bis approved or manufacturer should be iso 13485 certified preferred make: mindray/biocare/dre/byond/ge healthcare/akas/skanray/bpl/dre/braun/fresenius/contec 11 infusion pumps (supply, installation and demonstration) volumetric infusion pump technical specification: flow rate range: 1 to 1000 ml/hr. in normal mode, 1 ml / hr. increment, micro infusion mode: 0.1 to 100ml/hr. with 0.1 ml/hr increment. flow rate accuracy: accuracy of ±2% or better. infusion time: adjustable from 1 minute to 96 hours, 1 minutes increments. setting mode: flow rate, flow rate + volume, volume/time, flow rate +time, ramp up / ramp down, sequential, bolus, induction / loading dose, microinfusion. kvo rate: 3 ml / hr. adjustable pressure limit: 750 mmhg, adjustable from 100 to 900 mmhg (50 mmhg increment) history data log: up to 500 last data events. configuration: infusion mode, key board lock, kvo, pressure limit, display of drug name, time and hour setting, language, lcd contrast, alarm sound level, ward name, secret code, max. allowable flow rate, air bubble size, recall of last parameter on power on, display mode volume accumulating, end of infusion pre alarm setting. should have infusion line disconnection alarm should have infusion line pressure monitoring in mm of hg power supply: power input to be 220 – 240v ac, 50hz fitted with indian plug of appropriate rating battery backup: 3 6 hour quoted item should be usfda/ european ce with 4 digit notified body. bis approved or manufacturer should be iso 13485 certified. warranty: should have 1yrs. of manufacturer warranty. make: mindray/biocare/dre/byond/ge healthcare/niscomed/akas/skanray/bpl/dre/braun/fresenius/contec 12 cardiac table (supply, installation) cardiac table hospital adjustable table hospital table made with mild steel material laminated board top mounted on four 5 cm swivel castors manually adjustable height epoxy powder coated top size: 76(l)*40(w)cm height: 76/106c no 13 blanket phototherapy (supply, installation and demonstration) fibre optic based technology features: spectral irradiance: small pad 70 μw/cm /nm (+/ 25%) and 9 point check large pad 49 μwcm /nm (+/ 25%) and 6 point check wavelength: 460 470 nm fiberoptic lightpad, small : 12 x 30 cm (light emitting area) fiberoptic lightpad, large : 20 x 33 cm (light emitting area 15000 20000 hour led capability safety: no uv/ir/ emission length of fibre bundle: approx 170 cm sound level : <44 db at 1m power rating: 30w device automatically shuts off in the event of light engine over heating. should have complied with european ce 93/42 eec standard certification from a notified body iso 13485 certified preferred make:bilihu/biophoton/neotech/bpl/ibis/phoenix no 14 ambu bag for nicu for providing critical care during cardiopulmonary resuscitation, for patients undergoing endotracheal intubation or surgery under general anesthesia in nicu no 15 laryngoscope set for nicu no 16 diaper weighing machine no 17 baby weighing machine no 18 poc abg machine (supply, installation and demonstration) analyzer should be small lightweight (<1kg) handheld capable of measuring ph, pco2, po2, na+, k+, ca++, cl , glucose, lactate, creatinine/bun & hematocrit. calculated parameters: chb, ctco2, be, beecf, so2, hco3, egfr, a gap, a ado2. all the parameters should be performed simultaneously on a single use disposable test card. fast analysis time of less than 1 minute after sample introduction. analyzer should accept a small sample size of less than 100 μl. input: patient id, age, gender, height, temperature, fio2, sample type. sample types: arterial, venous cord & capillary whole blood. the analyzer should have the provision of storing at least 1000 patient and qc results. should display normal, outside reference range & critical patient results with color coded tiles. the test cartridges should be self contained with all the sensors & reagents and should not be separate. the test cartridges should be room temperature storable without the requirement of refrigeration. the analyzer should be provided with a dedicated wireless thermal printer. the analyzer should use amperometric, potentiometric, and conductometric measurement. the analyzer should have in built barcode readers for expiry control and patient data entry. analyzer should have dual power operation through ac adapter and/or rechargeable li ion battery. analyzer should have on board animation videos for user guidance. should have wireless connectivity facility for his/lis, remote updates etc. should be usfda and ce certified for all products and parameters. preferred make: abbott/siemens/radiometer/edan 19 jaundice meter a simple, effective, portable non invasive jaundice meter quick and easy to obtain bilirubin readings with minimal disturbance to the baby advanced optics and processing for highest accuracy suitable for screening infants from 35 weeks’ gestation power input: 3 vdc( 2aa batteries) measurement range: 0 32mg/dl measurement accuracy: ±1.5 mg/dl operating temperature: +10 to 50 c comliance: en 60601 1 20 vein viewer inbuilt rechargeable battary 3 intensity mode android charger 8 led total( 6 red+2 amber ) iso 9001:2015, iso 13845:2013, gmp, and ce certified 21 embrace warmer (supply, installation and demonstration) 1. the embrace warmer uses an effective phase change material to stabilise rapidly the temperature of an infant suffering from hypothermia. 2. the embrace warmer is light and portable. the baby can be held in the mother’s arms when the warmer is being used. 3. hygienic & durable: it can be reused several times. cleaning is easily done using soap and water. maintains temperature of ~37 degree c for at least 4 hours* (380mm x 220mm, 1.3kg) precision heating mechanism prevents overheating duration of at least 4 hours at ambient temperature greater than 25 c does not require constant power supply approx 15 watt of power consumption preferred make: phoenix/philips/neotech/ge healthcare 22 oxygen hood for nicu (infant use) transparent and curve shaped oxygen hood for neonatal oxygen therapy made with medical grade polycarbonate material. medical grade silicone flaps in the head opening area to adjust the neck size and make sure optimum oxygen concentration. small 21 cm ( diameter ) 16.5 cm ( height ) 12 cm ( neck opening ) medium 21 cm ( diameter ) 19 cm ( height ) 14cm ( neck opening ). accessories to be provided: tubings 01. shapes have enough space for baby head movement. its comes without any sharp corners and easy to clean and disinfect. the manufacturer should be iso 13485 certified. fully autoclavable. make: neotech/vng/david/ibis 23 crashcart crash cart ss frame 304 overall approx size 940mm l x 490 mm w x 1535 mm h stainless steel tubular frameprinciples for no six removable plastic bins & two polystrene lockable storage units with three drawers each four swivel castors, 150 mm dia (two with brakes) complete with corner buffers, oxygen cylinder holder, s s i v rod, s s top & shelves, cardiac massage board ss 304 24 bpc o2 flowmeter with jar usage nicu flow rate 15 l/min display analog tube cover material poly carbonate body material brass accuracy (flow rate) + 3% 25 portable suction machine technical specifications: minimum flow rate: 17 lpm minimum collection capacity: 600 ml make: philips/omron/drive devilbiss healthcare/resmed/niscomed/oxymed/lifeline/rossmax 26 cold light source (supply, installation and demonstration) use: cold light source is used for accessing tiny arteries and veins of the babies should have light intensity controlled with a smooth rotary potentiometer pressing button should have minimum dual control having 2 halogen/xenon/led lamps should have smps based design ensures smooth working of the light source within the voltage variation. dimensions/weight: length280mm, width 220mm, height from the floor:130mm weight up to 5kg heat dissipation heat is disbursed through an exhaust fan (if applicable). portability hand held device power requirements 230vac + 10%, 50 hz operating range: +15°c to 35°c environment storage range: 10°c to 60°c environment humidity: operating range: 15% to 90% rh non condensing storage range : 50% to 90% rh variable intensity : 0 to 100% continues. optical cable: 6mm diameter & 1m length on time: 5min & 10min selectable. display parameters :% of intensity, usage hours & timer alarm indication: fan fail, temperature sensor fail, light source over temperature. preferred make: neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care certifications: quality: iso 13485:2016, electrical safety: iec 60601 1, emc safety: iec 60601 1 2 should complied with european ce 93/42 eec standard certification from a notified body spares: illumination lamps: 2 nos. spares preferred make: neotech/zeal/ge healthcare/drager/ardo/healforce/phoenix/v care 27 dressing trolley with bowl & bucket for use in nicu s.s. frame work s.s. shelves with four side railing on castors size : 76 x 46 x 81 cm 28 instrument trolley ss with 4 wheels overall size 60 l x 45 w x 80 h cms ms tubular construction with ss top & shelf three side guard railing on upper shelf ss 304 29 revolving stool four legs s s tubular construction s s revolving top adjustable height with m s screw mechanism epoxy powder coated30 iv stands i.v. stand, 31 dia 2 hook iv stands wheel mounted on a plastic base with ms pipe , adjustable height from 55” to 95” 31 infant t piece resuscitator (supply, installation and demonstration) can deliver oxygen levels ranging from 21% through to 100%, from a flow meter or blender. the resuscitator has a pip control, as well as a maximum pressure relief valve that prevents the accidental delivery of excessively high pressures. resuscitator should features an accurate, easy to read, medical quality manometer, and can be mounted on a pole, rail, wall, infant warmer, or incubator. manometer range 20 to 80 cmh2o [mbar] manometer accuracy +/ 2.0% of full scale deflection maximum pressure relief @ 7lpm 1 to 66 cmh2o o [mbar](dependent on flow rate) storage range: 40% to 90% rh non condensing operating range: 15% to 90% rh non condensing recommended patient body weight 0 to 10 kg (22 lb) delivered oxygen concentration up to 100% depending on the gas supply operating time* (400 l cylinder) 50 minutes @ 8 l/min components: gas supply line; gas inlet adaptor; test lung; spare max pressure relief quality/test approval quality: iso 13485:2016 device standard: iso 10651 5 iso 10993 mdd product classification: class iib protection against increase of liquid : ipx4 european ce certified preferred make: zeal/fisher& paykel/neotech/ge healthcare/neotech/flexicare 32 oxygen panel and piping (supply, installation and demonstration) minimum 3 oxygen outlet. pipe should be of isi mark. approximate piping lenth: 10 ft pipe thickness must be of 12mm. mox regulator should be there to control the pressure. angle & t copper 33 oxygen cylinder (filled) (supply, installation and demonstration) jumbo type with regulator and trolley 34 syringe pump stand (supply & installation) no. of shelves: 1 shelve 2 saline hook framework material: ss mounted on moveble caster/wheel with electrical socket where 8 syringe pump can be plugged 35 observation trolley soft mattress for comfortable baby laying large working area mattress tilt ±30° on both side provision to take x ray without disturbing the baby 4 nos collapsible acrylic panels with plastic hinges 4” castor 4 nos (2 with brake and 2 without brake) storage tray option underneath the bed 36 hospital child bed 1650x780x630, height adjustable side rail, back rest lifting angle. epoxy powder coated 37 icu bed motorized electric operated five functions motorized hospital bed electrically operated with luxury castors central lockingsize: 2120x1000x460 720mm (lxwxh) • function at back rest, footrest, hi/lo adjustment, forward tilting, backward tilting with cable remote control. • epoxy powder coated bed frame, mounted on central locking luxury castors. • bed board link of soft, pp hiding side rails. quick release handle at back side pillow and mattress 4” thick made of pu foam with one side rexine & other side cotton cloth with food table and bed side locker make: hill rom/stryker/getinge/linet/invacare/paramount/arjo/joerns /drive devilbiss/skytron/steris or equivalent brands having bed production facility of us fda registered. bed to be european ce and facility to be iso 9001, 14001 and 13485 approved 38 icu bed, manual five functions motorized hospital bed manually operated with luxury castors central locking size: 2120x1000x460 720mm (lxwxh) • function at back rest, footrest, hi/lo adjustment, forward tilting, backward tilting with cable remote control. • epoxy powder coated bed frame, mounted on central locking luxury castors. • bed board link of soft, pp hiding side rails. quick release handle at back side pillow and mattress 4” thick made of pu foam with one side rexine & other side cotton cloth with food table and bed side locker make: paramount/arjo/joerns /drive devilbiss/medline /savion/khera/sng/narang/bpl/sigma/acme/prana or equivalent brands 39 glucometer technical specifications for glucometer: measurement range: 20 to 600 mg/dl (1.1 to 33.3 mmol/l) accuracy: ±10% deviation from laboratory reference values sample size: maximum 0.5 microliters of blood per test testing time: maximum 10 seconds memory and data management: minimum memory storage capacity of 500 test results, with data transfer capability to electronic medical record systems or computers display: clear and easy to read display, preferably with a backlit feature for enhanced visibility power source: long lasting battery life, support for disposable batteries and rechargeable options, with low battery status indication make/brands: accu chek (roche)onetouch (lifescan)/dr. morepen/johnson & johnson/omron/ bayer contour/ beurer/abbott /apollo/smart care 40 bp apparatus manual (mercury) iso / ce standard included components adult size cuff with velcro closure , owners manual , mercury fixed ready to use item weight 450.0 grams material type forged number of items 1 size regular special features high accurate readings specific uses for product clinic long lasting heavy duty silicone tubings ce certified , 4.2 mm capillary & hard metal body product should include all the necessory accesorries required for intented use. clear reading make: diamond/romson/dr trust/philips/ge/bpl/omron/rossmax/healthsense/beurer 41 digital bp apparatus manual iso / ce standard included components adult size cuff with velcro closure , owners manual type: upper arm, fully automated display: lcd measurement method: oscillometric method minimum pressure measurement range: 20 mmhg maximum pressure measurement range: 280 mmhg minimum pulse measurement range: 40 beats/min maximum pulse measurement range: 180 beats/min pulse measurement accuracy: +5 pressure measurement accuracy: +3 size regular special features high accurate readings specific uses for product: clinic, training nurses long lasting heavy duty silicone tubings product should include all the necessory accesorries required for intented use. make: dr trust/philips/ge/bpl/omron/rossmax/healthsense/beurer/romson/diamond 42 nibp (non invasive blood pressure) machine: 1. measurement range: 1.1. systolic pressure: 40 260 mmhg 1.2. diastolic pressure: 20 200 mmhg 1.3. mean arterial pressure (map): 30 240 mmhg 2. measurement method: 2.1. non invasive measurement using inflatable cuff 2.2. utilizes oscillometric or auscultatory method 3. accuracy: provides clinically acceptable blood pressure readings 4. cuff size: multiple sizes available for different arm circumferences 5. display: clear display of blood pressure measurements and additional information 6. memory and data management: stores and retrieves previous readings, data transfer capability 7. power source: battery or mains power, battery option for portability brands: omron / philips / ge healthcare / welch allyn / nihon kohden / dräger / mindray / schiller / bpl medical technologies / contec medical systems no 43 stethoscope dual non stick acoustic tubing provides insulation for superior sound included accessories: 2 extra sets comfort seal ear tips, spare adult and pediatric clear pvc diaphragms, pediatric diaphragm assembly, pediatric bell, infant bell and id tag intended use: adult, infant, pediatric approximate weight: 150 250 gm earpieces: earpieces should occlude your ear and block out most or all room noise. they should be comfortable yet snug and should follow the natural forward angle of the ear canals. tubing: the tubing should be sturdy and no longer than absolutely necessary. head: the head of the stethoscope should have a bell (a cup shaped side) and a diaphragm manufacturer is certified for iso 13485 medical devices. brands: littmann/rossmax/romson/healthsense/technocare/omron/mdf no 44 ultrasonic mesh nebulizer machine technical parameters: nebulization technology: ultrasonic mesh for fine aerosol production. medication compatibility: works with a range of medications. particle size: produces small particles for effective inhalation. no silent operation: quiet for patient comfort. battery life: long lasting for portable use. dosing control: precise medication delivery. easy maintenance: simple disassembly and cleaning. portability: compact and lightweight design. user interface: intuitive controls for easy operation. mask compatibility: suitable for various mask sizes. certification: complies with relevant industry standards. make: 1. philips/omron/dr. morepen/rossmax/agaro/healthsense/bpl/beurer/dr. trust 45 nebulizer for nicu particle size: fine aerosol particles for neonatal inhalation. medication compatibility: suitable for various nicu medications. silent operation: quiet operation for infant comfort. dosing accuracy: precise medication delivery control. continuous nebulization: capable of extended treatment. oxygen compatibility: accommodates oxygen therapy. user interface: intuitive controls for easy use. safety features: prevents overmedication risks. compact design: space efficient for nicu placement. easy maintenance: disassembles for cleaning. mask compatibility: fits neonatal masks. certification: iso compliant manufacturing. make: 1. philips/omron/dr. morepen/rossmax/agaro/healthsense/bpl/beurer/dr. trust 46 oxygen concentrator (supply, installation and demonstration): for use in nicu oxygen concentrator 5 lpm: flow rate: 5 liters per minute oxygen purity: typically around 93% (+/ 3%) power source: electric (ac) weight: standard range, usually between 14 to 18 kg dimensions: compact and portable design noise level: low decibel range for quiet operation filters: built in air intake filters for clean air supply oxygen delivery: continuous flow mode user interface: intuitive controls and lcd display alarms: visual and audible alarms for low oxygen concentration and power failure accessories: nasal cannula, humidifier bottle, filter replacements compliance: designed for medical use and regulatory compliance make: philips/devilbiss/nidek/inogen/oxymed/airsep 47 12 channel ecg machine with monitor and electrodes technical parameters: channels: 12 simultaneous channels for comprehensive cardiac monitoring. electrodes: high quality electrodes for accurate signal acquisition. display: clear display of 12 lead ecg data for real time analysis. printing:high resolution printing for detailed ecg reports. sampling rate: high sampling rate for precise waveform capture. interpretation: built in ecg interpretation algorithms for efficient analysis. filters: signal filters to eliminate interference and ensure accuracy. recording speed: adjustable recording speeds for various assessments. connectivity: usb or bluetooth connectivity for data transfer. battery backup: reliable battery backup for uninterrupted operation. make: ge healthcare/philips/schiller/bpl/nihon kohden/edan instruments/mindray/cardiac science/contec 48 steriliser make: goley / surya or equivalent 49 spring balance medical spring balance technical specifications: wide measurement range high accuracy durable construction clear display tare function overload protection portable design easy calibration no 50 intrauterine device (iud) thats inserted into the uterus for long term birth control (contraception). t shaped plastic frame has copper wire coiled around the stem and two copper sleeves along the arms that continuously release copper to bathe the lining of the uterus. it produces an inflammatory reaction in the uterus that is toxic to sperm, which helps prevent fertilization. no 51 pelvimeter pelvimeter technical specifications: material: high quality medical grade materials measurement range: suitable for various pelvic measurements accuracy: precise measurement graduations easy to read scale lightweight and portable design ergonomic handle for comfortable use durable and long lasting construction suitable for clinical and educational use no 52 delivery couch technical specifications: convertible design: easily converts into operating table for emergency caesarian section adjustable backrest for patient comfort removable headboard for versatility leg supports for secure positioning removable foot section for accessibility height adjustable: minimum 60 cm, maximum 90 cm smooth mobility: equipped with diagonally lockable 12 cm diameter castors corner bumpers for protection removable drain pan for easy cleaning no 53 foetal dopler ultrasound frequency: 3mhz ultrasound intensity: <10mw/cm2 power supply: alkalinity battery display: 45mm×25mm lcd fhr measuring range: 50~240bpm fhr resolution: 1bpm fhr accuracy: ±1bpm power consumption: <1w dimension :135mm ×95mm ×35mm weight:500g configuration: main body 3mhz probe feature table: functions: display b/w backlight:yes build in speaker : yes battery indicator:yes fhr display: yes auto power off: yes various work modes :yes alkalinity battery:yes make: life line / bpl/dipel/phillips/ sonoline/angelsounds/huntleigh/bistos/contec or equivalent no 54 automatic hematology analyzer: specifications: measurement parameters: complete blood count (cbc): hemoglobin, hematocrit, red blood cells (rbc), white blood cells (wbc), platelet count, mean corpuscular volume (mcv), mean corpuscular hemoglobin (mch), mean corpuscular hemoglobin concentration (mchc), red cell distribution width (rdw), and other relevant parameters. differential blood count: neutrophils, lymphocytes, monocytes, eosinophils, basophils, and other relevant subtypes. throughput: high throughput capacity capable of processing a large number of samples per hour, ideal for high volume laboratories and hospitals. sample types: accepts various sample types, including whole blood, serum, plasma, and diluted samples. sample volume: minimal sample volume required for analysis to minimize patient discomfort and conserve sample volume. automation: fully automated operation for sample handling, analysis, and result generation. automated sample identification and barcode scanning for sample tracking and data integrity. analysis method: utilizes advanced impedance or flow cytometry technology for accurate and reliable blood cell analysis. may noinclude laser based optical systems for specific measurements. user interface: intuitive and user friendly graphical interface for easy operation and navigation. touchscreen display with clear visualization of data and results. connectivity: built in connectivity options such as ethernet, usb, and lis (laboratory information system) integration for data transfer, result reporting, and remote access. quality control: integrated quality control features to ensure accuracy and precision of results. calibration options and automated quality control checks to maintain instrument performance. maintenance: self diagnostic capabilities for proactive maintenance and troubleshooting. automated cleaning and maintenance routines to ensure instrument reliability and longevity. size and weight: compact and space saving design suitable for laboratory environments. portable options available for on site or point of care testing. power requirements: operates on standard electrical power supply (e.g., 110 240v, 50 60hz). compliance: meets relevant regulatory standards and certifications (fda, ce, iso). make: sysmex corporation/beckman coulter inc./siemens healthineers/abbott laboratories/mindray medical international limited/roche diagnostics/horiba medical/nihon kohden corporation/boule diagnostics /erba/bio rad 55 laryngoscope sets, s.s. (with s.s. handle) satin / dull finish, with 4 s.s. blades size: 1,2,3 & 4 56 nasal cannula delivers:24 30% oxygen, flow rate :1 4l/min, manufactured from soft, non toxic medical grade material, made up of kink resistant pvc tube 57 high flow nasal cannula deliver:21 100% oxygen, flow rate: upto 60l/min, manufactured from soft, non toxic medical grade material, made up of kink resistant pvc tube 58 venturi mask delivers: 24 60% oxygen, flow rate: 2 15l/min, tube length 7 ft, manufactured from soft, non toxic medical grade material, 100% latex free 59 non rebreather mask delivers: 85 90% oxygen, flow rate: 10 15l/min, bag on mask with valves stopping almost all rebreathing of expired air, manufactured from non toxic medical grade material 60 face mask delivers: 40 60% oxygen, flow rate: 05 10l/min, manufactured from non toxic medical grade material 61 digital haemoglobinometer photometry based system for estimation of haemoglobin. 2 linearity range 2g/dl to 25 g/dl or beyond.. 3 open reagent system.. 4 led light source. 5 display of results in g/dl. 6 connectivity to pc and printer. 7 accessories to be supplied: along with equipment a micro pipette 2.5 ml : 1 no. b lancing device 1 unit c lancettes : 50 nos d cuvettes with rubber caps – 5 nos e capillaries – 50 nos make: labtronics/ekf/mission/accu/accon...

Department of Higher Education - Jharkhand

39120271 bids are invited for tracksuits , jerseys , sports cap , duffle gym bag , stockings , sports shoes for warm up march past , water polo costume v shape , event costume jammer , event costume single piece , water polo ear protection cap , swimming event cap white , towel total quantity : 2084...

Health Medical Education And Family Welfare Department - Jharkhand

39104137 bids are invited for steel dinner set ( q3 ) , lunch box ( q3 ) , steel tea cup set ( q3 ) , steel water bottle ( q3 ) , veg bowl set of 6 ( q3 ) , sanx plate ( q3 ) , mens wallet ( q3 ) , insulated lunch box ( q3 ) , ladies bag ( q3 ) total quantity : 14938...

East Central Railway - Jharkhand

39089885 supply of loco pilot tool kit pocket type bag with cover , belt and cover lock , size 14 x 9 high quality semi water proof lather [ warranty period: 30 months after the date of delivery ] ...

Department of Ex-Servicemen Welfare - Jharkhand

39075757 bids are invited for stationery register , red pen , blue pen , black pen , marker , whitener , fevi stick , stapler , stapler pin , dp punch , cello tape , zip lock plastic bag , stick notepad , highlighter , a4 paper , sticky notes , fevicol , scaler , box file , register four core , cartridge for printer total quantity : 367...